Your browser is old and dusty. Try Google Chrome!

Details for slr1847

ORF slr1847
Accession NP_440399.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -125 -139 11.111 0.253
NP_441061.1_2 Forward -185 -171 8.84938 0.083
NP_441061.1_2 Reverse -178 -192 3.24451 0.166
NP_440557.1_1 Forward -185 -166 -1.67217 0.276
NP_440795.1_7 Forward -185 -178 14.6904 0.0123
NP_440795.1_7 Reverse -178 -185 14.6904 0.0123
NP_441418.1_6 Forward -186 -167 -0.295539 0.0102
NP_441418.1_6 Reverse -177 -196 -20.0601 0.103
NP_441418.1_6 Forward -198 -179 -30.6798 0.291
NP_442291.1_5 Reverse -176 -192 17.9548 0.0165
NP_440897.1_6 Forward -186 -167 11.0117 0.0705
NP_441453.1_1 Reverse -170 -188 14.6697 0.0938
NP_441453.1_4 Reverse -177 -185 16.539 0.00633
NP_441453.1_4 Forward -186 -178 16.539 0.00633
NP_441453.1_4 Forward -134 -126 5.23096 0.157
NP_441453.1_4 Reverse -79 -87 5.13263 0.179
NP_441960.1_4 Reverse -163 -179 11.8575 0.279
NP_442151.1_6 Forward -186 -172 10.4227 0.123
NP_441818.1_1 Reverse -178 -189 18.0527 0.00639
NP_441818.1_9 Forward -307 -288 -10.1286 0.292
NP_440150.1_6 Reverse -174 -193 5.89931 0.229
NP_442173.1_1 Forward -185 -177 15.4574 0.00633
NP_442173.1_1 Reverse -178 -186 15.4574 0.00633
NP_442752.1_4 Forward -186 -179 13.8055 0.0199
NP_442752.1_4 Reverse -177 -184 13.8055 0.0199
NP_442752.1_4 Reverse -125 -132 4.56234 0.265
NP_443027.1_4 Reverse -175 -185 14.828 0.0437
NP_443027.1_4 Forward -188 -178 11.0914 0.107
NP_441812.1_3 Forward -187 -173 8.06273 0.254
NP_441812.1_3 Forward -228 -214 7.86607 0.259
NP_442975.1_10 Reverse -173 -187 14.0603 0.0459
NP_440784.1_7 Forward -185 -178 15.9687 0.0123
NP_440784.1_7 Reverse -178 -185 15.9687 0.0123
NP_440784.1_7 Reverse -372 -379 6.43063 0.218
NP_442909.1_7 Reverse -178 -192 13.8636 0.12
NP_440061.1_9 Reverse -175 -189 20.6484 0.00331
NP_440110.1_8 Forward -188 -169 20.059 0.0149
NP_442062.1_3 Reverse -20 -39 0.491109 0.239
NP_442062.1_8 Forward -186 -176 19.4496 0.000558
NP_442062.1_8 Reverse -177 -187 17.3846 0.00193
NP_442062.1_8 Forward -134 -124 4.20827 0.228
NP_442062.1_8 Forward -88 -78 4.0116 0.237
NP_441900.1_2 Forward -75 -57 -5.88141 0.288
NP_441859.1_3 Reverse -176 -195 9.43841 0.129
NP_440304.1_4 Reverse -175 -185 10.8948 0.051
NP_440304.1_4 Reverse -222 -232 3.32329 0.299
NP_440304.1_4 Forward -188 -178 1.84832 0.299
NP_442242.1_4 Forward -185 -178 14.3954 0.0124
NP_442242.1_4 Reverse -178 -185 14.3954 0.0124
NP_440044.1_8 Reverse -178 -197 -0.590531 0.224
NP_440044.1_8 Forward -185 -166 -1.67217 0.248
NP_440044.1_8 Reverse -219 -238 -2.75381 0.269
NP_441208.1_9 Forward -189 -175 5.1128 0.278
NP_441594.1_6 Reverse -168 -187 8.45592 0.153
