Your browser is old and dusty. Try Google Chrome!

Details for slr1854

ORF slr1854
Accession NP_440969.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -262 -243 -29.3032 0.221
NP_440815.1_2 Reverse -240 -254 11.897 0.262
NP_442151.1_6 Reverse -196 -210 8.84938 0.164
NP_441818.1_9 Forward -120 -101 -7.27704 0.271
NP_440996.1_1 Forward -303 -284 13.8253 0.131
NP_442975.1_10 Forward -164 -150 4.22722 0.245
NP_441250.1_8 Forward -57 -48 17.8955 0.274
NP_439979.1_7 Reverse -306 -323 19.5084 0.175
NP_440878.1_1 Forward -123 -104 18.1907 0.19
NP_441900.1_2 Reverse -300 -318 -5.29143 0.288
NP_441043.1_8 Forward -246 -227 16.9124 0.225
NP_440916.1_1 Reverse -24 -38 8.35772 0.273
NP_441935.1_10 Forward -391 -372 15.9291 0.288
NP_442742.1_9 Reverse -75 -94 -6.39206 0.222
NP_441925.1_4 Reverse -300 -319 -16.4225 0.282
NP_441434.1_1 Reverse -328 -342 8.03294 0.26
NP_441434.1_6 Forward -96 -86 15.5163 0.277
NP_441738.1_2 Forward -58 -51 8.29857 0.176
NP_441713.1_8 Forward -51 -33 16.5388 0.171
NP_442570.1_3 Forward -304 -285 -4.6221 0.233
NP_442570.1_3 Reverse -33 -52 -6.98204 0.265
NP_441716.1_1 Reverse -372 -386 4.62115 0.254
NP_441327.1_1 Forward -80 -61 11.806 0.184
NP_440438.2_9 Forward -138 -119 21.3373 0.114
NP_440747.1_10 Forward -305 -293 -12.2524 0.254
NP_441847.1_9 Reverse -15 -33 16.0471 0.218
NP_440842.1_6 Reverse -236 -255 12.4867 0.25
NP_441014.1_10 Forward -263 -244 1.57197 0.227
NP_442848.1_5 Reverse -102 -120 -1.94747 0.276
NP_441012.1_4 Reverse -249 -262 9.16406 0.272
NP_440376.1_1 Forward -302 -293 1.86802 0.238
NP_442687.1_7 Reverse -102 -112 9.32148 0.0994
NP_442687.1_7 Reverse -195 -205 4.10993 0.266
NP_441846.1_10 Forward -319 -300 -21.0434 0.256
NP_441013.1_2 Reverse -311 -329 -3.52077 0.29
NP_440571.1_5 Reverse -334 -353 15.5357 0.221
NP_440691.1_5 Forward -372 -353 16.8141 0.184
NP_442658.1_1 Reverse -101 -111 4.89613 0.292
NP_442205.1_9 Reverse -145 -161 -3.08806 0.278
NP_442937.1_5 Forward -341 -322 12.5858 0.105
NP_442321.1_1 Reverse -35 -54 -4.81876 0.216
NP_442321.1_4 Reverse -187 -206 6.39097 0.255
NP_441317.1_4 Reverse -275 -289 9.65494 0.29
NP_442605.1_4 Forward -363 -344 11.5042 0.268
NP_442690.1_1 Reverse -72 -91 -14.8485 0.275
NP_440153.1_8 Reverse -241 -254 7.00078 0.168
NP_440465.1_9 Reverse -336 -354 7.29564 0.169
NP_440569.1_10 Forward -79 -60 2.91208 0.28
NP_441514.1_4 Reverse -61 -80 12.6001 0.292
NP_441079.1_7 Forward -345 -326 0.883656 0.182
NP_441079.1_7 Reverse -61 -80 -3.63955 0.238
