Your browser is old and dusty. Try Google Chrome!

Details for slr1855

ORF slr1855
Accession NP_440970.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Forward -256 -237 1.86774 0.245
NP_440694.1_8 Forward -86 -67 7.07928 0.202
NP_442291.1_5 Forward -234 -218 3.20513 0.114
NP_442291.1_5 Forward -362 -346 -3.18639 0.236
NP_441453.1_4 Forward -233 -225 4.93597 0.224
NP_441453.1_8 Reverse -380 -397 8.00365 0.25
NP_441623.1_1 Reverse -380 -398 -4.70074 0.275
NP_440561.1_8 Forward -281 -262 5.60432 0.289
NP_441630.1_3 Reverse -216 -235 -0.688862 0.288
NP_443002.1_5 Forward -356 -338 10.4414 0.256
NP_442752.1_4 Reverse -224 -231 5.25066 0.256
NP_443027.1_4 Forward -112 -102 10.9931 0.109
NP_442975.1_10 Reverse -244 -258 3.53891 0.257
NP_442909.1_7 Forward -232 -218 5.60385 0.275
NP_440110.1_8 Reverse -283 -302 -1.57384 0.244
NP_442062.1_8 Reverse -362 -372 4.40493 0.217
NP_441900.1_2 Reverse -137 -155 -4.11147 0.288
NP_442242.1_4 Reverse -102 -109 9.77388 0.213
NP_441492.1_5 Forward -339 -320 6.05242 0.237
NP_441208.1_9 Reverse -83 -97 14.6509 0.0953
NP_441594.1_6 Forward -297 -278 1.17943 0.272
NP_442726.1_7 Forward -388 -370 7.09898 0.192
NP_441083.1_5 Forward -233 -223 7.05986 0.067
NP_441083.1_5 Reverse -218 -228 3.91327 0.162
NP_442827.1_8 Reverse -216 -235 0.392004 0.21
NP_442827.1_8 Forward -235 -216 -1.47628 0.247
NP_441738.1_2 Reverse -103 -110 13.3134 0.0335
NP_441713.1_1 Forward -239 -220 -8.26035 0.147
NP_441770.1_4 Forward -389 -370 -9.34199 0.25
NP_440178.1_7 Reverse -125 -144 -20.1584 0.186
NP_441025.1_5 Reverse -286 -300 18.2892 0.179
NP_441792.1_5 Forward -355 -339 9.39998 0.234
NP_441624.1_7 Forward -356 -342 7.86607 0.241
NP_440343.1_3 Forward -233 -215 2.47668 0.298
NP_440747.1_10 Reverse -369 -381 -11.4657 0.122
NP_442973.1_5 Forward -259 -240 11.7992 0.226
NP_441667.1_4 Forward -156 -137 15.8307 0.248
NP_440470.1_5 Reverse -53 -72 8.73709 0.245
NP_443018.1_3 Forward -374 -367 10.2655 0.107
NP_441634.1_8 Forward -392 -378 1.37622 0.198
NP_441634.1_8 Forward -386 -372 -4.7203 0.295
NP_440376.1_1 Reverse -372 -381 5.11294 0.144
NP_440376.1_1 Reverse -224 -233 3.34298 0.206
NP_442687.1_7 Forward -382 -372 4.89658 0.23
NP_441077.1_6 Forward -341 -325 3.09109 0.272
NP_441422.1_7 Reverse -124 -141 -4.38605 0.243
NP_442658.1_1 Forward -235 -225 4.89613 0.292
NP_441414.1_9 Reverse -224 -243 13.0775 0.0148
NP_441487.1_9 Reverse -125 -144 0.687771 0.219