NP_442110.1_7 Forward -186 -172 12.3893 0.0586
NP_442110.1_7 Reverse -177 -191 0.687908 0.252
NP_442110.1_7 Forward -192 -178 0.196253 0.266
NP_441925.1_4 Forward -336 -317 -17.3075 0.293
NP_441083.1_5 Reverse -177 -187 20.3345 0.00053
NP_441083.1_5 Forward -186 -176 11.3864 0.0159
NP_441083.1_5 Forward -134 -124 9.51814 0.026
NP_441083.1_5 Reverse -244 -254 4.10993 0.158
NP_441083.1_5 Reverse -125 -135 -0.609952 0.272
NP_442827.1_8 Reverse -169 -188 -0.984623 0.238
NP_441738.1_2 Forward -184 -177 15.28 0.0102
NP_441738.1_2 Reverse -179 -186 15.28 0.0102
NP_441738.1_2 Forward -132 -125 11.7401 0.0647
NP_441738.1_2 Forward -323 -316 6.72528 0.236
NP_440209.1_1 Reverse -177 -185 18.1123 0.00295
NP_440209.1_1 Forward -186 -178 18.1123 0.00295
NP_442889.1_8 Reverse -174 -188 4.52221 0.263
NP_441713.1_1 Reverse -171 -190 -16.2252 0.278
NP_440178.1_7 Reverse -176 -195 -20.7484 0.199
NP_442570.1_3 Forward -188 -169 5.89931 0.159
NP_441716.1_1 Reverse -177 -191 19.9608 0.00829
NP_441716.1_1 Forward -186 -172 3.73617 0.259
NP_442111.1_4 Forward -187 -173 19.6658 0.00373
NP_442111.1_4 Reverse -176 -190 2.94952 0.259
NP_440906.1_5 Forward -185 -178 15.8704 0.0124
NP_440906.1_5 Reverse -178 -185 15.8704 0.0124
NP_440747.1_10 Forward -189 -177 16.8536 0.00143
NP_440747.1_10 Reverse -174 -186 7.70879 0.00236
NP_440747.1_10 Forward -137 -125 -2.32097 0.0331
NP_440747.1_10 Reverse -76 -88 -2.32097 0.0331
NP_440747.1_10 Reverse -122 -134 -4.18925 0.0817
NP_440747.1_10 Reverse -241 -253 -12.2524 0.254
NP_441130.1_10 Reverse -175 -189 20.3541 0.00768
NP_441486.1_1 Forward -189 -175 11.2093 0.0168
NP_441486.1_1 Reverse -174 -188 4.52282 0.0432
NP_441486.1_1 Reverse -122 -136 -5.80194 0.26
NP_440944.1_2 Forward -319 -300 -0.590531 0.259
NP_442634.1_4 Forward -188 -174 7.76774 0.0479
NP_441265.1_3 Reverse -171 -185 2.94952 0.181
NP_440403.1_4 Forward -195 -176 -8.85033 0.261
NP_440403.1_10 Reverse -168 -187 5.50599 0.242
NP_441014.1_10 Forward -187 -168 3.44025 0.214
NP_442848.1_1 Forward -192 -178 17.7975 0.0143
NP_441012.1_4 Reverse -173 -186 7.19745 0.272
NP_441012.1_4 Reverse -103 -116 6.31247 0.282
NP_441012.1_4 Reverse -179 -192 5.82081 0.29
NP_443018.1_3 Forward -185 -178 14.8871 0.0123
NP_443018.1_3 Reverse -178 -185 14.8871 0.0123
NP_441316.1_10 Forward -376 -359 13.6085 0.298
NP_441634.1_8 Forward -188 -174 6.48943 0.114
NP_440376.1_1 Forward -186 -177 19.4693 0.000692
NP_440376.1_1 Reverse -177 -186 19.4693 0.000692
NP_440376.1_1 Forward -134 -125 7.76787 0.0688
NP_440376.1_1 Reverse -125 -134 6.48957 0.0963
NP_441588.1_4 Forward -132 -122 8.63316 0.14
NP_442687.1_7 Reverse -176 -186 15.8113 0.0125
NP_442687.1_7 Forward -187 -177 8.92815 0.0994
