Your browser is old and dusty. Try Google Chrome!

Details for slr1870

ORF slr1870
Accession NP_440987.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -130 -144 15.9292 0.104
NP_441061.1_2 Forward -148 -134 6.98109 0.11
NP_440795.1_7 Forward -391 -384 14.6904 0.0123
NP_440795.1_7 Reverse -384 -391 14.6904 0.0123
NP_441453.1_4 Reverse -383 -391 16.539 0.00633
NP_441453.1_4 Forward -392 -384 16.539 0.00633
NP_442151.1_6 Reverse -383 -397 13.4709 0.0512
NP_442151.1_6 Forward -392 -378 5.70279 0.266
NP_441818.1_9 Reverse -372 -391 -8.16202 0.274
NP_441818.1_9 Reverse -333 -352 -8.26035 0.276
NP_440226.1_1 Forward -392 -373 7.96426 0.0959
NP_441342.1_2 Forward -396 -382 10.3243 0.209
NP_441098.1_3 Forward -79 -60 -1.14243 0.268
NP_440996.1_3 Reverse -370 -388 18.3087 0.0908
NP_440996.1_3 Reverse -362 -380 17.0304 0.114
NP_442287.1_1 Forward -150 -140 14.6309 0.256
NP_442173.1_1 Forward -391 -383 15.4574 0.00633
NP_442173.1_1 Reverse -384 -392 15.4574 0.00633
NP_442752.1_4 Forward -392 -385 13.8055 0.0199
NP_442752.1_4 Reverse -383 -390 13.8055 0.0199
NP_443027.1_4 Forward -394 -384 7.25653 0.24
NP_443027.1_4 Reverse -381 -391 5.87989 0.294
NP_441812.1_3 Reverse -382 -396 6.88276 0.287
NP_442975.1_10 Reverse -379 -393 19.0751 0.00482
NP_442975.1_10 Forward -396 -382 1.37564 0.299
NP_441225.1_1 Forward -390 -371 7.96426 0.0498
NP_441225.1_4 Forward -153 -134 -12.3902 0.284
NP_440784.1_7 Forward -391 -384 15.9687 0.0123
NP_440784.1_7 Reverse -384 -391 15.9687 0.0123
NP_442062.1_3 Forward -176 -157 1.67108 0.226
NP_442062.1_8 Forward -392 -382 19.4496 0.000558
NP_442062.1_8 Reverse -383 -393 10.3048 0.0493
NP_440304.1_4 Forward -394 -384 10.8948 0.051
NP_440304.1_4 Forward -84 -74 2.83163 0.299
NP_440304.1_4 Reverse -381 -391 1.84832 0.299
NP_442242.1_4 Forward -391 -384 14.3954 0.0124
NP_442242.1_4 Reverse -384 -391 14.3954 0.0124
NP_440044.1_8 Forward -223 -204 -1.7705 0.251
NP_442762.1_10 Reverse -292 -311 -18.5851 0.297
NP_441208.1_9 Forward -395 -381 7.17775 0.226
NP_442110.1_7 Forward -312 -298 4.03116 0.208
NP_441083.1_5 Forward -392 -382 11.3864 0.0159
NP_441083.1_5 Reverse -383 -393 11.2881 0.0159
NP_442827.1_10 Reverse -302 -321 19.9606 0.248
NP_441434.1_7 Forward -390 -376 1.86788 0.29
NP_441738.1_2 Forward -390 -383 15.28 0.0102
NP_441738.1_2 Reverse -385 -392 15.28 0.0102
NP_441558.1_5 Forward -394 -375 6.19431 0.225
NP_440209.1_1 Reverse -383 -391 18.1123 0.00295
NP_440209.1_1 Forward -392 -384 18.1123 0.00295
NP_442136.1_4 Reverse -55 -74 4.81688 0.297
NP_442889.1_8 Reverse -380 -394 11.307 0.0733
NP_441713.1_1 Reverse -377 -396 -6.39206 0.118
NP_441770.1_4 Reverse -196 -215 -10.1286 0.267
NP_441770.1_4 Reverse -334 -353 -10.7186 0.278
NP_440178.1_7 Forward -393 -374 -9.73531 0.071
NP_441327.1_1 Reverse -153 -172 7.5772 0.232
NP_442111.1_4 Forward -393 -379 6.48943 0.123
NP_440906.1_5 Forward -391 -384 15.8704 0.0124
NP_440906.1_5 Reverse -384 -391 15.8704 0.0124
NP_440747.1_10 Forward -395 -383 5.54551 0.0128
NP_440747.1_10 Reverse -380 -392 5.34885 0.0141
NP_441486.1_1 Forward -395 -381 13.5693 0.0082
NP_441486.1_1 Reverse -380 -394 5.80112 0.0344
NP_440944.1_2 Reverse -277 -296 -1.27885 0.259
NP_441695.1_4 Forward -147 -129 10.7372 0.26
NP_442848.1_4 Reverse -340 -354 6.98109 0.282
NP_443018.1_3 Forward -391 -384 14.8871 0.0123
NP_443018.1_3 Reverse -384 -391 14.8871 0.0123
NP_441316.1_7 Reverse -381 -396 3.42148 0.141