NP_441127.1_1 Reverse -378 -392 7.76774 0.3
NP_440984.1_7 Forward -238 -224 8.84938 0.134
NP_442911.1_2 Forward -243 -224 -5.70374 0.165
NP_441580.1_6 Forward -382 -363 -7.37537 0.241
NP_440153.1_8 Forward -294 -281 5.42749 0.18
NP_441591.1_10 Reverse -369 -388 4.52268 0.297
NP_442536.1_7 Reverse -120 -139 8.65258 0.273
NP_443055.1_6 Forward -389 -371 9.16315 0.137
NP_442002.1_9 Forward -111 -104 10.7572 0.185
NP_440377.1_1 Forward -264 -247 14.366 0.195
NP_441916.1_7 Forward -371 -361 4.60159 0.169
NP_439966.1_7 Forward -235 -225 13.9425 0.0233
NP_442941.1_3 Forward -370 -360 4.60159 0.14
NP_440437.1_1 Reverse -95 -114 -3.83545 0.246
NP_439983.1_1 Reverse -138 -156 10.7364 0.289
NP_441196.1_4 Reverse -93 -112 9.24257 0.296
NP_441644.1_6 Forward -233 -223 3.71617 0.267
NP_440867.1_10 Forward -390 -371 4.81767 0.283
NP_442933.1_10 Forward -371 -362 5.50626 0.181
NP_442554.1_8 Reverse -225 -235 4.20827 0.193
NP_442476.1_1 Forward -75 -56 13.1297 0.225
NP_442476.1_6 Reverse -225 -239 4.03116 0.151
NP_442476.1_6 Reverse -363 -377 0.982901 0.233
NP_443009.1_5 Reverse -361 -372 3.40144 0.296
NP_442301.1_2 Reverse -143 -162 3.9319 0.284
NP_441715.1_4 Reverse -102 -112 5.19158 0.224
NP_440970.1_1 Forward -174 -160 15.5359 0.292
NP_440970.1_2 Forward -91 -74 17.9343 0.295
NP_440970.1_5 Forward -150 -131 24.4839 0.0201
NP_440970.1_6 Forward -275 -256 19.0748 0.269
NP_440379.1_5 Reverse -5 -24 -11.6036 0.299
NP_441618.1_7 Forward -21 -2 19.9207 0.188
NP_441020.2_6 Forward -112 -95 9.38028 0.173
NP_441673.1_1 Reverse -372 -381 -7.86675 0.187
NP_441673.1_1 Forward -381 -372 -7.96508 0.206
NP_441731.1_3 Forward -398 -379 -3.04881 0.284
NP_441637.1_9 Forward -251 -233 9.36059 0.223
NP_442719.1_2 Reverse -57 -75 -1.84987 0.178
NP_442719.1_2 Reverse -56 -74 -10.3063 0.272
NP_441612.1_2 Reverse -299 -309 14.9389 0.21
NP_441612.1_2 Forward -12 -2 8.45247 0.214
NP_442808.1_1 Forward -234 -224 6.76441 0.0982
NP_442775.1_6 Forward -262 -243 11.6025 0.277
NP_440145.1_3 Reverse -362 -381 3.34271 0.106
NP_440145.1_3 Forward -361 -342 -5.60541 0.273
NP_442542.1_2 Forward -235 -222 6.80412 0.205
NP_442050.1_5 Reverse -99 -109 10.8943 0.126
NP_442739.1_2 Forward -70 -51 9.78869 0.3
NP_442789.1_4 Forward -112 -93 -2.75381 0.242
NP_442724.1_1 Reverse -57 -67 15.9097 0.278
NP_441878.1_6 Forward -382 -372 0.865012 0.132
NP_441878.1_6 Reverse -371 -381 -7.00147 0.201
