Your browser is old and dusty. Try Google Chrome!

Details for slr1851

ORF slr1851
Accession NP_440405.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441098.1_3 Forward -195 -176 5.84395 0.25
NP_440784.1_7 Reverse -356 -363 7.51227 0.138
NP_442861.1_4 Forward -261 -242 0.686995 0.297
NP_442062.1_3 Forward -152 -133 -2.65548 0.272
NP_441594.1_6 Forward -367 -348 0.884433 0.279
NP_442110.1_2 Reverse -276 -289 16.8404 0.151
NP_440438.2_8 Forward -152 -133 4.12936 0.235
NP_442596.1_10 Reverse -377 -396 12.9791 0.234
NP_442145.1_4 Reverse -124 -143 7.49569 0.214
NP_440403.1_4 Reverse -340 -359 -1.67217 0.174
NP_443017.1_1 Reverse -126 -145 15.6218 0.249
NP_440376.1_1 Forward -295 -286 5.3096 0.137
NP_441077.1_6 Forward -148 -132 10.6108 0.16
NP_440781.1_1 Forward -355 -341 11.996 0.27
NP_441013.1_2 Forward -375 -357 0.117479 0.254
NP_442782.1_2 Forward -348 -334 0.196253 0.293
NP_439905.1_1 Reverse -340 -353 6.4108 0.288
NP_439905.1_5 Reverse -249 -263 11.406 0.288
NP_442690.1_1 Forward -141 -122 -10.3253 0.212
NP_442690.1_1 Forward -73 -54 -15.0452 0.277
NP_442690.1_1 Forward -199 -180 -16.5201 0.289
NP_442690.1_1 Reverse -16 -35 -17.0118 0.296
NP_440153.1_8 Reverse -355 -368 -2.53732 0.244
NP_442064.1_4 Forward -368 -349 5.50519 0.267
NP_440993.1_4 Reverse -334 -351 12.4285 0.171
NP_441294.1_7 Forward -293 -279 10.4985 0.185
NP_441125.1_6 Reverse -244 -257 11.229 0.25
NP_441550.1_7 Forward -100 -81 17.807 0.232
NP_441916.1_7 Reverse -359 -369 3.51995 0.213
NP_441041.1_4 Reverse -293 -312 -9.93197 0.226
NP_442396.1_5 Reverse -282 -295 18.6038 0.0171
NP_442941.1_2 Reverse -175 -194 18.7637 0.151
NP_441514.1_4 Reverse -245 -264 16.4832 0.185
NP_441079.1_7 Forward -148 -129 -6.88445 0.286
NP_442215.1_2 Reverse -284 -300 6.25339 0.0723
NP_442933.1_2 Forward -109 -91 6.30445 0.274
NP_442671.1_2 Forward -150 -131 -0.281761 0.294
NP_442142.1_4 Reverse -358 -371 7.68852 0.132
NP_442292.1_5 Reverse -263 -282 2.3594 0.257
NP_440405.1_1 Forward -99 -81 21.5528 0.121
NP_440405.1_2 Forward -332 -313 19.4681 0.123
NP_440405.1_3 Forward -246 -227 18.9543 0.0618
NP_442408.2_1 Reverse -287 -306 -6.98204 0.287
NP_441468.1_1 Forward -369 -362 6.72562 0.126
NP_441020.2_6 Forward -372 -355 8.59364 0.195
NP_441731.1_7 Forward -356 -337 1.37609 0.298
NP_441637.1_9 Forward -195 -177 -3.71743 0.296
NP_441764.1_1 Forward -142 -123 10.4225 0.195
NP_441764.1_4 Forward -154 -137 9.31325 0.29
NP_441764.1_8 Reverse -244 -254 15.7131 0.284
NP_441764.1_8 Forward -98 -88 11.5978 0.284
NP_441849.1_2 Forward -263 -244 1.86167 0.245