NP_440376.1_1 Forward -392 -383 19.4693 0.000692
NP_440376.1_1 Reverse -383 -392 19.4693 0.000692
NP_440376.1_1 Reverse -140 -149 2.06468 0.236
NP_441588.1_4 Forward -390 -380 14.238 0.0773
NP_441588.1_4 Reverse -385 -395 6.96153 0.178
NP_442687.1_7 Reverse -382 -392 15.8113 0.0125
NP_442687.1_7 Forward -393 -383 9.02648 0.0994
NP_441013.1_2 Forward -143 -125 -3.91409 0.295
NP_441422.1_7 Reverse -381 -398 -7.53264 0.259
NP_440360.1_9 Forward -178 -159 12.4875 0.243
NP_442658.1_1 Reverse -381 -391 15.9091 0.00966
NP_442658.1_1 Forward -394 -384 13.0576 0.04
NP_442782.1_2 Reverse -257 -271 3.63784 0.263
NP_442205.1_9 Forward -398 -382 -0.826444 0.264
NP_441414.1_9 Forward -392 -373 8.75091 0.0265
NP_442937.1_5 Reverse -378 -397 11.8975 0.126
NP_441958.1_5 Forward -393 -383 21.2195 0.000805
NP_441958.1_5 Reverse -382 -392 12.2714 0.00183
NP_441958.1_5 Reverse -302 -312 -1.19994 0.231
NP_440203.1_5 Reverse -386 -396 10.206 0.235
NP_440203.1_5 Forward -146 -136 9.51767 0.254
NP_439905.1_1 Reverse -384 -397 9.45906 0.219
NP_440984.1_7 Forward -397 -383 11.6026 0.122
NP_440984.1_7 Reverse -378 -392 7.86607 0.161
NP_439990.1_5 Forward -397 -384 5.82081 0.272
NP_442690.1_1 Forward -301 -282 -11.0136 0.221
NP_442911.1_2 Reverse -373 -392 -2.95047 0.105
NP_441580.1_6 Reverse -372 -391 -5.11376 0.235
NP_443055.1_3 Reverse -248 -267 11.6 0.25
NP_443055.1_6 Reverse -375 -393 5.72158 0.177
NP_443055.1_6 Reverse -289 -307 0.510066 0.242
NP_441348.1_9 Reverse -376 -395 13.1758 0.286
NP_442853.1_10 Forward -151 -132 13.2733 0.168
NP_441099.1_5 Reverse -373 -392 -9.53865 0.226
NP_442002.1_9 Reverse -189 -196 13.9038 0.141
NP_442002.1_9 Reverse -382 -389 10.7572 0.185
NP_441000.1_6 Forward -393 -379 -3.63866 0.225
NP_441000.1_6 Reverse -382 -396 -5.60527 0.285
NP_440147.1_4 Reverse -381 -394 12.114 0.0326
NP_440147.1_4 Forward -394 -381 11.7207 0.0326
NP_441550.1_8 Forward -394 -384 15.3192 0.0132
NP_441550.1_8 Reverse -381 -391 8.3377 0.124
NP_441916.1_7 Reverse -383 -393 18.9579 0.00144
NP_441916.1_7 Forward -392 -382 18.4663 0.00144
NP_440465.1_10 Forward -395 -376 -1.7705 0.297
NP_441041.1_4 Forward -392 -373 10.2259 0.0289
NP_441041.1_7 Reverse -380 -392 9.55551 0.109
NP_441041.1_7 Forward -395 -383 8.38938 0.137
NP_442396.1_5 Reverse -379 -392 9.95071 0.128
NP_442004.1_6 Reverse -383 -397 5.50613 0.19
NP_440703.1_9 Forward -188 -175 6.60689 0.284
NP_441725.1_5 Forward -391 -381 2.04498 0.115
NP_441725.1_5 Reverse -384 -394 1.94665 0.115
NP_439966.1_7 Reverse -381 -391 9.91099 0.0968
NP_439966.1_7 Forward -394 -384 6.27276 0.185
NP_439966.1_9 Reverse -381 -390 0.884706 0.253
NP_440202.1_4 Reverse -115 -134 16.9124 0.265
NP_442941.1_3 Reverse -384 -394 11.0914 0.0116
NP_442941.1_3 Forward -391 -381 2.63497 0.14
NP_440289.1_2 Reverse -380 -393 -3.71729 0.267
NP_440983.1_5 Forward -148 -129 -0.787193 0.228
NP_442281.1_1 Reverse -378 -392 10.8154 0.0537
NP_440177.1_9 Reverse -375 -394 14.6508 0.213
NP_441457.1_7 Forward -394 -375 0.884433 0.276
NP_442288.1_5 Forward -91 -77 14.4542 0.283
NP_440498.1_1 Reverse -374 -392 4.14905 0.131
NP_440375.1_8 Forward -391 -372 0.58944 0.26
NP_441644.1_6 Reverse -383 -393 19.0557 0.000803
NP_441644.1_6 Forward -392 -382 10.1076 0.0628
NP_440652.1_10 Reverse -137 -156 6.98095 0.283
NP_442215.1_2 Reverse -381 -397 -2.49807 0.198
NP_442177.1_5 Reverse -137 -151 9.04604 0.255
NP_442247.1_8 Forward -394 -380 10.9143 0.247