NP_442500.1_8 Reverse -325 -339 8.53947 0.295
NP_442012.1_1 Reverse -97 -116 1.57275 0.214
NP_440723.1_10 Forward -167 -148 17.8609 0.231
NP_441556.1_6 Reverse -68 -86 18.6048 0.215
NP_441071.1_2 Forward -97 -78 12.3658 0.291
NP_442933.1_2 Forward -289 -271 9.3602 0.257
NP_442933.1_3 Reverse -54 -73 15.899 0.261
NP_442554.1_8 Forward -204 -194 1.84832 0.292
NP_442970.1_1 Reverse -77 -91 11.2797 0.269
NP_441762.1_7 Forward -113 -101 -6.45087 0.284
NP_442338.1_3 Reverse -232 -251 16.5628 0.266
NP_440379.1_5 Reverse -100 -119 -8.85033 0.256
NP_441015.1_10 Forward -255 -236 -2.95047 0.184
NP_441379.1_2 Forward -101 -82 4.62101 0.263
NP_442719.1_2 Forward -67 -49 -10.5029 0.276
NP_443058.1_7 Reverse -203 -222 2.85105 0.279
NP_442808.1_1 Reverse -310 -320 5.78111 0.141
NP_442808.1_1 Forward -314 -304 3.61784 0.234
NP_442113.1_10 Reverse -303 -322 -0.0988766 0.205
NP_440385.1_8 Reverse -61 -80 10.6469 0.239
NP_442792.1_6 Forward -321 -302 3.83436 0.282
NP_441878.1_6 Reverse -195 -205 1.25834 0.108
NP_441878.1_6 Forward -206 -196 -7.59145 0.245
NP_441036.1_9 Forward -26 -8 15.6538 0.144
NP_441458.1_10 Reverse -238 -257 4.916 0.225
NP_440676.1_7 Forward -213 -194 20.1573 0.0745
NP_442397.1_1 Forward -303 -289 13.9243 0.291
NP_442347.1_2 Reverse -294 -303 4.0313 0.284
NP_442594.1_9 Forward -99 -80 9.34008 0.228
NP_442047.1_2 Reverse -185 -199 13.3726 0.224
NP_440899.1_8 Reverse -338 -357 -11.2103 0.299
NP_440299.1_1 Reverse -192 -205 2.772 0.274
NP_441007.1_10 Forward -261 -248 -1.06236 0.3
NP_441362.1_2 Forward -93 -74 13.596 0.243
NP_441559.1_8 Reverse -298 -312 -3.04867 0.197
NP_441559.1_8 Reverse -299 -313 -3.63866 0.207
NP_441559.1_8 Forward -55 -41 -6.29359 0.276
NP_441559.1_8 Forward -307 -293 -6.88358 0.281
NP_441270.1_5 Forward -262 -243 12.6039 0.236
NP_440695.1_6 Forward -93 -79 9.1509 0.296
NP_441494.1_5 Forward -244 -230 16.7152 0.291
NP_442993.1_1 Reverse -304 -320 -12.5278 0.274
NP_441254.1_1 Forward -63 -50 11.9167 0.295
NP_442240.1_2 Forward -312 -293 -20.0601 0.295
NP_442714.1_5 Forward -180 -161 1.0811 0.253
NP_442959.1_5 Forward -82 -63 4.81767 0.299
NP_440969.1_1 Forward -335 -318 26.4899 0.00575
NP_440969.1_2 Forward -36 -17 22.0256 0.0623
NP_440969.1_3 Forward -237 -219 20.9628 0.0562
NP_440969.1_5 Forward -304 -285 24.5822 0.0207
NP_439937.1_9 Forward -113 -96 -8.31994 0.176
NP_442294.1_3 Forward -117 -103 15.0436 0.213
NP_440439.1_1 Reverse -148 -161 0.314277 0.194