NP_442066.2_9 Forward -237 -224 16.3422 0.0536
NP_441308.1_8 Forward -235 -225 9.32148 0.226
NP_441308.1_8 Reverse -216 -226 8.92815 0.24
NP_441458.1_10 Forward -26 -7 6.98095 0.196
NP_441819.1_5 Forward -75 -56 14.7531 0.195
NP_441819.1_5 Reverse -52 -71 10.9334 0.261
NP_442212.1_1 Reverse -324 -343 23.008 0.035
NP_440861.1_2 Forward -344 -325 11.7435 0.27
NP_442347.1_2 Forward -232 -223 4.12963 0.284
NP_442347.1_2 Reverse -102 -111 3.93297 0.284
NP_442888.1_6 Reverse -237 -256 6.88262 0.216
NP_441037.1_4 Forward -235 -225 10.0465 0.21
NP_440151.1_5 Forward -376 -357 3.14605 0.289
NP_441633.1_3 Reverse -277 -290 -5.29059 0.234
NP_441633.1_3 Forward -97 -84 -7.25721 0.3
NP_440136.1_2 Reverse -225 -232 3.97235 0.288
NP_442998.1_10 Reverse -103 -110 12.3305 0.0564
NP_440299.1_1 Forward -261 -248 4.73861 0.201
NP_441743.1_1 Reverse -268 -287 9.93088 0.291
NP_440256.1_1 Reverse -359 -378 -3.93378 0.143
NP_441559.1_8 Reverse -106 -120 4.52282 0.117
NP_441559.1_8 Reverse -367 -381 -7.2769 0.289
NP_442158.1_4 Reverse -339 -349 10.7964 0.283
NP_441866.1_6 Forward -68 -49 6.98015 0.285
NP_441704.1_8 Forward -131 -112 8.84842 0.202
NP_442452.1_8 Reverse -356 -370 11.1104 0.283
NP_441464.1_8 Reverse -126 -140 10.4227 0.178
NP_442993.1_1 Reverse -342 -358 -9.87289 0.197
NP_442386.1_9 Forward -234 -225 9.14408 0.172
NP_442386.1_9 Reverse -380 -389 8.06244 0.209
NP_442386.1_9 Forward -372 -363 5.40752 0.253
NP_442386.1_9 Reverse -223 -232 4.52254 0.297
NP_440570.1_5 Reverse -362 -381 -1.7705 0.276
NP_440168.1_9 Reverse -370 -389 10.8159 0.209
NP_440586.1_1 Forward -166 -147 -6.29373 0.299
NP_440586.1_8 Forward -374 -367 9.08521 0.178
NP_442251.1_6 Reverse -102 -109 9.77388 0.162
NP_442959.1_7 Reverse -379 -398 19.469 0.0258
NP_442294.1_3 Reverse -199 -213 12.3887 0.289
NP_440439.1_1 Forward -374 -361 1.78924 0.143
NP_440439.1_1 Reverse -221 -234 -1.55401 0.273
NP_440372.1_2 Reverse -225 -232 4.07068 0.262
NP_442114.1_4 Reverse -224 -235 11.1701 0.142
NP_442114.1_8 Reverse -234 -248 7.07881 0.234
NP_440364.1_6 Forward -234 -221 13.6867 0.275
NP_442121.1_7 Reverse -277 -296 16.5191 0.146
NP_441877.1_7 Reverse -274 -293 17.3048 0.0595
NP_442713.1_1 Forward -182 -163 -0.787193 0.284
NP_442262.1_10 Forward -374 -367 9.18389 0.211
NP_441689.1_5 Reverse -216 -226 10.501 0.132
NP_441689.1_5 Reverse -99 -109 5.68278 0.215
NP_441898.1_2 Forward -101 -82 13.5683 0.298