NP_442687.1_7 Reverse -124 -134 4.10993 0.266
NP_442191.1_4 Forward -185 -171 17.5862 0.0182
NP_442589.1_1 Reverse -315 -334 20.5506 0.0572
NP_442485.1_3 Reverse -166 -185 3.93269 0.192
NP_442485.1_3 Reverse -62 -81 3.73603 0.193
NP_441846.1_10 Reverse -317 -336 -22.6167 0.264
NP_441846.1_10 Reverse -124 -143 -22.8133 0.266
NP_441846.1_10 Forward -187 -168 -23.4033 0.285
NP_442958.1_3 Forward -253 -234 -0.787193 0.268
NP_442958.1_3 Forward -197 -178 -1.47551 0.277
NP_441013.1_3 Forward -198 -179 10.1275 0.219
NP_441422.1_7 Reverse -175 -192 -2.91109 0.225
NP_441950.1_7 Forward -304 -285 -5.01543 0.221
NP_442658.1_1 Reverse -175 -185 15.9091 0.00966
NP_442658.1_1 Forward -188 -178 7.94438 0.199
NP_442198.1_3 Forward -150 -131 4.52268 0.275
NP_442198.1_7 Forward -189 -170 12.3883 0.198
NP_441855.2_4 Reverse -169 -188 11.9332 0.204
NP_442782.1_2 Forward -186 -172 7.57108 0.202
NP_442782.1_2 Reverse -316 -330 1.27789 0.281
NP_442205.1_9 Forward -173 -157 -3.38305 0.282
NP_441414.1_9 Reverse -177 -196 1.96607 0.0704
NP_441256.1_1 Forward -65 -46 -9.047 0.271
NP_442937.1_5 Forward -191 -172 11.3075 0.141
NP_442937.1_5 Forward -297 -278 10.9142 0.151
NP_442937.1_5 Forward -232 -213 6.78429 0.27
NP_441958.1_5 Forward -187 -177 12.2714 0.00183
NP_441958.1_5 Reverse -176 -186 12.2714 0.00183
NP_441958.1_5 Reverse -124 -134 0.57002 0.139
NP_441958.1_5 Forward -89 -79 0.57002 0.139
NP_442836.1_5 Forward -192 -173 4.42435 0.209
NP_440203.1_5 Forward -323 -313 12.1726 0.164
NP_440984.1_7 Forward -139 -125 9.04604 0.131
NP_439990.1_5 Forward -191 -178 5.42749 0.295
NP_442911.1_2 Forward -196 -177 14.4541 0.0112
NP_442911.1_2 Reverse -167 -186 -9.73531 0.262
NP_441580.1_6 Reverse -166 -185 -7.67036 0.246
NP_440153.1_5 Reverse -178 -192 17.8958 0.0482
NP_440153.1_5 Forward -185 -171 1.76955 0.245
NP_440153.1_8 Reverse -218 -231 -2.53732 0.244
NP_442064.1_4 Reverse -167 -186 5.01354 0.281
NP_443055.1_6 Reverse -290 -308 1.88669 0.224
NP_440934.1_1 Reverse -111 -130 5.30933 0.239
NP_442210.1_9 Forward -190 -172 13.0972 0.209
NP_440138.1_6 Reverse -178 -197 9.53674 0.175
NP_441099.1_5 Forward -196 -177 -8.94866 0.209
NP_441099.1_5 Reverse -69 -88 -9.53865 0.226
NP_442002.1_9 Reverse -176 -183 10.7572 0.185
NP_442567.1_3 Forward -297 -281 11.7599 0.281
NP_441424.1_2 Forward -350 -331 12.8432 0.186
NP_441646.1_1 Forward -193 -174 0.491109 0.251
NP_442438.1_10 Reverse -172 -186 19.0758 0.0137
NP_442438.1_10 Forward -191 -177 0.196253 0.236
NP_442431.1_10 Forward -304 -286 1.00246 0.262
NP_442885.1_5 Reverse -179 -198 18.9765 0.0873
NP_441000.1_6 Reverse -176 -190 4.22782 0.0964
NP_442771.1_1 Forward -188 -170 -6.96235 0.169