NP_440253.1_2 Forward -392 -374 -2.53746 0.268
NP_440929.1_8 Forward -392 -383 19.2726 0.000701
NP_440929.1_8 Reverse -383 -392 19.2726 0.000701
NP_441346.1_7 Reverse -345 -364 18.6823 0.122
NP_442933.1_10 Forward -392 -383 17.601 0.00325
NP_442933.1_10 Reverse -383 -392 17.601 0.00325
NP_441751.2_8 Reverse -384 -398 5.01447 0.0448
NP_442554.1_8 Reverse -384 -394 16.4013 0.0065
NP_442554.1_8 Forward -391 -381 13.2547 0.0187
NP_441762.1_7 Forward -393 -381 10.2654 0.0142
NP_441762.1_7 Reverse -382 -394 9.47875 0.0142
NP_442142.1_4 Reverse -380 -393 5.23026 0.197
NP_442142.1_4 Forward -395 -382 5.0336 0.204
NP_442142.1_4 Forward -345 -332 3.16532 0.265
NP_442292.1_1 Reverse -384 -393 17.5026 0.00435
NP_442292.1_1 Forward -391 -382 9.63616 0.0183
NP_442476.1_6 Forward -391 -377 4.42448 0.143
NP_443009.1_5 Forward -393 -382 19.626 0.00102
NP_443009.1_5 Reverse -382 -393 7.82632 0.118
NP_442406.1_9 Reverse -290 -309 2.3594 0.271
NP_442301.1_2 Forward -366 -347 9.93006 0.2
NP_441715.1_4 Forward -391 -381 9.41981 0.097
NP_441715.1_4 Reverse -384 -394 7.35486 0.108
NP_440357.1_3 Reverse -381 -400 5.211 0.242
NP_440777.1_9 Reverse -278 -297 4.916 0.255
NP_441198.1_8 Forward -394 -384 12.783 0.116
NP_441468.1_1 Forward -391 -384 15.8704 0.0124
NP_441468.1_1 Reverse -384 -391 15.8704 0.0124
NP_441020.2_6 Forward -394 -377 7.217 0.237
NP_441673.1_1 Forward -392 -383 20.8459 0.000698
NP_441673.1_1 Reverse -383 -392 20.8459 0.000698
NP_441330.1_1 Forward -397 -378 -11.7019 0.183
NP_441330.1_1 Forward -137 -118 -13.2752 0.183
NP_441764.1_4 Forward -178 -161 11.2231 0.231
NP_441764.1_4 Forward -169 -152 10.8411 0.237
NP_442868.1_6 Forward -394 -384 0.963343 0.205
NP_442868.1_6 Reverse -381 -391 0.865012 0.205
NP_442719.1_2 Reverse -282 -300 -9.81463 0.267
NP_442427.1_10 Reverse -361 -380 8.35677 0.266
NP_442808.1_1 Reverse -382 -392 18.4657 0.00201
NP_442808.1_1 Forward -393 -383 8.73102 0.0481
NP_440145.1_3 Reverse -373 -392 1.67108 0.125
NP_440145.1_3 Forward -252 -233 -2.0655 0.161
NP_442050.1_5 Forward -394 -384 9.22267 0.193
NP_440038.1_2 Reverse -335 -354 13.4708 0.267
NP_441878.1_6 Forward -393 -383 10.5014 0.0176
NP_441878.1_6 Reverse -382 -392 10.4031 0.0176
NP_441036.1_8 Reverse -382 -392 17.7779 0.000554
NP_441036.1_8 Forward -393 -383 15.713 0.00724
NP_441036.1_8 Forward -200 -190 9.12481 0.174
NP_441036.1_8 Reverse -302 -312 7.35486 0.201
NP_441557.1_5 Forward -392 -383 19.9609 0.000699
NP_441557.1_5 Reverse -383 -392 19.9609 0.000699
NP_442066.2_4 Reverse -98 -117 -8.94866 0.296
NP_441739.1_2 Reverse -73 -89 5.36772 0.228
NP_440101.1_3 Reverse -129 -148 3.6377 0.226
NP_442183.1_1 Forward -392 -378 8.84938 0.107
NP_441819.1_5 Forward -300 -281 15.9945 0.195
NP_441574.1_1 Reverse -371 -390 -0.39387 0.206
NP_442347.1_2 Forward -391 -382 11.1111 0.056
NP_442347.1_2 Reverse -384 -393 3.34298 0.284
NP_442645.1_2 Reverse -375 -394 -2.75381 0.0487
NP_442645.1_2 Forward -400 -381 -14.6519 0.177
NP_441037.1_4 Forward -394 -384 15.0168 0.028
NP_441037.1_4 Reverse -381 -391 14.7245 0.028
NP_441037.1_4 Reverse -188 -198 13.0677 0.0753
NP_441633.1_3 Reverse -381 -394 3.36254 0.0699
NP_441633.1_3 Forward -394 -381 1.39592 0.109
NP_440136.1_2 Forward -391 -384 15.9687 0.0123
NP_440136.1_2 Reverse -384 -391 15.9687 0.0123
NP_442590.1_10 Reverse -250 -269 4.52268 0.274
NP_441728.2_4 Forward -170 -151 14.2756 0.23
NP_442998.1_10 Forward -390 -383 15.5754 0.0102