NP_441896.1_5 Reverse -347 -354 12.2322 0.273
NP_441679.1_6 Forward -238 -219 -0.000545616 0.269
NP_440888.1_2 Forward -381 -367 5.89884 0.258
NP_440491.1_1 Forward -399 -380 6.52718 0.296
NP_439969.1_9 Reverse -387 -399 16.4603 0.254
NP_440237.1_5 Reverse -325 -339 19.5668 0.0673
NP_442033.1_10 Forward -383 -364 0.392778 0.107
NP_441543.1_2 Reverse -242 -251 5.70292 0.181
NP_441543.1_2 Reverse -363 -372 3.93297 0.3
NP_442845.1_2 Reverse -218 -232 14.7492 0.0774
NP_442845.1_2 Forward -381 -367 4.71948 0.254
NP_441469.1_8 Forward -234 -225 6.09625 0.236
NP_442315.1_1 Reverse -181 -199 5.91901 0.256
NP_442315.1_1 Reverse -184 -202 3.95239 0.285
NP_443064.1_6 Reverse -111 -121 8.39772 0.292
NP_442578.1_7 Reverse -363 -370 5.25066 0.251
NP_442578.1_7 Forward -109 -102 5.25066 0.251
NP_440939.1_1 Reverse -210 -223 18.1122 0.183
NP_442204.1_1 Reverse -358 -369 -0.236322 0.289
NP_442204.1_1 Forward -379 -368 -0.432984 0.299
NP_441560.1_8 Reverse -81 -100 16.6743 0.068
NP_440544.1_5 Forward -306 -299 14.5681 0.264
NP_442487.1_1 Reverse -100 -119 16.2232 0.141
NP_440516.1_2 Forward -377 -359 1.29745 0.201
NP_440516.1_8 Reverse -218 -227 7.17789 0.0754
NP_440516.1_8 Forward -233 -224 7.07956 0.0867
NP_441353.1_7 Forward -371 -353 15.1613 0.3
NP_442120.1_10 Reverse -156 -175 -9.14533 0.242
NP_440673.1_2 Forward -267 -248 11.2676 0.181
NP_440673.1_2 Reverse -91 -110 9.02386 0.259
NP_440673.1_2 Forward -391 -372 8.04834 0.284
NP_440673.1_7 Forward -378 -359 1.76941 0.24
NP_442219.1_9 Forward -232 -223 5.60459 0.146
NP_440436.1_4 Reverse -363 -372 4.42421 0.265
NP_441086.1_3 Forward -73 -54 5.75208 0.289
NP_442813.1_4 Reverse -330 -349 -5.9004 0.299
NP_442813.1_4 Reverse -327 -346 -6.88371 0.299
NP_442366.1_3 Forward -258 -240 -1.35749 0.211
NP_442206.1_10 Reverse -381 -396 0.766545 0.245
NP_443054.1_2 Reverse -277 -291 -0.295402 0.293
NP_441851.1_10 Forward -269 -259 5.97822 0.19
NP_442622.1_8 Forward -375 -357 -19.1554 0.296
NP_442515.1_1 Reverse -386 -400 -1.37704 0.253
NP_442515.1_1 Reverse -371 -385 -1.67204 0.26
NP_441683.1_7 Forward -150 -131 -5.80207 0.264
NP_441661.1_3 Forward -113 -96 4.16874 0.198
NP_442314.1_1 Reverse -355 -373 -0.669169 0.231
NP_440431.1_3 Forward -61 -42 -8.65367 0.236
NP_440431.1_3 Forward -352 -333 -10.4236 0.275
NP_440023.1_7 Forward -188 -169 8.06259 0.269
NP_442006.1_2 Reverse -372 -389 -16.5791 0.256
NP_442006.1_2 Forward -129 -112 -16.6774 0.261
