Your browser is old and dusty. Try Google Chrome!

Details for slr1862

ORF slr1862
Accession NP_440976.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -286 -272 5.40779 0.137
NP_441061.1_2 Forward -277 -263 0.786239 0.199
NP_441061.1_2 Reverse -369 -383 -0.393733 0.228
NP_441061.1_2 Reverse -270 -284 -0.983719 0.246
NP_440795.1_7 Forward -277 -270 14.6904 0.0123
NP_440795.1_7 Reverse -270 -277 14.6904 0.0123
NP_441418.1_6 Reverse -269 -288 0.884433 0.00871
NP_441418.1_6 Forward -278 -259 -28.9099 0.213
NP_442291.1_5 Forward -279 -263 -2.49807 0.217
NP_442272.1_2 Forward -159 -140 12.4613 0.217
NP_441453.1_4 Reverse -269 -277 16.539 0.00633
NP_441453.1_4 Forward -278 -270 7.8859 0.0536
NP_441623.1_1 Reverse -220 -238 -3.22577 0.256
NP_442151.1_6 Forward -278 -264 8.45605 0.172
NP_441818.1_1 Forward -277 -266 10.1862 0.232
NP_440226.1_1 Forward -278 -259 3.14605 0.237
NP_441465.1_8 Forward -282 -264 5.72234 0.286
NP_440813.1_1 Forward -284 -270 20.2551 0.0896
NP_441098.1_3 Reverse -73 -92 -0.759618 0.256
NP_441098.1_3 Forward -59 -40 -6.40615 0.28
NP_442655.1_10 Reverse -275 -294 -10.227 0.22
NP_442173.1_1 Forward -277 -269 15.4574 0.00633
NP_442173.1_1 Reverse -270 -278 8.27922 0.101
NP_442752.1_4 Reverse -278 -285 15.0838 0.0199
NP_442752.1_4 Reverse -269 -276 13.8055 0.0199
NP_443027.1_4 Reverse -276 -286 8.23984 0.215
NP_441745.1_3 Forward -295 -276 12.9783 0.298
NP_440784.1_7 Forward -277 -270 15.9687 0.0123
NP_440784.1_7 Reverse -270 -277 15.9687 0.0123
NP_442062.1_8 Reverse -269 -279 11.1898 0.0493
NP_442062.1_8 Forward -278 -268 7.84651 0.0871
NP_442062.1_8 Reverse -278 -288 5.87989 0.149
NP_441859.1_3 Forward -279 -260 8.55343 0.138
NP_440304.1_4 Reverse -267 -277 1.84832 0.299
NP_442268.1_3 Forward -38 -19 14.7483 0.284
NP_442242.1_4 Forward -277 -270 14.3954 0.0124
NP_442242.1_4 Reverse -270 -277 14.3954 0.0124
NP_440044.1_8 Forward -277 -258 16.0274 0.0239
NP_441083.1_5 Forward -278 -268 19.0562 0.00147
NP_441083.1_5 Reverse -269 -279 1.65166 0.2
NP_441738.1_2 Forward -276 -269 15.28 0.0102
NP_441738.1_2 Forward -285 -278 11.7401 0.0647
NP_440209.1_1 Reverse -269 -277 18.1123 0.00295
NP_440209.1_1 Forward -278 -270 15.1624 0.00583
NP_440209.1_1 Reverse -278 -286 5.13263 0.17
NP_442889.1_8 Forward -281 -267 5.70218 0.217
NP_442920.1_3 Forward -271 -252 16.09 0.278
NP_442111.1_4 Reverse -268 -282 3.24451 0.253
NP_440906.1_5 Forward -277 -270 15.8704 0.0124
NP_440906.1_5 Reverse -270 -277 15.8704 0.0124
NP_440906.1_5 Reverse -279 -286 8.79057 0.149
NP_440747.1_10 Forward -281 -269 7.21714 0.00643
NP_440747.1_10 Reverse -266 -278 5.25052 0.0154
NP_440747.1_10 Forward -290 -278 -12.3507 0.27
NP_441130.1_10 Forward -280 -266 9.83269 0.12
NP_441486.1_1 Reverse -266 -280 5.40779 0.037
NP_441486.1_1 Forward -281 -267 -3.63866 0.18
NP_442634.1_2 Forward -293 -274 6.19431 0.222
NP_442848.1_1 Reverse -263 -277 -2.36035 0.263
NP_443018.1_3 Forward -277 -270 14.8871 0.0123
NP_443018.1_3 Reverse -270 -277 14.8871 0.0123
NP_441634.1_8 Reverse -267 -281 -3.04867 0.295
NP_440376.1_1 Reverse -269 -278 9.73449 0.0365
NP_440376.1_1 Forward -278 -269 9.63616 0.0385
NP_441588.1_4 Forward -276 -266 18.1713 0.0143
NP_442687.1_7 Forward -279 -269 13.0581 0.0591
NP_442485.1_3 Forward -289 -270 7.47261 0.145
NP_442485.1_3 Reverse -267 -286 1.0811 0.233
NP_442530.1_6 Forward -85 -72 19.4453 0.135
NP_440642.1_10 Reverse -158 -172 5.1122 0.242
NP_441950.1_8 Forward -307 -293 4.22782 0.298