NP_442998.1_10 Reverse -385 -392 15.5754 0.0102
NP_440299.1_1 Reverse -379 -392 10.9334 0.0529
NP_441799.1_1 Forward -396 -382 23.3033 0.00206
NP_441799.1_1 Reverse -379 -393 13.2736 0.0337
NP_441007.1_10 Forward -397 -384 3.5592 0.182
NP_442201.1_10 Reverse -372 -391 -12.9802 0.27
NP_440256.1_1 Forward -395 -376 -3.24547 0.129
NP_440256.1_1 Reverse -329 -348 -9.047 0.273
NP_440709.1_1 Reverse -157 -176 12.7816 0.0464
NP_441559.1_8 Forward -397 -383 1.08123 0.156
NP_440915.1_5 Reverse -184 -203 15.006 0.283
NP_440915.1_6 Reverse -379 -393 4.81781 0.0953
NP_441464.1_8 Forward -392 -378 6.48943 0.232
NP_441464.1_8 Reverse -383 -397 6.09611 0.247
NP_440695.1_6 Forward -82 -68 16.5197 0.135
NP_441199.1_6 Reverse -379 -398 -1.18052 0.287
NP_441199.1_7 Forward -179 -160 13.1758 0.136
NP_442993.1_1 Reverse -383 -399 -1.80975 0.101
NP_442993.1_1 Forward -392 -376 -9.38124 0.185
NP_442386.1_9 Reverse -382 -391 15.7322 0.0144
NP_442386.1_9 Forward -393 -384 6.39082 0.219
NP_442386.1_9 Forward -150 -141 6.29249 0.226
NP_441340.1_5 Forward -391 -384 15.6737 0.0124
NP_441340.1_5 Reverse -384 -391 15.6737 0.0124
NP_441160.1_1 Forward -367 -348 -3.14714 0.236
NP_440586.1_8 Forward -391 -384 13.2151 0.026
NP_440586.1_8 Reverse -384 -391 13.2151 0.026
NP_442251.1_6 Forward -391 -384 15.2804 0.0124
NP_442251.1_6 Reverse -384 -391 15.2804 0.0124
NP_440684.1_9 Reverse -377 -391 8.84938 0.223
NP_441262.1_3 Reverse -383 -390 14.7888 0.0223
NP_441262.1_3 Forward -392 -385 14.7888 0.0223
NP_443051.1_1 Forward -393 -384 19.5676 0.00335
NP_443051.1_1 Reverse -382 -391 10.4228 0.00754
NP_441232.1_10 Reverse -372 -391 2.16274 0.255
NP_439937.1_9 Reverse -382 -399 -6.64833 0.157
NP_439937.1_9 Forward -200 -183 -7.92662 0.171
NP_439937.1_9 Forward -374 -357 -12.8431 0.276
NP_439937.1_9 Forward -375 -358 -12.9415 0.278
NP_439937.1_9 Reverse -351 -368 -16.7764 0.287
NP_441595.1_2 Forward -78 -65 8.36957 0.292
NP_440439.1_1 Forward -395 -382 11.524 0.033
NP_440439.1_1 Reverse -380 -393 1.00259 0.164
NP_440372.1_2 Forward -391 -384 16.3621 0.0124
NP_440372.1_2 Reverse -384 -391 16.3621 0.0124
NP_440267.1_2 Forward -386 -372 5.30886 0.272
NP_442384.1_10 Reverse -383 -396 15.1623 0.0113
NP_442384.1_10 Forward -392 -379 7.09911 0.0875
NP_442262.1_10 Forward -391 -384 14.1988 0.0123
NP_442262.1_10 Reverse -384 -391 14.1988 0.0123
NP_441689.1_5 Forward -394 -384 8.3377 0.132
NP_440344.1_10 Reverse -376 -393 -7.72931 0.119
NP_440344.1_10 Forward -399 -382 -9.99092 0.163
NP_440531.1_6 Forward -400 -381 5.40766 0.115
NP_440531.1_6 Reverse -132 -151 -4.42544 0.28
NP_441335.1_8 Reverse -338 -357 9.3409 0.228
NP_440826.1_5 Reverse -189 -207 17.4161 0.231
NP_441965.1_10 Reverse -380 -396 11.7599 0.107
NP_440297.1_9 Forward -305 -295 6.66654 0.178
NP_440297.1_9 Forward -391 -381 -0.118297 0.282
NP_440297.1_9 Reverse -384 -394 -0.216628 0.282
NP_440999.1_1 Forward -353 -334 20.2548 0.0215
NP_440888.1_2 Forward -392 -378 8.06211 0.172
NP_440888.1_2 Reverse -383 -397 5.50552 0.276
NP_440873.1_1 Forward -119 -100 4.52268 0.294
NP_440052.1_5 Reverse -372 -391 14.9458 0.0714
NP_440575.1_1 Forward -158 -139 -0.39464 0.29
NP_441543.1_2 Forward -391 -382 18.486 0.00236
NP_441543.1_2 Reverse -384 -393 15.9293 0.00518
NP_442845.1_2 Forward -398 -384 14.0609 0.0872
NP_442845.1_2 Reverse -134 -148 5.50613 0.231
NP_442845.1_2 Reverse -377 -391 4.91614 0.249