NP_441570.1_1 Forward -110 -92 -17.8771 0.295
NP_441078.1_4 Reverse -372 -381 -1.57357 0.266
NP_442729.1_5 Reverse -191 -201 8.82982 0.244
NP_442348.1_2 Forward -399 -390 6.98123 0.293
NP_441432.1_9 Reverse -328 -341 14.028 0.157
NP_441432.1_9 Forward -248 -235 9.08315 0.282
NP_441333.1_1 Reverse -205 -215 13.4965 0.217
NP_442320.1_8 Forward -297 -283 -5.31028 0.217
NP_442540.1_7 Reverse -302 -320 7.98396 0.188
NP_442157.1_6 Forward -389 -371 15.8504 0.12
NP_442274.1_3 Reverse -284 -303 7.47261 0.297
NP_441057.1_3 Reverse -32 -51 -10.7186 0.214
NP_442353.1_4 Reverse -105 -124 5.11187 0.189
NP_442353.1_4 Forward -367 -348 -0.492971 0.29
NP_440713.1_4 Forward -375 -356 4.03102 0.231
NP_440713.1_4 Reverse -362 -381 1.57275 0.284
NP_442489.1_7 Reverse -372 -381 -1.08191 0.179
NP_440757.1_7 Reverse -367 -385 -2.53746 0.276
NP_440565.1_2 Forward -372 -358 15.7108 0.292
NP_441659.2_8 Forward -351 -341 7.55152 0.0593
NP_441022.1_1 Reverse -53 -62 15.0954 0.183
NP_441022.1_1 Forward -63 -54 15.0954 0.183
NP_441022.1_1 Forward -34 -25 11.1625 0.284
NP_441185.1_6 Forward -261 -242 1.76941 0.209
NP_442346.1_5 Forward -352 -342 7.74818 0.159
NP_440352.1_5 Reverse -243 -262 12.2664 0.229
NP_440555.1_1 Forward -386 -367 0.294447 0.294
NP_442603.1_7 Reverse -218 -232 10.3237 0.129
NP_442603.1_7 Forward -233 -219 8.84875 0.162
NP_441888.1_7 Forward -376 -362 10.4227 0.118
NP_441329.1_3 Forward -68 -58 12.0145 0.273
NP_441329.1_6 Forward -343 -324 -2.43547 0.294
NP_442162.1_8 Forward -269 -250 1.67108 0.265
NP_440671.1_2 Reverse -152 -166 14.4542 0.257
NP_442021.1_6 Forward -166 -147 14.0608 0.198
NP_441609.1_1 Forward -71 -52 0.58944 0.21
NP_441813.1_5 Forward -373 -363 -0.708283 0.272
NP_440594.1_5 Reverse -236 -255 4.12856 0.293
NP_440590.1_4 Reverse -225 -238 10.7374 0.025
NP_440821.1_4 Reverse -222 -232 3.02829 0.131
NP_440821.1_4 Forward -112 -102 -0.511621 0.269
NP_441239.1_9 Reverse -379 -391 8.00379 0.145
NP_442568.1_8 Forward -341 -327 19.3708 0.161
NP_442568.1_8 Forward -218 -204 9.73436 0.257
NP_441727.1_3 Forward -388 -369 4.03102 0.275
NP_440624.1_5 Forward -42 -24 6.51052 0.298
NP_441617.1_6 Reverse -56 -75 -4.81876 0.272
NP_440546.1_4 Reverse -224 -234 6.8464 0.276
NP_442041.1_2 Reverse -185 -203 8.86894 0.283
NP_440462.1_6 Forward -373 -363 5.19158 0.164
NP_440462.1_6 Forward -235 -225 5.19158 0.164
NP_440462.1_6 Reverse -360 -370 4.99491 0.175