NP_442658.1_1 Forward -280 -270 14.9258 0.0188
NP_442658.1_1 Forward -289 -279 7.64939 0.213
NP_442658.1_1 Reverse -267 -277 6.76441 0.214
NP_442658.1_1 Forward -304 -294 6.76441 0.214
NP_442782.1_2 Reverse -269 -283 0.88457 0.282
NP_442544.1_6 Forward -285 -266 -8.16202 0.298
NP_441414.1_9 Forward -278 -259 -3.93378 0.143
NP_441487.1_9 Forward -279 -260 0.491109 0.228
NP_441256.1_1 Forward -281 -262 -7.37537 0.239
NP_442937.1_5 Reverse -264 -283 13.3725 0.0942
NP_441958.1_5 Reverse -268 -278 3.12662 0.0364
NP_441958.1_5 Forward -279 -269 2.43831 0.0422
NP_440984.1_7 Reverse -264 -278 5.01447 0.276
NP_442690.1_1 Forward -81 -62 -7.57203 0.175
NP_443055.1_6 Reverse -261 -279 6.01657 0.172
NP_440827.1_3 Forward -383 -364 12.1925 0.26
NP_441129.1_3 Forward -232 -213 -17.7001 0.285
NP_441099.1_5 Forward -288 -269 8.45592 0.0373
NP_442002.1_9 Reverse -36 -43 11.1505 0.185
NP_441000.1_6 Forward -279 -265 5.21113 0.0933
NP_441000.1_6 Reverse -277 -291 -5.31028 0.273
NP_440147.1_4 Reverse -267 -280 8.37742 0.0518
NP_440147.1_4 Forward -280 -267 0.60927 0.249
NP_441550.1_8 Reverse -267 -277 14.6309 0.0132
NP_441550.1_8 Forward -230 -220 7.94438 0.14
NP_441550.1_8 Forward -280 -270 5.19112 0.26
NP_441916.1_7 Reverse -269 -279 9.12481 0.0396
NP_441916.1_7 Forward -278 -268 2.04498 0.265
NP_441041.1_7 Forward -281 -269 11.9849 0.0689
NP_441041.1_7 Reverse -266 -278 10.916 0.0864
NP_441041.1_7 Forward -290 -278 7.70913 0.162
NP_441725.1_5 Forward -377 -367 3.91327 0.115
NP_441725.1_5 Forward -277 -267 2.04498 0.115
NP_441725.1_5 Reverse -270 -280 0.0783647 0.215
NP_439966.1_7 Forward -280 -270 18.6624 0.00473
NP_439966.1_7 Reverse -267 -277 7.25606 0.15
NP_439966.1_9 Forward -280 -271 9.83282 0.215
NP_439966.1_9 Reverse -276 -285 8.1612 0.253
NP_442941.1_3 Forward -277 -267 11.0914 0.0116
NP_442941.1_3 Reverse -270 -280 1.35667 0.15
NP_440289.1_2 Forward -281 -268 10.7374 0.0239
NP_440289.1_2 Reverse -266 -279 -3.4223 0.267
NP_441554.1_4 Forward -165 -151 13.7328 0.281
NP_441514.1_6 Reverse -287 -294 12.7238 0.29
NP_442281.1_1 Forward -283 -269 11.1104 0.0507
NP_442281.1_1 Reverse -264 -278 9.34041 0.0717
NP_441079.1_7 Forward -158 -139 -4.62285 0.25
NP_441079.1_7 Reverse -136 -155 -4.62285 0.25
NP_442256.1_2 Forward -280 -262 10.2456 0.0965
NP_440437.1_1 Forward -284 -265 -4.13045 0.251
NP_440498.1_1 Forward -287 -269 -3.12744 0.256
NP_441644.1_6 Forward -278 -268 14.7292 0.0105
NP_441644.1_6 Reverse -269 -279 6.37109 0.161
NP_443049.1_6 Reverse -268 -278 13.8856 0.139
NP_440652.1_10 Reverse -28 -47 2.85105 0.283
NP_442215.1_2 Forward -380 -364 -6.33298 0.268
NP_442215.1_2 Reverse -105 -121 -6.52964 0.273
NP_442029.1_1 Forward -314 -295 -19.4701 0.29
NP_440253.1_2 Forward -278 -260 6.60732 0.0778
NP_440253.1_2 Reverse -269 -287 -0.669169 0.218
NP_440929.1_8 Reverse -269 -278 9.93116 0.0249
NP_440929.1_8 Forward -278 -269 9.83282 0.0254
NP_442933.1_1 Forward -21 -2 12.1748 0.242
NP_442933.1_2 Reverse -4 -22 18.7184 0.227
NP_442933.1_2 Forward -95 -77 5.82699 0.286
NP_442933.1_10 Reverse -269 -278 9.04618 0.063
NP_442933.1_10 Forward -278 -269 8.94785 0.0643
NP_441751.2_8 Reverse -270 -284 5.60446 0.0419
NP_441751.2_8 Forward -277 -263 -3.147 0.134
NP_441751.2_8 Forward -286 -272 -3.93365 0.157
NP_442554.1_8 Forward -277 -267 15.3197 0.00882
NP_442554.1_8 Reverse -270 -280 4.60159 0.18
NP_442970.1_1 Forward -267 -253 13.7625 0.269
NP_441762.1_7 Reverse -268 -280 5.05386 0.0443
NP_441762.1_7 Forward -279 -267 2.10393 0.0692