NP_440439.1_1 Forward -323 -310 -1.849 0.285
NP_440271.1_2 Forward -328 -309 5.01433 0.247
NP_440770.1_3 Reverse -51 -65 14.6509 0.262
NP_442384.1_10 Reverse -293 -306 3.75586 0.179
NP_442114.1_8 Reverse -325 -339 3.53891 0.29
NP_441604.1_7 Forward -273 -254 11.8975 0.295
NP_440297.1_9 Forward -204 -194 6.76487 0.17
NP_440700.1_10 Forward -155 -136 17.3425 0.276
NP_442067.1_4 Forward -123 -104 5.70265 0.235
NP_440888.1_2 Reverse -196 -210 6.68548 0.223
NP_441771.1_4 Reverse -322 -341 20.059 0.0179
NP_440822.1_2 Reverse -307 -326 9.93088 0.202
NP_442277.1_4 Forward -240 -221 1.47364 0.276
NP_441469.1_8 Reverse -252 -261 8.45619 0.227
NP_443064.1_6 Forward -302 -292 9.75513 0.199
NP_440148.1_6 Reverse -368 -382 17.9078 0.255
NP_441560.1_8 Forward -117 -98 12.8761 0.246
NP_440783.1_5 Forward -319 -300 -6.1954 0.29
NP_440673.1_3 Forward -260 -253 7.41394 0.263
NP_440992.1_5 Reverse -100 -119 11.9854 0.297
NP_441884.1_9 Reverse -193 -212 -22.9117 0.284
NP_441884.1_9 Forward -163 -144 -23.305 0.284
NP_441004.1_5 Forward -145 -131 6.88276 0.296
NP_439949.1_7 Forward -339 -325 13.7659 0.242
NP_439949.1_7 Reverse -48 -62 12.9793 0.257
NP_441966.1_7 Reverse -243 -262 4.22689 0.192
NP_441851.1_10 Forward -313 -303 11.4848 0.0715
NP_442001.1_4 Forward -277 -258 6.78348 0.29
NP_441668.1_5 Reverse -40 -59 6.78429 0.279
NP_442515.1_1 Reverse -195 -209 1.86788 0.147
NP_441982.1_6 Reverse -80 -89 12.6763 0.274
NP_440463.1_8 Reverse -301 -320 4.98276 0.294
NP_440432.1_9 Reverse -197 -212 -3.36336 0.179
NP_442843.1_1 Forward -120 -101 -9.14533 0.264
NP_442843.1_7 Forward -98 -80 25.3196 0.00356
NP_440431.1_3 Reverse -73 -92 -4.22878 0.178
NP_440431.1_4 Forward -177 -158 -7.40105 0.262
NP_440431.1_5 Forward -295 -276 6.98095 0.299
NP_442006.1_2 Forward -214 -197 -15.3991 0.224
NP_442006.1_2 Forward -325 -308 -15.6941 0.228
NP_440483.1_1 Forward -326 -307 -8.35868 0.282
NP_441078.1_4 Forward -205 -196 6.09625 0.0863
NP_441078.1_4 Reverse -196 -205 -1.86856 0.272
NP_442729.1_8 Reverse -192 -205 7.29578 0.158
NP_442388.1_4 Reverse -243 -262 15.6332 0.197
NP_440539.1_9 Reverse -356 -375 -0.000545616 0.278
NP_442348.1_2 Reverse -51 -60 17.011 0.055
NP_442348.1_2 Forward -336 -327 7.17789 0.285
NP_442443.1_1 Forward -119 -100 9.43923 0.108
NP_440526.1_3 Forward -59 -48 5.85971 0.229
NP_441432.1_8 Forward -206 -197 3.04799 0.268
NP_441432.1_9 Forward -340 -327 12.1858 0.22
NP_440629.1_1 Forward -73 -55 2.28076 0.245