NP_442820.1_10 Forward -364 -346 9.85225 0.245
NP_441445.1_1 Reverse -271 -290 0.196116 0.281
NP_441445.1_1 Reverse -346 -365 0.0977854 0.283
NP_441433.1_8 Forward -235 -216 -0.197208 0.244
NP_440084.1_8 Forward -145 -131 8.70139 0.299
NP_442192.1_2 Forward -51 -32 21.0423 0.107
NP_441819.1_5 Forward -74 -55 15.135 0.195
NP_442645.1_2 Forward -297 -278 -17.4051 0.254
NP_440640.1_6 Reverse -287 -306 8.06259 0.17
NP_442333.2_5 Forward -392 -373 -7.17871 0.227
NP_440256.1_1 Reverse -352 -371 -7.76869 0.245
NP_441362.1_4 Forward -194 -176 10.7372 0.18
NP_441559.1_8 Forward -300 -286 -6.58858 0.279
NP_440997.1_6 Reverse -197 -216 10.6192 0.263
NP_440787.1_5 Reverse -189 -203 8.94771 0.297
NP_440306.1_5 Reverse -244 -263 -2.16383 0.298
NP_441199.1_7 Reverse -248 -267 3.93269 0.245
NP_442993.1_1 Forward -364 -348 -9.5779 0.188
NP_442054.1_4 Reverse -328 -347 8.55425 0.299
NP_441340.1_9 Reverse -244 -254 14.6181 0.194
NP_440161.1_3 Reverse -337 -356 8.75091 0.264
NP_442959.1_5 Forward -187 -168 8.75091 0.224
NP_440398.1_6 Forward -171 -152 8.75091 0.214
NP_440408.1_7 Forward -349 -330 8.06259 0.282
NP_440372.1_3 Reverse -182 -196 13.1895 0.269
NP_440267.1_1 Reverse -177 -193 18.0548 0.295
NP_442384.1_10 Reverse -355 -368 0.707601 0.282
NP_440693.1_6 Reverse -346 -365 14.5524 0.253
NP_441877.1_9 Forward -144 -127 2.69378 0.285
NP_441018.1_7 Forward -352 -333 7.37428 0.272
NP_440531.1_6 Forward -389 -370 -1.57384 0.234
NP_441060.1_4 Reverse -238 -256 3.85406 0.252
NP_440350.1_5 Forward -276 -257 -5.21209 0.289
NP_439926.1_7 Reverse -259 -277 9.65558 0.204
NP_440888.1_2 Reverse -366 -380 8.75042 0.149
NP_440888.1_2 Reverse -355 -369 8.75042 0.149
NP_440060.1_2 Forward -356 -337 13.7649 0.288
NP_441917.1_2 Reverse -290 -308 4.73903 0.288
NP_442845.1_2 Forward -376 -362 4.91614 0.249
NP_442710.1_6 Forward -59 -40 9.24257 0.204
NP_442337.1_7 Reverse -346 -364 19.882 0.0581
NP_441223.1_5 Reverse -243 -257 16.7213 0.162
NP_440710.1_1 Reverse -358 -376 -9.12563 0.294
NP_442428.1_8 Forward -353 -334 1.57275 0.228
NP_442577.1_9 Forward -324 -310 10.0287 0.289
NP_442694.1_9 Forward -252 -233 12.6841 0.207
NP_442206.1_10 Reverse -287 -302 0.176559 0.269
NP_442854.1_6 Forward -375 -356 8.06259 0.229
NP_441851.1_10 Reverse -285 -295 9.7148 0.114
NP_440593.1_3 Forward -300 -281 -7.17871 0.288
NP_442689.1_8 Forward -195 -178 -1.14113 0.209
NP_442689.1_8 Reverse -20 -37 -8.51595 0.294
NP_441124.1_5 Forward -190 -180 12.9127 0.215
NP_440431.1_4 Reverse -244 -263 -8.92892 0.275
NP_442450.1_5 Reverse -359 -369 13.2547 0.115