NP_441762.1_7 Forward -288 -276 -5.46756 0.212
NP_442142.1_4 Forward -281 -268 17.8166 0.0255
NP_442142.1_4 Reverse -266 -279 10.2451 0.0767
NP_442142.1_9 Reverse -271 -290 12.5858 0.168
NP_442292.1_1 Forward -277 -268 18.486 0.00229
NP_442292.1_1 Reverse -270 -279 0.786375 0.23
NP_442476.1_6 Reverse -270 -284 1.86788 0.202
NP_442476.1_6 Forward -286 -272 0.491246 0.258
NP_442381.1_8 Reverse -266 -285 -13.7669 0.279
NP_443009.1_5 Reverse -268 -279 9.69459 0.0913
NP_441865.1_2 Forward -96 -79 18.3685 0.259
NP_441741.1_6 Forward -215 -196 11.9958 0.247
NP_441715.1_4 Reverse -270 -280 9.7148 0.097
NP_441715.1_4 Forward -277 -267 7.94484 0.107
NP_440357.1_3 Forward -280 -261 1.96607 0.269
NP_441198.1_5 Forward -276 -263 12.7034 0.216
NP_440464.1_10 Forward -277 -267 13.0082 0.169
NP_441758.1_10 Forward -329 -310 10.2251 0.0739
NP_441468.1_1 Forward -277 -270 15.8704 0.0124
NP_441468.1_1 Reverse -270 -277 15.8704 0.0124
NP_441529.1_1 Reverse -269 -283 21.2384 0.0143
NP_441015.1_9 Reverse -201 -214 17.9149 0.246
NP_441673.1_1 Reverse -269 -278 11.1111 0.0121
NP_441673.1_1 Forward -278 -269 11.0128 0.018
NP_441826.1_2 Forward -284 -270 0.392915 0.187
NP_442868.1_6 Forward -280 -270 10.0098 0.038
NP_442868.1_6 Reverse -267 -277 9.81313 0.038
NP_441612.1_2 Reverse -374 -384 6.61303 0.283
NP_442808.1_1 Forward -279 -269 18.8591 0.00201
NP_442808.1_1 Forward -288 -278 5.97777 0.134
NP_442542.1_2 Forward -280 -267 5.03416 0.288
NP_442050.1_5 Reverse -267 -277 7.64939 0.243
NP_440558.1_2 Reverse -290 -309 -1.96717 0.22
NP_441048.1_7 Forward -266 -252 18.5835 0.188
NP_441518.1_3 Reverse -259 -278 -5.99873 0.131
NP_441878.1_6 Reverse -268 -278 0.668351 0.139
NP_441878.1_6 Forward -279 -269 0.57002 0.14
NP_441036.1_8 Forward -279 -269 15.418 0.00944
NP_441036.1_8 Forward -237 -227 11.5831 0.114
NP_441036.1_8 Forward -288 -278 5.38824 0.287
NP_441557.1_5 Reverse -269 -278 10.8161 0.00464
NP_441557.1_5 Forward -278 -269 10.4228 0.00915
NP_441445.1_1 Reverse -260 -279 13.7658 0.0557
NP_442066.2_9 Forward -282 -269 8.9674 0.183
NP_440084.1_8 Reverse -46 -60 13.667 0.223
NP_441458.1_8 Reverse -138 -157 3.34933 0.273
NP_442183.1_1 Reverse -269 -283 11.3077 0.0724
NP_440979.1_3 Reverse -270 -288 14.5721 0.234
NP_440979.1_3 Forward -286 -268 11.7205 0.234
NP_441574.1_1 Reverse -257 -276 -7.17871 0.286
NP_441549.1_9 Forward -307 -289 -7.45401 0.207
NP_440414.1_5 Forward -300 -281 12.7825 0.138
NP_442347.1_2 Forward -277 -268 12.4878 0.056
NP_442347.1_2 Forward -286 -277 5.80125 0.219
NP_441037.1_4 Reverse -267 -277 7.9999 0.237
NP_442317.1_6 Forward -283 -264 7.57094 0.226
NP_441633.1_3 Forward -289 -276 5.32916 0.0545
NP_441633.1_3 Reverse -267 -280 -1.16069 0.153
NP_441633.1_3 Forward -280 -267 -1.75067 0.163
NP_440136.1_2 Forward -277 -270 15.9687 0.0123
NP_440136.1_2 Reverse -270 -277 15.9687 0.0123
NP_442998.1_5 Reverse -35 -45 8.23984 0.267
NP_442998.1_10 Forward -276 -269 15.5754 0.0102
NP_442998.1_10 Reverse -271 -278 5.84064 0.235
NP_442998.1_10 Forward -285 -278 5.74231 0.255
NP_440299.1_1 Reverse -370 -383 3.26365 0.251
NP_441799.1_1 Reverse -265 -279 14.3553 0.0242
NP_441799.1_1 Forward -282 -268 11.012 0.0629
NP_441007.1_10 Reverse -264 -277 0.412608 0.23
NP_441007.1_10 Forward -283 -270 0.0192843 0.254
NP_441007.1_10 Reverse -273 -286 -0.865694 0.295
NP_440256.1_1 Forward -231 -212 -8.85033 0.268
NP_440256.1_1 Reverse -266 -285 -9.24366 0.275
NP_440087.1_1 Reverse -269 -288 5.99764 0.166