NP_440462.1_6 Forward -112 -102 2.33998 0.29
NP_442340.1_3 Reverse -1 -20 -10.7186 0.291
NP_440868.1_4 Reverse -220 -232 4.46387 0.118
NP_440868.1_4 Forward -114 -102 0.923956 0.196
NP_441497.1_3 Reverse -380 -399 -2.45882 0.2
NP_441249.1_1 Reverse -315 -334 1.47442 0.257
NP_441249.1_8 Reverse -13 -32 2.0644 0.284
NP_440812.1_4 Reverse -228 -247 13.3767 0.25
NP_441848.1_4 Reverse -56 -72 8.88755 0.288
NP_441848.1_4 Reverse -247 -263 8.60108 0.288
NP_441084.1_6 Forward -353 -339 9.92586 0.257
NP_442039.1_3 Reverse -42 -61 16.3224 0.211
NP_442039.1_7 Forward -271 -261 8.33817 0.263
NP_441811.1_1 Reverse -371 -390 12.5858 0.257
NP_442837.1_3 Forward -370 -363 9.18389 0.144
NP_442053.1_1 Forward -233 -224 6.09625 0.147
NP_440914.1_1 Forward -233 -223 13.7874 0.0256
NP_440914.1_1 Reverse -381 -391 7.73678 0.224
NP_441011.1_8 Reverse -363 -372 5.01461 0.289
NP_442533.1_6 Forward -233 -224 4.22796 0.186
NP_442533.1_6 Reverse -342 -351 1.96635 0.28
NP_442229.1_1 Forward -137 -123 6.68548 0.212
NP_442293.1_6 Reverse -303 -322 13.7658 0.298
NP_441697.1_5 Reverse -54 -73 -10.0748 0.278
NP_440816.1_2 Forward -343 -324 7.88715 0.259
NP_441028.1_6 Forward -307 -297 12.0743 0.192
NP_441527.1_4 Forward -340 -321 14.8486 0.0458
NP_441527.1_4 Forward -341 -322 2.7211 0.126
NP_441527.1_4 Forward -342 -323 -9.02441 0.254
NP_440115.1_6 Reverse -359 -369 10.2065 0.115
NP_442492.1_2 Reverse -192 -211 3.44104 0.224
NP_440429.1_9 Reverse -111 -130 5.01433 0.215
NP_441286.1_1 Reverse -371 -383 -4.48425 0.161
NP_440670.1_8 Forward -110 -101 4.22796 0.202
NP_440670.1_8 Reverse -126 -135 3.34298 0.275
NP_440886.1_7 Forward -234 -224 12.5659 0.0805
NP_440828.1_4 Forward -391 -372 -4.91784 0.246
NP_440404.1_9 Forward -335 -316 10.074 0.215
NP_440799.1_10 Forward -341 -322 14.8474 0.234
NP_442213.1_6 Reverse -216 -235 5.11266 0.285
NP_440907.2_8 Reverse -225 -235 4.99446 0.228
NP_442264.1_2 Forward -400 -383 10.7569 0.185
NP_441463.1_2 Forward -69 -51 3.63839 0.198
NP_441463.1_2 Reverse -324 -342 1.71619 0.247
NP_442842.1_10 Reverse -321 -340 -0.0199524 0.273
NP_442365.1_7 Forward -114 -95 -5.40875 0.269
NP_441401.1_4 Forward -341 -328 14.6706 0.215
NP_441962.1_4 Forward -293 -274 -9.73531 0.22
NP_440387.1_1 Forward -110 -94 -5.15301 0.217
NP_441836.1_2 Reverse -2 -21 -5.11376 0.272
NP_442323.1_7 Forward -232 -213 6.78348 0.19
NP_441510.2_6 Reverse -362 -381 16.0265 0.132