NP_440760.1_7 Forward -70 -51 10.0284 0.172
NP_442400.1_10 Forward -92 -79 8.17859 0.279
NP_442489.1_7 Forward -205 -196 -1.6719 0.235
NP_440757.1_6 Reverse -99 -118 14.9458 0.167
NP_441706.1_2 Forward -112 -93 15.6341 0.244
NP_440386.1_3 Forward -93 -74 -7.17871 0.274
NP_442913.1_10 Reverse -42 -61 -5.01543 0.254
NP_441800.1_7 Reverse -302 -320 -2.93078 0.268
NP_441923.1_6 Forward -324 -310 9.5377 0.278
NP_440486.1_9 Forward -44 -30 15.3392 0.193
NP_440010.1_10 Forward -117 -98 4.32602 0.246
NP_441943.1_8 Reverse -314 -333 -5.11376 0.245
NP_442551.1_4 Forward -207 -192 -2.38005 0.259
NP_440847.1_8 Reverse -25 -44 11.8975 0.277
NP_440449.1_6 Forward -321 -303 5.04615 0.284
NP_440671.1_5 Reverse -305 -319 13.5686 0.293
NP_442943.1_1 Reverse -63 -78 4.06266 0.24
NP_442943.1_1 Forward -79 -64 3.67984 0.26
NP_440772.1_7 Forward -369 -350 13.8641 0.193
NP_441609.1_1 Reverse -25 -44 0.491109 0.21
NP_441671.1_10 Forward -318 -299 6.98095 0.205
NP_442568.1_8 Forward -387 -373 10.0294 0.257
NP_442193.1_1 Reverse -85 -103 7.09898 0.298
NP_442629.1_4 Forward -122 -103 14.5524 0.263
NP_440573.1_3 Reverse -274 -287 18.8737 0.0806
NP_441119.1_1 Reverse -157 -176 2.85105 0.207
NP_442809.1_6 Reverse -241 -260 2.45773 0.265
NP_440546.1_6 Forward -260 -241 8.06259 0.265
NP_442479.1_9 Reverse -23 -42 -13.0786 0.288
NP_441848.1_4 Forward -68 -52 11.0839 0.232
NP_442679.1_1 Forward -179 -160 -4.6221 0.283
NP_442380.1_10 Forward -260 -242 18.702 0.131
NP_442696.1_6 Reverse -129 -148 -4.13045 0.159
NP_442786.1_5 Forward -50 -31 18.289 0.105
NP_441252.1_6 Reverse -321 -328 11.6422 0.288
NP_440914.1_1 Reverse -253 -263 7.83437 0.219
NP_442101.1_10 Forward -213 -194 -7.17871 0.209
NP_442533.1_1 Forward -318 -299 -9.93197 0.23
NP_442533.1_1 Reverse -34 -53 -10.0303 0.23
NP_442533.1_1 Forward -317 -298 -10.522 0.234
NP_442533.1_1 Reverse -35 -54 -14.7502 0.247
NP_442541.1_10 Forward -224 -210 1.08065 0.292
NP_440263.1_5 Forward -89 -75 8.55439 0.294
NP_442322.1_2 Reverse -325 -344 14.1583 0.229
NP_442322.1_4 Reverse -351 -368 -3.60008 0.249
NP_441697.1_5 Reverse -327 -346 -11.2207 0.294
NP_441961.1_4 Forward -120 -101 3.04771 0.281
NP_439903.1_6 Forward -163 -144 1.47364 0.245
NP_441286.1_1 Forward -206 -194 -5.36923 0.197
NP_441930.1_3 Reverse -60 -79 5.75208 0.263
NP_440886.1_7 Reverse -312 -322 8.3377 0.0805
NP_440028.1_6 Forward -261 -243 18.112 0.134
NP_442264.1_2 Forward -266 -249 10.2653 0.188
NP_441962.1_4 Forward -117 -98 -11.5053 0.241