NP_441559.1_8 Forward -292 -278 2.16287 0.147
NP_441559.1_8 Forward -282 -268 -5.60527 0.267
NP_441559.1_8 Forward -283 -269 -7.08024 0.283
NP_440733.1_2 Forward -156 -138 22.1561 0.0557
NP_442031.1_3 Reverse -232 -251 10.0292 0.183
NP_441464.1_1 Reverse -211 -230 7.07928 0.27
NP_440677.1_1 Forward -287 -268 5.70265 0.294
NP_442386.1_9 Forward -279 -270 17.6988 0.0144
NP_442386.1_9 Reverse -268 -277 13.8639 0.0289
NP_441750.1_4 Forward -290 -271 1.17943 0.288
NP_441340.1_5 Forward -277 -270 15.6737 0.0124
NP_441340.1_5 Reverse -270 -277 15.6737 0.0124
NP_440168.1_9 Reverse -267 -286 -5.40875 0.296
NP_440161.1_3 Forward -280 -261 9.43923 0.247
NP_440586.1_8 Forward -277 -270 13.2151 0.026
NP_440586.1_8 Reverse -270 -277 13.2151 0.026
NP_442251.1_6 Forward -277 -270 15.2804 0.0124
NP_442251.1_6 Reverse -270 -277 15.2804 0.0124
NP_440192.1_4 Reverse -276 -295 11.9201 0.199
NP_442959.1_5 Reverse -174 -193 7.57094 0.231
NP_440684.1_9 Reverse -263 -277 12.0943 0.168
NP_441262.1_3 Reverse -269 -276 14.7888 0.0223
NP_441262.1_3 Forward -278 -271 6.52896 0.0809
NP_443051.1_1 Reverse -268 -277 10.4228 0.00754
NP_443051.1_1 Forward -279 -270 0.983037 0.125
NP_439984.1_10 Forward -41 -27 10.9137 0.253
NP_439937.1_8 Reverse -267 -286 -5.60541 0.299
NP_440439.1_1 Forward -281 -268 0.412608 0.192
NP_440439.1_1 Reverse -275 -288 0.117615 0.202
NP_439943.1_1 Forward -45 -26 -5.60541 0.235
NP_440372.1_2 Forward -277 -270 16.3621 0.0124
NP_440372.1_2 Reverse -270 -277 16.3621 0.0124
NP_439977.1_5 Forward -384 -365 1.27776 0.195
NP_441572.1_7 Reverse -272 -291 -1.57384 0.188
NP_441572.1_7 Forward -284 -265 -6.68705 0.3
NP_442384.1_10 Reverse -269 -282 7.59077 0.0784
NP_442035.1_8 Forward -281 -267 12.3893 0.251
NP_441877.1_7 Forward -283 -264 -0.29631 0.283
NP_442790.1_4 Forward -287 -268 -14.8485 0.282
NP_442262.1_10 Forward -277 -270 14.1988 0.0123
NP_442262.1_10 Reverse -270 -277 14.1988 0.0123
NP_441689.1_5 Reverse -267 -277 5.78111 0.197
NP_440344.1_10 Reverse -262 -279 -3.8944 0.0889
NP_440344.1_10 Forward -285 -268 -8.31929 0.125
NP_440531.1_6 Forward -286 -267 -0.688862 0.218
NP_442123.1_3 Forward -236 -217 10.0292 0.294
NP_442750.1_3 Forward -219 -200 -10.9153 0.236
NP_440297.1_9 Forward -377 -367 4.40493 0.231
NP_440297.1_9 Forward -277 -267 -0.118297 0.282
NP_440350.1_2 Forward -279 -260 4.52268 0.289
NP_440350.1_5 Forward -23 -4 -6.88371 0.299
NP_442187.1_3 Reverse -268 -278 17.188 0.0619
NP_440999.1_9 Forward -282 -268 16.9125 0.0184
NP_440888.1_2 Forward -278 -264 5.70218 0.267
NP_441771.1_4 Forward -74 -55 4.62101 0.192
NP_440600.1_4 Forward -286 -268 -4.20908 0.255
NP_442948.1_2 Reverse -268 -287 4.52268 0.26
NP_442033.1_10 Forward -290 -271 -3.04881 0.163
NP_441543.1_2 Forward -277 -268 16.9127 0.00359
NP_441543.1_2 Reverse -270 -279 8.94785 0.0968
NP_441469.1_8 Forward -279 -270 15.4377 0.0124
NP_441469.1_8 Forward -288 -279 6.5879 0.227
NP_441469.1_8 Reverse -268 -277 6.48957 0.227
NP_443064.1_6 Forward -278 -268 9.46426 0.219
NP_442337.1_8 Forward -313 -294 -0.983855 0.278
NP_442578.1_7 Forward -277 -270 14.5921 0.026
NP_442578.1_7 Reverse -270 -277 14.5921 0.026
NP_441462.1_2 Reverse -269 -279 9.32148 0.0234
NP_441462.1_2 Forward -278 -268 1.74999 0.0811
NP_441621.1_7 Reverse -267 -281 -1.77037 0.187
NP_441621.1_7 Forward -289 -275 -3.04867 0.188
NP_443062.1_1 Forward -278 -260 16.639 0.0304
NP_443062.1_6 Reverse -261 -280 4.62101 0.216
NP_443062.1_6 Reverse -52 -71 1.17943 0.278