NP_440293.1_3 Forward -383 -364 -4.91709 0.268
NP_440766.1_4 Reverse -220 -234 1.08123 0.255
NP_440766.1_5 Forward -68 -56 7.94227 0.288
NP_440422.1_10 Reverse -323 -342 5.46683 0.271
NP_440458.1_7 Reverse -40 -59 3.14526 0.218
NP_440213.1_5 Forward -262 -243 8.84924 0.275
NP_440142.1_3 Forward -151 -132 12.1925 0.276
NP_440473.1_9 Reverse -355 -374 -1.27885 0.144
NP_442509.1_9 Reverse -224 -234 8.14104 0.192
NP_442582.1_3 Reverse -56 -70 13.7625 0.257
NP_441496.1_1 Forward -76 -62 14.8129 0.265
NP_442587.1_9 Reverse -317 -330 12.5073 0.227
NP_440554.1_4 Reverse -102 -112 1.74999 0.29
NP_441845.1_6 Forward -245 -227 0.510803 0.274
NP_441761.1_8 Forward -368 -349 17.9119 0.26
NP_441885.1_5 Forward -233 -223 -0.314959 0.195
NP_442341.1_7 Reverse -223 -237 2.75286 0.247
NP_440191.1_6 Reverse -204 -218 13.1895 0.294
NP_440750.1_5 Forward -340 -326 5.50613 0.256
NP_442932.1_9 Forward -78 -59 5.50599 0.266
NP_440091.1_1 Forward -295 -283 0.432302 0.25
NP_439962.1_4 Reverse -154 -173 -1.67217 0.216
NP_440175.1_4 Forward -398 -379 -14.1602 0.273
NP_440149.1_8 Forward -171 -152 -3.63879 0.193
NP_440149.1_8 Reverse -111 -130 -7.4737 0.285
NP_440216.1_9 Reverse -250 -259 7.07956 0.289
NP_440172.1_1 Forward -233 -223 3.81494 0.216
NP_442662.1_4 Reverse -133 -152 18.1898 0.153
NP_442015.1_10 Reverse -368 -381 4.24752 0.177
NP_442015.1_10 Forward -16 -3 -0.177378 0.255
NP_441226.1_7 Forward -232 -225 8.59356 0.197
NP_440244.1_8 Reverse -52 -71 2.0644 0.291
NP_441766.1_2 Forward -227 -218 1.1797 0.299
NP_442417.1_5 Reverse -362 -376 5.70279 0.252
NP_442417.1_5 Forward -291 -277 5.60446 0.255
NP_440416.1_1 Reverse -282 -301 -3.54046 0.117
NP_440416.1_9 Reverse -355 -374 -17.9951 0.25
NP_443052.1_8 Forward -301 -282 -8.752 0.179
NP_443052.1_9 Forward -28 -9 -3.24547 0.247
NP_442116.1_6 Reverse -247 -264 9.12387 0.235
NP_440261.1_5 Reverse -373 -386 -11.7804 0.266
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGGCATTATTGCCATTGGGGCCTACGCCATGGATCGCTTGCGGTACCAAGCCACCGTCAAAAAAGGTGAAAAAAATCAAGCCCCCGCAGTTATTTTTCTCCGTAAAGCAGCGGCCACTGAAGGGTTAAAGCTGGGAACCATTTGCCATAGTTTATGGCTATTTTGCGCCGATCCCGATCTGCTTAAAGATAAAAAAGTCACCTGCGCCCACAACATTATTTGTGACGTGGAAAATGCTGGAGCGGATGTGGTGTATGAAGAGGATCAGACCGCCGAGTTGGTAATTGACGGCGATCTAATTACCGGCAAACATCCAGGCATGATTGAAGAATTTGTCAAAACTTTTGTTGAGCAAATCGAAGCTTAAAAACCTTTCCGTCCTTCCCGTGGCATCAACAT

CDS