NP_441031.1_1 Reverse -121 -140 10.9682 0.193
NP_441031.1_1 Forward -147 -128 7.8832 0.257
NP_441031.1_8 Forward -381 -362 4.62101 0.177
NP_440195.1_4 Reverse -287 -306 4.52268 0.294
NP_441078.1_4 Reverse -286 -295 -1.6719 0.266
NP_441663.1_6 Forward -356 -337 16.7157 0.196
NP_442348.1_2 Forward -349 -340 11.6028 0.232
NP_442443.1_1 Reverse -332 -351 3.14605 0.177
NP_440793.1_1 Forward -279 -265 9.34041 0.293
NP_441432.1_8 Forward -296 -287 5.3096 0.17
NP_441333.1_1 Reverse -20 -30 11.5899 0.241
NP_441030.1_4 Reverse -237 -256 5.68135 0.277
NP_440760.1_1 Forward -295 -276 -16.1268 0.166
NP_442400.1_10 Reverse -180 -193 16.7729 0.135
NP_442489.1_7 Reverse -286 -295 -1.6719 0.235
NP_441659.2_6 Forward -140 -121 14.0599 0.234
NP_441040.1_2 Forward -353 -334 1.67108 0.119
NP_439956.1_7 Forward -354 -335 6.39097 0.257
NP_439956.1_7 Forward -381 -362 2.16274 0.276
NP_440025.1_3 Reverse -147 -161 9.44903 0.296
NP_440449.1_6 Reverse -278 -296 6.69963 0.241
NP_440751.1_8 Reverse -2 -21 5.70265 0.233
NP_441329.1_6 Forward -64 -45 1.38421 0.239
NP_441329.1_6 Reverse -51 -70 -2.62645 0.294
NP_440671.1_1 Forward -144 -125 8.42796 0.204
NP_442140.1_3 Reverse -294 -304 3.71661 0.283
NP_442810.1_2 Forward -109 -91 12.8014 0.232
NP_440227.1_2 Reverse -179 -195 12.8416 0.271
NP_440665.1_1 Reverse -287 -306 -7.67036 0.224
NP_441617.1_6 Reverse -279 -298 -7.27704 0.292
NP_440546.1_4 Forward -370 -360 6.8464 0.276
NP_441497.1_2 Forward -263 -244 10.5209 0.221
NP_441848.1_4 Reverse -54 -70 8.02812 0.288
NP_442039.1_7 Forward -81 -71 10.8948 0.257
NP_442679.1_1 Reverse -242 -261 2.85105 0.158
NP_442679.1_2 Reverse -254 -273 10.0292 0.215
NP_440160.1_2 Reverse -360 -379 -0.787193 0.232
NP_440724.1_5 Reverse -256 -274 14.8671 0.262
NP_442533.1_6 Reverse -361 -370 2.26134 0.266
NP_442533.1_6 Forward -364 -355 2.26134 0.266
NP_440263.1_5 Forward -194 -180 9.34103 0.294
NP_440854.1_2 Forward -295 -276 9.83255 0.26
NP_442229.1_9 Reverse -207 -226 17.4032 0.12
NP_441697.1_5 Reverse -130 -149 12.0793 0.111
NP_441697.1_5 Forward -147 -128 -7.01908 0.239
NP_441527.1_4 Reverse -245 -264 6.06331 0.106
NP_441527.1_4 Reverse -254 -273 -6.7326 0.224
NP_441527.1_4 Reverse -177 -196 -11.3162 0.281
NP_441527.1_4 Reverse -257 -276 -12.5576 0.291
NP_440608.1_1 Reverse -239 -258 9.99995 0.213
NP_441602.1_3 Reverse -281 -300 -2.55715 0.233
NP_441106.1_3 Forward -145 -126 13.9625 0.16
NP_441869.1_4 Reverse -29 -48 14.3558 0.189
NP_441705.1_3 Reverse -251 -270 -4.91709 0.291
NP_439899.1_1 Forward -145 -127 8.56748 0.18
NP_440028.1_6 Reverse -294 -312 12.5072 0.24