NP_440255.1_3 Forward -399 -389 14.6315 0.298
NP_440516.1_2 Forward -284 -266 6.70565 0.122
NP_440516.1_8 Reverse -269 -278 18.9776 0.00442
NP_440516.1_8 Forward -278 -269 7.07956 0.0867
NP_442428.1_5 Forward -277 -270 15.8704 0.0124
NP_442428.1_5 Reverse -270 -277 15.8704 0.0124
NP_440673.1_3 Reverse -271 -278 13.1171 0.0426
NP_440673.1_3 Forward -276 -269 12.4288 0.0426
NP_440673.1_3 Reverse -109 -116 6.72562 0.277
NP_441052.1_2 Forward -278 -268 20.5312 0.00106
NP_441052.1_2 Forward -383 -373 1.94665 0.221
NP_441052.1_2 Reverse -269 -279 0.766681 0.256
NP_442219.1_8 Reverse -259 -278 14.3516 0.137
NP_442219.1_9 Forward -277 -268 17.7976 0.00718
NP_442219.1_9 Reverse -270 -279 8.94785 0.0681
NP_440436.1_4 Forward -277 -268 17.2072 0.00233
NP_440436.1_4 Forward -286 -277 11.9957 0.0435
NP_440436.1_4 Reverse -270 -279 9.04574 0.092
NP_441884.1_9 Reverse -266 -285 -24.19 0.284
NP_442577.1_1 Forward -213 -194 9.14423 0.125
NP_441719.1_4 Forward -277 -270 16.3621 0.0124
NP_441719.1_4 Reverse -270 -277 16.3621 0.0124
NP_441733.1_10 Reverse -266 -279 12.114 0.106
NP_441004.1_1 Forward -383 -364 -12.7836 0.251
NP_442366.1_3 Forward -279 -261 4.34571 0.0984
NP_442366.1_5 Reverse -266 -276 14.8275 0.0375
NP_440296.1_6 Reverse -75 -93 12.034 0.295
NP_441115.1_4 Reverse -292 -310 9.16315 0.223
NP_441115.1_4 Forward -379 -361 7.58986 0.279
NP_442694.1_4 Forward -212 -203 12.9794 0.225
NP_442206.1_10 Reverse -269 -284 5.58476 0.178
NP_443054.1_2 Forward -280 -266 -0.492064 0.295
NP_441851.1_10 Reverse -268 -278 8.33817 0.118
NP_441851.1_10 Forward -279 -269 6.66654 0.159
NP_441851.1_10 Reverse -277 -287 4.79825 0.247
NP_442515.1_1 Reverse -322 -336 -3.44199 0.29
NP_442515.1_1 Reverse -268 -282 -4.81863 0.298
NP_442689.1_8 Forward -77 -60 -4.18939 0.263
NP_441349.1_10 Forward -246 -227 -8.45701 0.275
NP_441349.1_10 Reverse -259 -278 -9.34199 0.289
NP_440874.1_2 Reverse -78 -97 11.806 0.222
NP_441409.1_6 Forward -284 -265 -12.5869 0.229
NP_442314.1_2 Forward -213 -194 2.16274 0.275
NP_440432.1_9 Forward -277 -262 0.569883 0.159
NP_440432.1_9 Forward -235 -220 -2.67504 0.175
NP_442843.1_1 Reverse -220 -239 -2.36049 0.203
NP_442843.1_1 Reverse -270 -289 -3.3438 0.222
NP_440431.1_4 Reverse -2 -21 10.074 0.07
NP_440431.1_4 Forward -169 -150 -8.26048 0.275
NP_442450.1_5 Reverse -267 -277 7.55152 0.13
NP_440588.1_2 Forward -287 -268 -1.18052 0.155
NP_441031.1_10 Reverse -148 -167 15.2101 0.262
NP_440943.1_4 Forward -124 -112 14.297 0.297
NP_442243.1_1 Reverse -24 -42 -3.12816 0.299
NP_441570.1_1 Forward -278 -260 -12.3706 0.213
NP_441078.1_4 Reverse -269 -278 9.93116 0.0203
NP_441078.1_4 Forward -278 -269 9.83282 0.0226
NP_441078.1_4 Forward -383 -374 3.53964 0.136
NP_441663.1_8 Forward -284 -265 4.32602 0.169
NP_442348.1_2 Forward -213 -204 7.47288 0.28
NP_440526.1_3 Forward -277 -266 10.2846 0.0646
NP_440526.1_3 Forward -286 -275 6.25303 0.208
NP_441432.1_8 Reverse -268 -277 16.8143 0.00595
NP_441432.1_8 Forward -384 -375 3.14632 0.259
NP_441432.1_9 Forward -16 -3 10.7314 0.245
NP_441432.1_9 Forward -26 -13 10.4405 0.249
NP_441333.1_1 Forward -13 -3 13.9731 0.217
NP_442320.1_8 Reverse -263 -277 3.63784 0.0578
NP_442344.1_7 Forward -277 -258 9.73422 0.0407
NP_440685.1_6 Forward -281 -262 15.5349 0.283
NP_440760.1_7 Reverse -146 -165 6.88182 0.192
NP_440199.1_10 Reverse -266 -276 7.25653 0.231
NP_441072.1_2 Reverse -258 -277 10.3242 0.2
NP_442489.1_2 Forward -289 -270 5.30933 0.201