ATGAGTCCCAAAATTAACTTTCCTTTTTCCGATCTGATTGCAGGTTATGTGACAAGTTACGACCAAGAAGCGGATATTTTTGGTCTGAAAACCTCCGACGGCCAAGAGTTTCAGGTCAAACTTAGTCCCATGGCCTACGCCAAAGTGATCCAAAACTTTGATGAAGGTTATCCCGATGCCACCGGCACTATGCGGACTTGGTTAACCCCAGGGCGATTTCTCTACGTTTACGGCGTTTTTTACCCTGATACGGCTATTTTTGACGGGAAACAGGTGGTCTTTGCAGGCAAAAAGCCAGCGGAATACGTGTTTGAGAAACAGGATTGGTGGATTAAACAGGTAAACTCCCTCGGTAAGTTTTTTATCAAAGCCCAATTTGGCGACGGGGAGATTGATTACCGCCATTACCGCACCGATTTGTCCATGAGTGGGGAGCGGTCAACGGTGAATTTTCGCCAAGAAACGGATACCATTTCCCGCCTGGTGTACGGCTTTGCTACCGCCTTTATGATGACCGGGGATGACCAATTTTTGGAGGCGGCGGAAAAAGGTACGGAGTATTTACGGGAGCATATGCGCTTTGTCGATAAGGACGAAGACATTATTTACTGGTACCACGCCATTGATGTGCAGGGGGAAAAAGAACAAAAAATCTTTGCGTCCGAATTTGGCGATGATTACGATGCTATTCCTGCCTACGAACAAATCTACGCTTTAGCCGGCCCCATCCAGACCTACCGTTGCACTGGCGATCGTCGTATTCTCCATGACGCAGAACAGACCATTAAACTGTTCGACAAATTTTTCCTAGACAAGAGCGAATATGGGGGGTACTTTTCCCATCTCGACCCTTTGATGTTGGATCCCCGCAGTGAATCCCTCGGTCCCAACAAAGCCCGGAAGAACTGGAACTCCGTGGGGGATCACGCTCCGGCTTATCTAATTAACCTATGGTTGGCCACCGGGGAGCAAAAATATGCCGATATGTTGGAATATACCTTCGACACCATTGAGAAATATTTCCCGGACTACGACCATAGCCCCTTTGTGCAAGAACGTTTTTACGAAGACTGGAGCCACGACACCACTTGGGGCTGGCAACAAAATCGGGCTGTGGTGGGGCACAACCTCAAAATTGCCTGGAATTTGATGCGGATGAATAGCCTCAAGTCCAAAGAAAAATATGTGGAGTTAGCCAAGAAAATTGCTGACCTGATGCCGGCGGTAGGTAGTGACCAACAGCGGGGCGGCTGGTACGACGTGGTAGAAAGGTTGTTGGATAACCATAGCCGTTGCCATCAATTTGTTTGGCATGACCGCAAAGCCTGGTGGCAACAGGAACAGGCGATTTTGGCCTATCTAATTTTGGCTGGTATTTTGGACGATGAAGAATACCACCGCCATGGCCAGGAGGCGTCCGCTTTCTATAACGCTTGGTTCCTAGATTTAGAAGATGGGGGCATTTACTTTAACGTCCTTGCCAACGGCATTCCCTACCTAGCGGGGGGTAATGAACGGGCTAAGGGTAGTCACTCCATGAGTGGTTACCATTCCTTTGAACTTTGTTATCTAGCGGCGGTGTACACCAATTTTCTGATCACCAAGCACCCCATGGATTTCTATTTCAAACCCTTGCCTAACGGTTTCCCCGACGGTATTCTGCGGGTATCCCCGGATATTCTTCCCCCTGGCAGTGTGGCGATCGCCAGTGTGGAAATTGACGGCAAACCCTATGAAAATTTCGATGCCCAGGGCTTAACTGTGACCTTACCCGACAGCCAAGAACGGGTCAAAATCAAAGTTCGTTTAGTCCCCACTGCCTAA

Protein

MSPKINFPFSDLIAGYVTSYDQEADIFGLKTSDGQEFQVKLSPMAYAKVIQNFDEGYPDATGTMRTWLTPGRFLYVYGVFYPDTAIFDGKQVVFAGKKPAEYVFEKQDWWIKQVNSLGKFFIKAQFGDGEIDYRHYRTDLSMSGERSTVNFRQETDTISRLVYGFATAFMMTGDDQFLEAAEKGTEYLREHMRFVDKDEDIIYWYHAIDVQGEKEQKIFASEFGDDYDAIPAYEQIYALAGPIQTYRCTGDRRILHDAEQTIKLFDKFFLDKSEYGGYFSHLDPLMLDPRSESLGPNKARKNWNSVGDHAPAYLINLWLATGEQKYADMLEYTFDTIEKYFPDYDHSPFVQERFYEDWSHDTTWGWQQNRAVVGHNLKIAWNLMRMNSLKSKEKYVELAKKIADLMPAVGSDQQRGGWYDVVERLLDNHSRCHQFVWHDRKAWWQQEQAILAYLILAGILDDEEYHRHGQEASAFYNAWFLDLEDGGIYFNVLANGIPYLAGGNERAKGSHSMSGYHSFELCYLAAVYTNFLITKHPMDFYFKPLPNGFPDGILRVSPDILPPGSVAIASVEIDGKPYENFDAQGLTVTLPDSQERVKIKVRLVPTA