NP_441021.1_8 Forward -81 -63 2.67408 0.241
NP_441626.1_4 Reverse -148 -167 16.0274 0.156
NP_442238.1_3 Forward -375 -356 12.1925 0.133
NP_441962.1_4 Forward -165 -146 -13.5702 0.275
NP_441431.1_2 Reverse -362 -376 8.25877 0.221
NP_440358.1_8 Forward -261 -242 -1.18052 0.274
NP_441272.1_7 Reverse -280 -290 13.943 0.257
NP_440293.1_9 Forward -369 -355 16.2726 0.144
NP_441246.1_7 Reverse -299 -318 9.0459 0.197
NP_439910.1_2 Reverse -351 -368 -13.7275 0.162
NP_440987.1_8 Reverse -93 -107 14.4542 0.294
NP_442680.1_5 Forward -39 -20 3.3937 0.233
NP_442680.1_5 Forward -40 -21 0.072229 0.269
NP_442297.1_10 Reverse -117 -136 12.0942 0.288
NP_441489.1_3 Reverse -182 -196 8.79688 0.232
NP_442439.1_8 Reverse -94 -113 14.1591 0.153
NP_442703.1_1 Reverse -241 -260 6.63627 0.266
NP_442703.1_9 Forward -162 -144 12.9005 0.227
NP_440119.1_1 Forward -311 -295 2.32015 0.222
NP_440191.1_6 Forward -66 -52 15.9588 0.294
NP_440191.1_6 Reverse -19 -33 13.5715 0.294
NP_440552.1_8 Forward -256 -239 10.6517 0.262
NP_440312.1_6 Forward -256 -237 17.0481 0.271
NP_441902.1_3 Reverse -263 -273 13.8563 0.226
NP_441207.1_7 Reverse -247 -261 10.8044 0.253
NP_440216.1_9 Reverse -242 -251 6.39124 0.289
NP_440172.1_1 Forward -364 -354 2.14332 0.283
NP_440167.1_3 Reverse -345 -364 8.16093 0.281
NP_441045.1_1 Reverse -258 -277 11.1109 0.3
NP_443052.1_9 Forward -312 -293 -5.01543 0.265
NP_442116.1_6 Reverse -121 -138 5.59067 0.293
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCACTCTGCACCACTCATATCACTGGCACAGGGCTGGCGCTGACTATTTCCGGCATTGGTTGGACCACTCATCGGAACTACTAAAATCCTACTCCTCCACCATAGGGATTCGCCAAAACCAATTCGTTTCTCCTCTACTTTCTTTAATTTTTCTTTGGAAATAAGCCCTTACATAGCAATAAATTGTGCTTGATACCTACAGCTATTTTTTCGTAAATTTAATGTACGATTTACTCCCGAGACTTTGCAGCAATAAATGTTAAATTTTGTATCGATATTCAACGTTTCTGTATCTAGCCATAAATAAAATTTGAGTTACAATGGGAGAAGAGTGTTTTTAAAATTAAGTGCAAAAAGTCGGTGTGATTTAAAGCAAAAAAAGTCGCTGTGTAGAAAAGG

CDS

ATGAAAACTATGGATGCCCAGGAAATTCTTCGGTGTTACGCGCAAGGACAAAGGGATTTTAGTCATATAAACTTGGTCAGAGTCTGTTTGTCCAATGCAAGCCTAATCGGAGCACAACTAATTTTCGTAGACCTCGGTGGTGCAAACTTAACCCGTGCACAGCTTGACAGTGCAACCTTAAAAAACGCCAATCTTGCTTTAGCTAATATGACGGAGGTGTGTTTGATTTATGCTGATTTGAGTAATGCAGACCTTAGTGGTGCAAATTTAGTGGGGGCAGATCTAACCAATGCAGATCTATCGGGGGCAAAACTAGGGGGGGCAGACTTACGAAAAGCGAACTTGTCTGAAGCTAGTCTTCGGGGAGCAGATTTGCGCGGTGTGAACTTGATCGAAGCCAACCTAACAAATACAGATTTTAGCGAGGCAGACTTAACGGGGGCTTACATAAGTGATGGCGCAGTGATTAATGTTGTCAATCTCTCCTAA

Protein

MKTMDAQEILRCYAQGQRDFSHINLVRVCLSNASLIGAQLIFVDLGGANLTRAQLDSATLKNANLALANMTEVCLIYADLSNADLSGANLVGADLTNADLSGAKLGGADLRKANLSEASLRGADLRGVNLIEANLTNTDFSEADLTGAYISDGAVINVVNLS