NP_442710.1_7 Forward -173 -154 -5.7811 0.294
NP_441469.1_8 Reverse -382 -391 16.126 0.00797
NP_441469.1_8 Forward -393 -384 6.5879 0.227
NP_442315.1_2 Reverse -135 -147 9.18376 0.291
NP_443064.1_6 Reverse -383 -393 10.8217 0.13
NP_442578.1_7 Forward -391 -384 14.5921 0.026
NP_442578.1_7 Reverse -384 -391 14.5921 0.026
NP_441462.1_2 Reverse -383 -393 20.2362 0.000805
NP_441462.1_2 Forward -392 -382 11.5831 0.00406
NP_441462.1_7 Reverse -179 -198 14.5524 0.243
NP_441621.1_7 Reverse -381 -395 -5.60527 0.256
NP_443062.1_1 Forward -392 -374 14.0063 0.0538
NP_443062.1_6 Forward -400 -381 4.52268 0.217
NP_442204.1_1 Forward -396 -385 6.64685 0.157
NP_442204.1_1 Reverse -299 -310 6.15519 0.173
NP_440255.1_7 Forward -170 -153 9.18362 0.277
NP_440516.1_2 Forward -398 -380 8.18062 0.116
NP_440516.1_2 Reverse -377 -395 -1.45582 0.285
NP_440516.1_8 Forward -392 -383 16.9127 0.00442
NP_440516.1_8 Reverse -383 -392 16.9127 0.00442
NP_441033.1_2 Reverse -373 -392 -9.63698 0.293
NP_442428.1_5 Forward -391 -384 15.8704 0.0124
NP_442428.1_5 Reverse -384 -391 15.8704 0.0124
NP_440673.1_3 Forward -390 -383 12.4288 0.0426
NP_440673.1_3 Reverse -385 -392 12.4288 0.0426
NP_441714.1_3 Forward -399 -381 18.4062 0.0616
NP_441052.1_2 Forward -392 -382 10.5014 0.0285
NP_441052.1_2 Reverse -383 -393 10.4031 0.0285
NP_442219.1_9 Forward -391 -382 8.35786 0.0681
NP_442219.1_9 Reverse -384 -393 8.25953 0.0681
NP_440436.1_4 Forward -391 -382 18.1905 0.00233
NP_440436.1_4 Reverse -384 -393 9.24241 0.0871
NP_442086.1_3 Forward -391 -372 10.9142 0.196
NP_440314.1_9 Forward -391 -372 0.294447 0.0963
NP_440648.1_1 Forward -392 -373 2.65439 0.288
NP_441719.1_4 Forward -391 -384 16.3621 0.0124
NP_441719.1_4 Reverse -384 -391 16.3621 0.0124
NP_442813.1_4 Reverse -171 -190 6.88262 0.173
NP_442813.1_4 Reverse -314 -333 -7.08038 0.299
NP_441231.1_3 Forward -357 -338 20.8447 0.055
NP_442366.1_3 Reverse -382 -400 -1.94747 0.219
NP_442366.1_5 Forward -395 -385 17.2858 0.0141
NP_442366.1_5 Reverse -380 -390 13.3526 0.0775
NP_441115.1_4 Reverse -382 -400 17.0296 0.0226
NP_442854.1_6 Reverse -303 -322 1.47442 0.279
NP_443054.1_2 Forward -394 -380 1.76955 0.245
NP_441851.1_10 Reverse -382 -392 16.008 0.00552
NP_441851.1_10 Forward -393 -383 8.53483 0.114
NP_441542.1_4 Reverse -346 -360 3.63784 0.267
NP_442515.1_1 Forward -275 -261 -1.27871 0.251
NP_442515.1_1 Forward -149 -135 -2.06536 0.268
NP_442515.1_1 Forward -393 -379 -3.24533 0.289
NP_442515.1_1 Reverse -382 -396 -4.4253 0.298
NP_441396.1_5 Reverse -184 -193 8.25953 0.224
NP_441046.1_2 Reverse -278 -297 1.27776 0.257
NP_442689.1_8 Forward -297 -280 2.49712 0.181
NP_441409.1_6 Forward -398 -379 -15.3402 0.29
NP_440432.1_9 Forward -391 -376 -2.77337 0.175
NP_442843.1_1 Reverse -333 -352 -9.83364 0.271
NP_440474.1_8 Forward -391 -377 7.66879 0.202
NP_440474.1_8 Reverse -384 -398 5.30886 0.251
NP_440431.1_4 Forward -187 -168 -6.15965 0.25
NP_440431.1_4 Forward -108 -89 -7.21006 0.262
NP_442450.1_5 Forward -394 -384 7.64985 0.13
NP_442450.1_5 Forward -120 -110 7.64985 0.13
NP_442450.1_5 Reverse -381 -391 7.55152 0.13
NP_442168.1_5 Forward -391 -372 -0.787193 0.264
NP_441031.1_1 Reverse -155 -174 8.75086 0.23
NP_441078.1_4 Forward -392 -383 19.6659 0.0007
NP_441078.1_4 Reverse -383 -392 19.6659 0.0007
NP_442443.1_1 Reverse -334 -353 4.71934 0.157
NP_442443.1_1 Forward -366 -347 -0.0988766 0.222
NP_441432.1_8 Forward -393 -384 16.8143 0.00595