NP_442489.1_2 Reverse -258 -277 0.982764 0.296
NP_442489.1_7 Reverse -269 -278 10.4228 0.0151
NP_442489.1_7 Forward -278 -269 10.3245 0.0193
NP_440559.1_1 Forward -277 -268 17.4043 0.00658
NP_441659.2_8 Forward -278 -268 8.63316 0.0405
NP_441659.2_8 Reverse -269 -279 2.43831 0.2
NP_440779.1_5 Forward -278 -261 -6.25434 0.17
NP_442346.1_5 Forward -117 -107 9.22315 0.118
NP_442346.1_5 Reverse -268 -278 8.23984 0.143
NP_442346.1_5 Forward -279 -269 5.19158 0.256
NP_440352.1_5 Forward -174 -155 10.2223 0.278
NP_440545.1_3 Forward -382 -365 1.31714 0.121
NP_440545.1_3 Reverse -265 -282 -0.452814 0.154
NP_440010.1_10 Reverse -266 -285 3.24438 0.264
NP_440010.1_10 Reverse -257 -276 1.86774 0.292
NP_442603.1_7 Reverse -269 -283 5.70218 0.277
NP_441888.1_7 Forward -283 -269 10.6193 0.113
NP_441948.1_4 Forward -294 -276 9.16393 0.0572
NP_441948.1_4 Reverse -262 -280 6.41066 0.0644
NP_441833.1_4 Forward -277 -270 15.9687 0.0124
NP_441833.1_4 Reverse -270 -277 15.9687 0.0124
NP_441329.1_6 Forward -110 -91 -2.62645 0.294
NP_442498.1_5 Forward -344 -325 9.63589 0.284
NP_442162.1_9 Forward -277 -270 16.2637 0.0124
NP_442162.1_9 Reverse -270 -277 16.2637 0.0124
NP_443026.1_5 Forward -218 -199 -4.03212 0.283
NP_440772.1_6 Forward -286 -267 7.17762 0.292
NP_442073.1_6 Forward -287 -268 1.96607 0.25
NP_442199.1_5 Forward -232 -213 -0.197208 0.177
NP_442140.1_3 Reverse -270 -280 16.008 0.0287
NP_442140.1_3 Forward -277 -267 12.2714 0.0632
NP_442140.1_3 Reverse -279 -289 4.0116 0.265
NP_440875.1_9 Forward -285 -275 14.5042 0.0411
NP_440875.1_9 Reverse -271 -281 8.17736 0.24
NP_441813.1_5 Forward -280 -270 19.4496 0.00647
NP_441813.1_5 Reverse -267 -277 8.63316 0.0367
NP_441813.1_5 Forward -289 -279 -0.708283 0.272
NP_442028.1_1 Forward -15 -2 8.65605 0.281
NP_440590.1_4 Forward -277 -264 2.2809 0.0939
NP_440567.1_1 Reverse -270 -284 6.48943 0.0831
NP_440567.1_1 Forward -277 -263 4.52282 0.118
NP_442497.1_10 Forward -277 -268 10.4228 0.0087
NP_442497.1_10 Reverse -270 -279 1.37636 0.111
NP_440821.1_4 Reverse -267 -277 9.41981 0.0286
NP_440821.1_4 Forward -280 -270 7.84651 0.0626
NP_440821.1_4 Reverse -276 -286 5.78156 0.106
NP_441239.1_9 Forward -280 -268 13.9036 0.0335
NP_441892.1_1 Reverse -260 -277 -1.14113 0.198
NP_442216.1_4 Reverse -155 -163 8.08217 0.255
NP_440212.1_9 Forward -157 -138 6.52 0.169
NP_440212.1_9 Reverse -135 -154 3.54061 0.214
NP_440949.1_7 Forward -286 -267 13.5683 0.209
NP_440354.1_7 Forward -234 -216 6.41066 0.283
NP_442138.1_9 Reverse -287 -306 7.07848 0.299
NP_442138.1_10 Forward -278 -259 2.3594 0.12
NP_442138.1_10 Forward -306 -287 -2.45882 0.207
NP_440546.1_4 Reverse -269 -279 13.0517 0.0572
NP_440546.1_4 Reverse -219 -229 13.0517 0.0572
NP_440546.1_4 Forward -228 -218 11.0156 0.0991
NP_440546.1_4 Forward -278 -268 7.33119 0.246
NP_440462.1_6 Forward -280 -270 16.303 0.0113
NP_440462.1_6 Reverse -276 -286 6.56821 0.109
NP_440462.1_6 Reverse -267 -277 1.35667 0.294
NP_440868.1_4 Forward -282 -270 20.8851 0.00865
NP_440868.1_4 Reverse -265 -277 5.93884 0.0879
NP_440868.1_4 Reverse -274 -286 -0.354346 0.263
NP_442499.1_3 Forward -297 -279 8.67227 0.279
NP_440374.1_4 Forward -157 -138 15.9945 0.246
NP_441474.1_1 Forward -288 -269 -2.16459 0.272
NP_442402.1_4 Forward -274 -255 -8.94939 0.285
NP_441848.1_4 Reverse -62 -78 13.4712 0.195
NP_440653.1_10 Forward -277 -258 2.65439 0.288
NP_442039.1_4 Forward -277 -270 15.1821 0.0124
NP_442039.1_4 Reverse -270 -277 15.1821 0.0124