NP_442323.1_7 Reverse -224 -243 0.981987 0.293
NP_442324.1_7 Forward -175 -156 11.3538 0.268
NP_441510.2_6 Forward -312 -293 14.7483 0.186
NP_440287.1_5 Reverse -304 -323 8.16011 0.286
NP_442087.1_5 Forward -314 -295 16.7157 0.245
NP_440293.1_3 Forward -120 -101 3.73603 0.192
NP_440293.1_9 Forward -255 -241 10.2813 0.276
NP_441531.1_6 Reverse -310 -323 7.49244 0.284
NP_442867.1_8 Reverse -356 -375 10.2259 0.214
NP_442680.1_5 Forward -358 -339 2.31911 0.237
NP_442936.1_10 Reverse -84 -98 9.45527 0.269
NP_441275.1_5 Forward -200 -181 13.8633 0.276
NP_442341.1_7 Reverse -195 -209 1.76955 0.281
NP_441756.1_5 Reverse -307 -326 2.26107 0.212
NP_440191.1_6 Forward -285 -271 14.7174 0.294
NP_440507.2_3 Forward -259 -240 7.27514 0.283
NP_441902.1_3 Reverse -97 -107 11.8156 0.288
NP_441902.1_3 Forward -178 -168 11.7184 0.293
NP_442451.1_2 Forward -68 -49 -11.6036 0.297
NP_442638.1_3 Forward -177 -158 21.0555 0.087
NP_441207.1_7 Forward -174 -160 8.57771 0.282
NP_439962.1_4 Forward -120 -101 3.24438 0.193
NP_442371.1_1 Forward -37 -27 12.7626 0.24
NP_442788.1_2 Forward -56 -37 23.9922 0.00616
NP_443052.1_9 Reverse -101 -120 -3.44213 0.25
NP_442116.1_6 Forward -79 -62 10.6517 0.215
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAAAAACGCTGTGCTGGATGATAAAGACCTCCAGGCAGGTCTGGGTGGGATTAATCCTAAATTTGGTGATTTTTGCACCAGGGTAGCGGGGGAAGCCTGGGGTTTACCATTAATTGATCAAAAAACTAAAGCCCTAATTGTCATTGCGGTGGATGTGGCTAATCAGACCCTCAGTGGCCCTTTTCAAGCCCATGTGGATATGGCCCTAAAACAGGGTGCTACTAAGGAAGAAATTGAAGAAGTGCTCTCCTTCATGTGTGTTTATGGTGGCTTTAATAAAGCCGCTGGAGCTTTTGCCGCCCTAAAAGAAATTTTCGAGCAAAATTCTTAGATAACTTTTAAAAATCCCCCCTGGTTCCCAACCTCGGAGAAATTTATTCCTCATCAAATTAGGAGCTTT

CDS

ATGACCACAACAAAAGGTAAGATTGGTGTCTTAATCGAAGAACATTTTGATGGCACTGAATATCGCTGGTTTAATGAGTATTTTCCCGCCCAGGGCTATGAAGTGGAATATATCAGCCATTTGTGGGGACAACCGGAACTGAAGTTTGGTTCTAACCCAGAAAATGACCAAGTGGAATACCACGTCACCGTAACCACGGAAGTGAATGATATTGACCCCAAAGATTACAAGGGCATTATTGCCATTGGGGCCTACGCCATGGATCGCTTGCGGTACCAAGCCACCGTCAAAAAAGGTGAAAAAAATCAAGCCCCCGCAGTTATTTTTCTCCGTAAAGCAGCGGCCACTGAAGGGTTAAAGCTGGGAACCATTTGCCATAGTTTATGGCTATTTTGCGCCGATCCCGATCTGCTTAAAGATAAAAAAGTCACCTGCGCCCACAACATTATTTGTGACGTGGAAAATGCTGGAGCGGATGTGGTGTATGAAGAGGATCAGACCGCCGAGTTGGTAATTGACGGCGATCTAATTACCGGCAAACATCCAGGCATGATTGAAGAATTTGTCAAAACTTTTGTTGAGCAAATCGAAGCTTAA

Protein

MTTTKGKIGVLIEEHFDGTEYRWFNEYFPAQGYEVEYISHLWGQPELKFGSNPENDQVEYHVTVTTEVNDIDPKDYKGIIAIGAYAMDRLRYQATVKKGEKNQAPAVIFLRKAAATEGLKLGTICHSLWLFCADPDLLKDKKVTCAHNIICDVENAGADVVYEEDQTAELVIDGDLITGKHPGMIEEFVKTFVEQIEA