NP_441432.1_8 Reverse -382 -391 8.25953 0.0755
NP_441432.1_8 Forward -260 -251 6.98123 0.112
NP_442320.1_8 Reverse -377 -391 16.7159 0.00688
NP_442344.1_7 Forward -391 -372 5.50599 0.0638
NP_441732.1_2 Forward -396 -380 -7.70961 0.0885
NP_441732.1_2 Reverse -379 -395 -16.3627 0.165
NP_440760.1_1 Forward -392 -373 0.196116 0.0279
NP_440760.1_1 Forward -132 -113 -21.83 0.245
NP_442624.1_3 Reverse -52 -66 12.6843 0.288
NP_439935.1_1 Forward -102 -83 8.45592 0.25
NP_442489.1_7 Forward -392 -383 20.1576 0.000695
NP_442489.1_7 Reverse -383 -392 20.1576 0.000695
NP_440386.1_3 Forward -102 -83 -5.99873 0.26
NP_440559.1_1 Forward -391 -382 8.75118 0.0586
NP_440559.1_1 Reverse -384 -393 8.65285 0.0586
NP_441659.2_8 Reverse -383 -393 20.9245 0.000805
NP_441659.2_8 Forward -392 -382 11.9764 0.0147
NP_441659.2_8 Forward -312 -302 3.02829 0.177
NP_442346.1_5 Forward -393 -383 16.303 0.00248
NP_442346.1_5 Reverse -382 -392 9.02648 0.118
NP_440545.1_3 Reverse -379 -396 -3.69774 0.21
NP_440459.1_2 Reverse -374 -391 8.10198 0.27
NP_442311.1_5 Forward -364 -345 0.884433 0.27
NP_441833.1_4 Forward -391 -384 15.9687 0.0124
NP_441833.1_4 Reverse -384 -391 15.9687 0.0124
NP_441329.1_6 Forward -176 -157 9.31004 0.13
NP_442162.1_9 Forward -391 -384 16.2637 0.0124
NP_442162.1_9 Reverse -384 -391 16.2637 0.0124
NP_440671.1_1 Forward -178 -159 9.28929 0.203
NP_441915.1_4 Reverse -296 -315 5.11187 0.3
NP_442199.1_5 Reverse -375 -394 -2.16383 0.185
NP_442140.1_3 Forward -391 -381 16.2046 0.0255
NP_442140.1_3 Reverse -384 -394 6.66654 0.159
NP_441813.1_5 Reverse -381 -391 9.91146 0.021
NP_441813.1_5 Forward -394 -384 8.63316 0.0367
NP_441813.1_7 Forward -351 -337 14.5519 0.197
NP_440594.1_6 Reverse -377 -396 14.8466 0.169
NP_440594.1_8 Reverse -384 -397 10.2451 0.17
NP_440590.1_4 Forward -391 -378 8.47575 0.0446
NP_440590.1_4 Reverse -384 -397 3.36254 0.0746
NP_440567.1_1 Forward -391 -377 9.2427 0.0471
NP_440567.1_1 Reverse -384 -398 5.21113 0.105
NP_442497.1_10 Reverse -384 -393 17.601 0.00813
NP_442497.1_10 Forward -391 -382 10.4228 0.0087
NP_440821.1_4 Reverse -381 -391 10.2065 0.0163
NP_440821.1_4 Forward -394 -384 2.24165 0.131
NP_441239.1_9 Forward -394 -382 13.707 0.0355
NP_441239.1_9 Reverse -381 -393 12.3303 0.0477
NP_442643.1_1 Reverse -377 -396 -11.7019 0.231
NP_441541.1_1 Forward -177 -159 0.192969 0.234
NP_440354.1_5 Reverse -380 -399 1.0811 0.29
NP_440546.1_4 Reverse -383 -393 13.5365 0.0459
NP_440546.1_4 Forward -392 -382 11.8882 0.0679
NP_441230.1_5 Reverse -378 -397 -1.18052 0.298
NP_440462.1_4 Reverse -133 -147 7.76774 0.273
NP_440462.1_6 Forward -394 -384 10.5014 0.0396
NP_440462.1_6 Reverse -381 -391 9.02648 0.0498
NP_440868.1_4 Forward -396 -384 17.7386 0.0124
NP_440868.1_4 Reverse -379 -391 8.39711 0.0602
NP_440401.1_9 Forward -145 -138 14.5917 0.287
NP_440374.1_3 Reverse -17 -35 11.843 0.277
NP_442402.1_4 Forward -380 -361 -8.85106 0.284
NP_441848.1_4 Reverse -35 -51 8.41009 0.288
NP_441848.1_7 Forward -227 -208 1.86696 0.228
NP_439942.1_7 Reverse -350 -369 0.0977854 0.228
NP_442358.1_6 Forward -247 -229 14.1788 0.131
NP_442039.1_4 Forward -391 -384 15.1821 0.0124
NP_442039.1_4 Reverse -384 -391 15.1821 0.0124
NP_441811.1_8 Forward -398 -384 8.45605 0.238
NP_442829.1_2 Forward -328 -312 8.62426 0.287
NP_440825.1_7 Forward -391 -381 12.4217 0.155
NP_442837.1_3 Forward -391 -384 15.7721 0.0124
NP_442837.1_3 Reverse -384 -391 15.7721 0.0124