NP_441180.1_2 Forward -274 -255 11.7425 0.287
NP_442679.1_1 Reverse -7 -26 7.17762 0.147
NP_440825.1_7 Forward -277 -267 12.9096 0.152
NP_442837.1_3 Forward -277 -270 15.7721 0.0124
NP_442837.1_3 Reverse -270 -277 15.7721 0.0124
NP_442053.1_1 Reverse -269 -278 17.601 0.00138
NP_442053.1_1 Forward -278 -269 16.2243 0.00451
NP_440505.1_3 Reverse -276 -286 12.0747 0.0596
NP_440505.1_3 Reverse -267 -277 9.22315 0.122
NP_440505.1_3 Forward -280 -270 6.07655 0.197
NP_440351.1_9 Forward -157 -139 8.57394 0.223
NP_441102.1_1 Reverse -270 -289 5.89931 0.25
NP_442532.1_1 Forward -88 -74 11.4741 0.22
NP_442532.1_7 Reverse -269 -283 4.03116 0.178
NP_440914.1_1 Forward -278 -268 15.0561 0.00832
NP_440914.1_1 Reverse -269 -279 7.34642 0.241
NP_441699.1_7 Forward -66 -47 7.07848 0.255
NP_441011.1_8 Reverse -270 -279 15.3394 0.012
NP_441011.1_8 Forward -277 -268 8.25953 0.144
NP_442533.1_1 Reverse -272 -291 -15.6352 0.257
NP_442533.1_6 Reverse -269 -278 7.86621 0.0862
NP_442533.1_6 Forward -278 -269 7.37455 0.0898
NP_443016.1_1 Reverse -263 -282 5.11266 0.13
NP_439944.1_9 Forward -277 -267 10.5014 0.0887
NP_441527.1_4 Reverse -1 -20 3.867 0.111
NP_441527.1_4 Reverse -4 -23 3.77151 0.111
NP_441527.1_4 Reverse -2 -21 -2.53096 0.158
NP_441527.1_4 Reverse -7 -26 -4.53629 0.187
NP_441527.1_4 Reverse -8 -27 -8.06949 0.24
NP_441527.1_4 Reverse -3 -22 -8.06949 0.24
NP_441527.1_4 Forward -168 -149 -8.45146 0.244
NP_441527.1_4 Reverse -5 -24 -11.6982 0.284
NP_442492.1_2 Forward -278 -259 0.0977854 0.247
NP_441106.1_1 Reverse -268 -277 9.63616 0.0311
NP_441106.1_1 Forward -279 -270 9.04618 0.0371
NP_441825.1_4 Forward -213 -203 12.9597 0.249
NP_442306.1_10 Forward -241 -222 -10.0303 0.11
NP_441286.1_1 Reverse -268 -280 5.05386 0.0259
NP_441286.1_1 Forward -279 -267 -5.86088 0.229
NP_440670.1_8 Reverse -269 -278 9.04618 0.0606
NP_440670.1_8 Forward -278 -269 8.75118 0.0606
NP_440670.1_8 Forward -287 -278 3.63797 0.239
NP_440886.1_7 Forward -279 -269 17.7774 0.0011
NP_440886.1_7 Reverse -268 -278 6.66608 0.115
NP_442614.1_2 Reverse -278 -292 6.48943 0.291
NP_440907.2_8 Forward -277 -267 7.64939 0.117
NP_440907.2_8 Forward -286 -276 7.15773 0.127
NP_442264.1_2 Forward -387 -370 9.47861 0.196
NP_440841.1_4 Reverse -28 -47 0.687771 0.119
NP_441463.1_3 Reverse -259 -278 8.84924 0.0481
NP_442842.1_10 Forward -21 -2 3.96021 0.236
NP_441626.1_2 Forward -277 -270 15.7721 0.0124
NP_441626.1_2 Reverse -270 -277 15.7721 0.0124
NP_442365.1_5 Forward -277 -258 8.25926 0.221
NP_441460.1_5 Forward -187 -173 13.077 0.3
NP_442794.1_1 Reverse -265 -277 2.69391 0.286
NP_441401.1_4 Reverse -13 -26 13.0973 0.29
NP_442615.1_1 Reverse -260 -278 14.9655 0.00922
NP_440387.1_1 Reverse -269 -285 -3.67804 0.164
NP_441431.1_2 Forward -281 -267 18.8785 0.0152
NP_440114.1_10 Forward -278 -264 8.75105 0.195
NP_440114.1_10 Reverse -219 -233 7.9644 0.219
NP_442324.1_8 Forward -269 -250 15.9291 0.293
NP_440766.1_4 Reverse -265 -279 0.88457 0.263
NP_441237.1_9 Forward -277 -267 14.828 0.0242
NP_441237.1_9 Forward -377 -367 10.4031 0.233
NP_439998.1_4 Forward -292 -273 16.6615 0.237
NP_441984.1_3 Forward -127 -109 5.32902 0.287
NP_442509.1_9 Reverse -269 -279 14.7292 0.0242
NP_442509.1_9 Forward -287 -277 11.3859 0.134
NP_440660.1_7 Reverse -25 -44 -3.14714 0.298
NP_441253.1_8 Reverse -264 -278 12.1173 0.217
NP_440554.1_4 Reverse -270 -280 9.91146 0.0608
NP_440554.1_4 Forward -227 -217 2.92996 0.248
NP_441885.1_5 Forward -278 -268 11.0914 0.00874