NP_442053.1_1 Forward -392 -383 18.3876 0.0007
NP_442053.1_1 Reverse -383 -392 18.3876 0.0007
NP_440505.1_3 Forward -394 -384 8.04317 0.147
NP_440505.1_3 Reverse -381 -391 6.76487 0.169
NP_442532.1_1 Forward -167 -153 8.65595 0.295
NP_442532.1_7 Forward -392 -378 5.21113 0.171
NP_440914.1_1 Reverse -383 -393 16.3248 0.00196
NP_440914.1_1 Forward -392 -382 8.6151 0.186
NP_441011.1_8 Forward -391 -382 16.9127 0.00602
NP_441011.1_8 Reverse -384 -393 16.6177 0.00602
NP_442101.1_10 Reverse -375 -394 -10.817 0.259
NP_442533.1_6 Forward -392 -383 17.2076 0.00137
NP_442533.1_6 Reverse -383 -392 17.2076 0.00137
NP_442229.1_1 Forward -394 -380 8.84875 0.184
NP_441482.1_7 Reverse -377 -391 -10.7185 0.213
NP_439944.1_9 Reverse -384 -394 9.12481 0.1
NP_442202.1_10 Forward -352 -338 6.3911 0.255
NP_441527.1_4 Forward -249 -230 -0.812105 0.146
NP_441527.1_4 Forward -185 -166 -5.87318 0.21
NP_441527.1_4 Reverse -8 -27 -7.68752 0.236
NP_441527.1_4 Forward -175 -156 -8.06949 0.24
NP_440115.1_6 Forward -395 -385 6.37155 0.186
NP_440007.1_9 Reverse -130 -144 1.08123 0.29
NP_441680.1_4 Forward -147 -128 -0.885524 0.256
NP_441170.1_4 Reverse -374 -392 2.28076 0.285
NP_441106.1_1 Forward -393 -384 18.486 0.0028
NP_441106.1_1 Reverse -382 -391 18.191 0.0028
NP_439903.1_6 Reverse -148 -167 1.37531 0.248
NP_442306.1_10 Forward -397 -378 18.289 0.00471
NP_441286.1_1 Forward -393 -381 -3.40261 0.145
NP_441286.1_1 Reverse -382 -394 -3.59927 0.145
NP_440670.1_8 Forward -392 -383 18.3876 0.000699
NP_440670.1_8 Reverse -383 -392 18.3876 0.000699
NP_440886.1_7 Reverse -382 -392 17.7774 0.0011
NP_440886.1_7 Forward -393 -383 8.04271 0.0805
NP_442614.1_2 Reverse -383 -397 7.37441 0.275
NP_442072.1_9 Reverse -382 -400 -21.417 0.208
NP_442401.1_2 Forward -133 -114 6.58682 0.294
NP_442022.1_4 Reverse -350 -369 7.96426 0.268
NP_440907.2_8 Reverse -384 -394 15.9091 0.0161
NP_440907.2_8 Forward -391 -381 14.2375 0.0312
NP_441021.1_1 Forward -317 -298 -11.8003 0.274
NP_441021.1_8 Reverse -378 -396 0.904127 0.291
NP_440841.1_4 Forward -394 -375 -9.63698 0.26
NP_441463.1_3 Reverse -373 -392 0.982764 0.128
NP_441626.1_2 Forward -391 -384 15.7721 0.0124
NP_441626.1_2 Reverse -384 -391 15.7721 0.0124
NP_442794.1_1 Reverse -119 -131 4.5622 0.256
NP_442615.1_1 Reverse -374 -392 -1.65248 0.131
NP_440387.1_1 Forward -392 -376 6.9417 0.0282
NP_440387.1_1 Reverse -383 -399 6.45005 0.0282
NP_440387.1_8 Forward -163 -144 11.405 0.226
NP_441431.1_2 Forward -395 -381 13.4703 0.0891
NP_441431.1_2 Reverse -380 -394 8.55376 0.211
NP_441993.1_1 Reverse -297 -316 0.679741 0.294
NP_440114.1_10 Reverse -383 -397 14.4542 0.0401
NP_440114.1_10 Forward -392 -378 13.5693 0.0531
NP_440293.1_10 Reverse -333 -352 1.27776 0.219
NP_439988.1_10 Forward -174 -155 7.57817 0.226
NP_439910.1_2 Reverse -375 -392 -12.3509 0.0837
NP_440457.1_1 Reverse -303 -315 1.21895 0.244
NP_440987.1_2 Forward -149 -130 23.0089 0.0147
NP_440987.1_4 Forward -93 -74 20.4523 0.111
NP_440987.1_6 Forward -38 -19 18.9554 0.122
NP_440987.1_7 Forward -184 -170 17.6008 0.198
NP_440987.1_8 Forward -64 -50 17.4042 0.28
NP_440798.1_6 Forward -391 -378 4.54251 0.145
NP_440798.1_6 Reverse -384 -397 3.75586 0.148
NP_440473.1_9 Reverse -129 -148 -5.11376 0.206
NP_440473.1_9 Reverse -361 -380 -5.9004 0.22
NP_442509.1_9 Forward -392 -382 16.2041 0.00739
NP_442509.1_9 Reverse -383 -393 8.04271 0.192
NP_440081.1_4 Reverse -146 -165 16.6125 0.187