NP_441885.1_5 Reverse -269 -279 2.33998 0.0799
NP_441885.1_5 Forward -383 -373 -1.49493 0.264
NP_440628.1_2 Reverse -250 -269 12.6841 0.206
NP_442703.1_9 Reverse -5 -23 3.46073 0.291
NP_442341.1_7 Reverse -367 -381 1.76955 0.281
NP_442341.1_9 Forward -280 -266 15.9285 0.0405
NP_441756.1_5 Forward -282 -263 -5.11376 0.298
NP_440423.1_6 Reverse -270 -289 -12.2919 0.194
NP_440423.1_6 Reverse -261 -280 -19.4701 0.239
NP_443000.1_7 Reverse -267 -277 10.3048 0.0345
NP_443000.1_7 Forward -280 -270 2.53664 0.226
NP_441842.1_10 Reverse -262 -276 13.7659 0.0689
NP_440275.1_3 Reverse -267 -277 8.04317 0.0602
NP_440275.1_3 Forward -280 -270 6.76487 0.0966
NP_440275.1_3 Forward -289 -279 2.83163 0.249
NP_440091.1_1 Reverse -265 -277 8.88877 0.0567
NP_441397.1_8 Forward -165 -152 12.5712 0.256
NP_440679.1_10 Reverse -271 -290 -14.2585 0.226
NP_442638.1_3 Reverse -55 -74 10.7424 0.298
NP_441635.1_1 Reverse -139 -158 15.6125 0.172
NP_441190.1_2 Reverse -206 -225 3.6377 0.182
NP_441207.1_7 Forward -96 -82 13.7088 0.205
NP_440216.1_1 Reverse -269 -283 -2.16369 0.0482
NP_440216.1_1 Forward -278 -264 -11.6035 0.203
NP_440216.1_1 Reverse -278 -292 -12.4884 0.274
NP_440172.1_1 Reverse -269 -279 9.7148 0.0586
NP_440172.1_1 Forward -278 -268 5.19158 0.149
NP_442015.1_10 Forward -282 -269 4.54251 0.167
NP_441226.1_7 Forward -277 -270 14.4934 0.0123
NP_441226.1_7 Reverse -270 -277 14.4934 0.0123
NP_441226.1_7 Forward -227 -220 9.47853 0.147
NP_441111.1_7 Forward -277 -269 18.7023 0.00294
NP_441111.1_7 Reverse -270 -278 8.96754 0.0463
NP_441766.1_2 Forward -278 -269 18.2893 0.00297
NP_441766.1_2 Reverse -269 -278 9.14451 0.0337
NP_442417.1_5 Reverse -269 -283 8.55439 0.155
NP_442252.1_3 Reverse -262 -280 15.5554 0.0849
NP_440416.1_9 Reverse -262 -281 -8.55534 0.117
NP_440416.1_9 Forward -294 -275 -18.8801 0.266
NP_443052.1_8 Reverse -259 -278 -7.96535 0.166
NP_442154.1_1 Reverse -270 -288 -17.2871 0.251
NP_440261.1_5 Reverse -270 -283 -2.93064 0.0983
NP_440261.1_5 Forward -286 -273 -11.1904 0.246
NP_440988.1_10 Forward -41 -27 7.60958 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTAATATTATTAATTATGGCTATGCCAATGCACCGGGTCATAATCAAATTAGCATCCAAGTAGAAGCGGATGATTGTCAATTAAAGGTTACTATGGTGGACACTGGCTTGCCCTACGATCCCCGCGATCGCCAATTTGATCAATCAATTCTTAGTCTGGAAGCAGAAGATCGACCCATCGGTGGACTAGGGATTTTTTTGGCTCTGCAAAGTGTAGATGAATTTACCTATGAAGTGAGGGGAAATAAAAATATTAGTTGTTTAGTCATGAATTTTGATCCTCCGGGCAATGATTAATGTTACGAGAGAAAGTAAATTAATTGAATAATTGCTACAATTACCAACATTTAAATATTTGATTTGCCCACTGCAACCTTTTCTTTGTTATTGTTTCTTTTTTC

CDS

ATGGCGATGTTACCTCTGCCAAACTATTGCCGTATTGCCCCGCGCCAACCAGAACCATTATCTAAATTTCACGGCCAGCAGTCTATTAGGTTGCAAAGTTTTCCTGAGCTCTGTTTAAGTTTACCTGAAGGCAGTCATTATTTGACTGCAAGAATGAATTTATATGAACATTTTGGTCATGATCAGGTGTTTAAAGCTTGCATTGATTACCTAGAAAAAGCCCTAGAAAAATTGGGAATACTAGATAGCGATATTCCAGCTAGGTTATTACTAGTTTTTCCGGATCACACCCGCACCGCCATTGCGGTTCGCCTACTGTTAGACGCTATTTTTTACTTCCAGGAAACCTATAAGCATTTACAATTCAGCATCCTTTTTGGTTTAGGTACCCATCCCCCTATGACACATAAAAGTGTGAGTGAATATTTGGGGGGGGAGCGTTATCAAAAATTGATTAATCTGGGAATTACTATTCGTCAACAGACCACAATTGCCCCCCTGGAACCCCAAGTAAAAATTAAGGTGCAAGATCGATTAAAAATTGATGAAGTTTCCAATTACAGTTTTGCAAATTTGAATAGAAACACTGCCCAGTTACCAGAATCGTTGAATCGCACTTATGTACGACCTAAAAATAGACAGAATAATCCTATAGCAAAGCAAATTCATCACCTTAGTGCTAACTCCCTTAGCCAGTGTACATAG

Protein

MAMLPLPNYCRIAPRQPEPLSKFHGQQSIRLQSFPELCLSLPEGSHYLTARMNLYEHFGHDQVFKACIDYLEKALEKLGILDSDIPARLLLVFPDHTRTAIAVRLLLDAIFYFQETYKHLQFSILFGLGTHPPMTHKSVSEYLGGERYQKLINLGITIRQQTTIAPLEPQVKIKVQDRLKIDEVSNYSFANLNRNTAQLPESLNRTYVRPKNRQNNPIAKQIHHLSANSLSQCT