NP_440734.1_9 Forward -149 -130 12.4875 0.24
NP_440554.1_4 Reverse -384 -394 8.82982 0.0646
NP_440554.1_4 Forward -391 -381 7.35486 0.103
NP_441885.1_5 Forward -392 -382 11.4848 0.00668
NP_441885.1_5 Reverse -383 -393 11.3864 0.00668
NP_441885.1_5 Reverse -303 -313 -1.49493 0.264
NP_440478.1_10 Reverse -381 -395 7.86607 0.257
NP_442341.1_7 Reverse -382 -396 6.3911 0.127
NP_442341.1_9 Reverse -381 -395 12.487 0.103
NP_442341.1_9 Reverse -301 -315 7.27547 0.202
NP_441173.1_9 Reverse -3 -11 10.9338 0.242
NP_440750.1_3 Forward -110 -91 17.2074 0.0353
NP_443000.1_7 Forward -394 -384 10.6981 0.0345
NP_443000.1_7 Reverse -381 -391 1.94665 0.226
NP_441842.1_1 Reverse -385 -398 16.7349 0.0433
NP_440275.1_3 Forward -394 -384 9.02648 0.0563
NP_440275.1_3 Reverse -381 -391 8.33817 0.0602
NP_440091.1_1 Reverse -379 -391 1.41561 0.197
NP_442495.1_4 Reverse -295 -305 13.353 0.191
NP_440216.1_1 Forward -392 -378 5.40779 0.0209
NP_440216.1_1 Reverse -383 -397 -1.37704 0.0312
NP_440172.1_1 Reverse -383 -393 17.5813 0.00421
NP_440172.1_1 Forward -392 -382 8.73149 0.0586
NP_442015.1_10 Forward -396 -383 2.77255 0.187
NP_442015.1_10 Reverse -379 -392 1.78924 0.204
NP_442015.1_10 Forward -217 -204 1.00259 0.216
NP_441226.1_7 Forward -391 -384 14.4934 0.0123
NP_441226.1_7 Reverse -384 -391 14.4934 0.0123
NP_441226.1_7 Forward -148 -141 8.29857 0.205
NP_441111.1_7 Forward -391 -383 18.7023 0.00294
NP_441111.1_7 Reverse -384 -392 18.7023 0.00294
NP_441766.1_2 Forward -392 -383 17.5026 0.00297
NP_441766.1_2 Reverse -383 -392 17.5026 0.00297
NP_441766.1_9 Reverse -334 -353 -0.885524 0.261
NP_440416.1_1 Forward -392 -373 -2.26216 0.116
NP_443052.1_8 Reverse -373 -392 0.884433 0.0624
NP_442403.1_8 Reverse -197 -216 -0.295539 0.252
NP_440591.1_9 Reverse -302 -320 6.01734 0.231
NP_442154.1_1 Reverse -132 -150 -9.32229 0.178
NP_442154.1_1 Reverse -348 -366 -15.6155 0.222
NP_440261.1_5 Reverse -384 -397 4.93583 0.0478
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATGTTGTAGGCGATCGCCGAATCATCGACGCATTCCGCCAGAAATACTGCCCCAAAACCACCAGTACCCAGTAAAGACTGCAGGACATACCGCCCGCCTAGGCACTTTTGCTCTAAACTTCTCCAGGACGACAAAAACATAGGCTTTCAGTGTAAACAGGCAAAGGTACTATGTAAAACTATGCCCTCCTGAAGACCATCATAGGTTCGCCCACCAAAAGCGAATATAAAGATTAGTAAAGAAAATTACTTTGCCAACCCCAACATCCGGCGATAATGCAAGCTTCAGCGAAAAGCAAGAGATTCTAGAAGAGATTAGAGCAATTTCAAGATAATTCCATTAATTGCTTGACTATTATTAGAGTTAGAATTCTTAGTTAATCGTCCCTTTTTGGAGAAGT

CDS

ATGCCGCAATCGGAATCAAACATTGCCCTGCTAATTGATGCGGATAATGCCCCAGCGTCCAAAATTGAGGCGATCGTATCGGAAATTGCCAAATATGGAGTAGCCAATATTCGTAAAGCCTATGGCAATTGGAAAAGCCCTAACCTAAAAGCCTGGGAAGAATGTTTACATGAGTATGCCATTCGTCCCGTGCAACAGTTTGATTACACCAAGGGTAAAAATGCCACCGATGCCGCCATGATTATTGATGCCATGGATTTGCTCTACACCCAACGGTTGGACGCCTTTGCCATTGTGTCAAGTGATTGTGACTTTACCCCTTTAGTAATGCGGATTTTGACCAATGGACTAAAAGTTTATGGCTTTGGGGAGAAAAAAACTCCCTTGCCTTTTGTCTATGCTTGTTCGACATTTTTATACTTGGAAAGTATTGATCAAATTGAAAACTCTGAAGGGGCGACCCAAAGTTCCACTAGTGTTAAGAAAACTGGGAAGGAATTGAAACAAGACGCAAAATTAATTAGTTTACTTAGGAGTGCCATTTCCAGCACCATTGACGACGATGGCTGGTCAAGCTTAGCTGAAATTGGCGGCCACATCAAAAACCAAGCATCCTTTGATTCCCGCAACTACGGCTATGCCAAGCTAAGTAGTTTATTTGAGGCGATTGATTTGTTTGAAATTGAGCGTAAAAACAGGGCAATTTACGTTAGGAATAGACAAAAAAAGTCCGCCACATCTAAGTCCTAG

Protein

MPQSESNIALLIDADNAPASKIEAIVSEIAKYGVANIRKAYGNWKSPNLKAWEECLHEYAIRPVQQFDYTKGKNATDAAMIIDAMDLLYTQRLDAFAIVSSDCDFTPLVMRILTNGLKVYGFGEKKTPLPFVYACSTFLYLESIDQIENSEGATQSSTSVKKTGKELKQDAKLISLLRSAISSTIDDDGWSSLAEIGGHIKNQASFDSRNYGYAKLSSLFEAIDLFEIERKNRAIYVRNRQKKSATSKS