NP_440484.1_3 Forward -188 -174 11.406 0.242
NP_440147.1_4 Reverse -175 -188 11.0324 0.0341
NP_440147.1_4 Forward -188 -175 7.39411 0.0695
NP_440147.1_4 Reverse -123 -136 6.50913 0.0911
NP_440147.1_4 Forward -90 -77 4.73917 0.149
NP_441295.1_4 Reverse -172 -191 -4.13045 0.29
NP_441550.1_8 Forward -188 -178 15.1225 0.0132
NP_441550.1_8 Reverse -175 -185 6.0761 0.214
NP_441916.1_7 Forward -186 -176 18.4663 0.00144
NP_441916.1_7 Reverse -177 -187 10.3048 0.0261
NP_441916.1_7 Reverse -79 -89 7.55152 0.0639
NP_441041.1_4 Forward -186 -167 2.3594 0.0735
NP_441041.1_4 Forward -134 -115 -6.49039 0.168
NP_441041.1_4 Forward -233 -214 -6.78538 0.174
NP_441041.1_7 Reverse -174 -186 7.61196 0.162
NP_441041.1_7 Reverse -159 -171 5.27969 0.265
NP_443063.1_5 Reverse -360 -379 15.0432 0.287
NP_442004.1_6 Reverse -177 -191 2.35953 0.266
NP_441725.1_4 Forward -191 -177 4.22722 0.278
NP_441725.1_5 Forward -185 -175 11.2881 0.0247
NP_441725.1_5 Reverse -178 -188 2.04498 0.115
NP_439966.1_7 Reverse -175 -185 18.4657 0.00473
NP_439966.1_7 Forward -188 -178 15.3192 0.0152
NP_439966.1_7 Forward -136 -126 7.55106 0.15
NP_439966.1_9 Reverse -175 -184 0.983037 0.253
NP_442941.1_3 Reverse -178 -188 19.2529 0.00262
NP_442941.1_3 Forward -185 -175 11.4848 0.0116
NP_442941.1_3 Reverse -80 -90 0.0783647 0.231
NP_440289.1_2 Reverse -174 -187 11.819 0.0171
NP_440289.1_2 Forward -189 -176 -3.52063 0.267
NP_440260.1_8 Reverse -168 -186 -7.25734 0.295
NP_441678.1_2 Forward -153 -134 8.84924 0.238
NP_442281.1_1 Reverse -172 -186 19.7634 0.00247
NP_442281.1_1 Forward -191 -177 8.55376 0.0798
NP_442281.1_1 Forward -139 -125 7.57046 0.0969
NP_441334.1_7 Forward -188 -169 -11.2103 0.12
NP_442256.1_2 Forward -188 -170 -6.1757 0.214
NP_442256.1_2 Reverse -175 -193 -9.61729 0.281
NP_440437.1_1 Reverse -171 -190 11.3075 0.0411
NP_442012.1_1 Forward -192 -173 -0.000545616 0.249
NP_442012.1_1 Forward -157 -138 -1.57384 0.292
NP_442049.1_6 Forward -194 -175 10.1275 0.215
NP_441457.1_7 Reverse -62 -81 3.24438 0.246
NP_441860.1_2 Reverse -252 -271 13.9625 0.262
NP_441556.1_7 Reverse -208 -227 1.37531 0.287
NP_441556.1_10 Forward -379 -365 12.7526 0.195
NP_441644.1_6 Reverse -177 -187 17.3841 0.00127
NP_441644.1_6 Forward -186 -176 10.1076 0.0628
NP_441644.1_6 Forward -134 -124 7.74772 0.117
NP_442644.1_9 Forward -277 -258 18.1907 0.1
NP_442215.1_2 Forward -188 -172 6.9417 0.0699
NP_442215.1_2 Reverse -123 -139 -5.54633 0.251
NP_442029.1_6 Reverse -209 -228 9.43923 0.188
NP_442029.1_6 Forward -191 -172 7.57094 0.223
NP_442247.1_5 Reverse -290 -304 15.0597 0.234
NP_442247.1_6 Reverse -47 -66 16.9124 0.11
NP_440253.1_2 Reverse -177 -195 3.65739 0.114
NP_440253.1_2 Reverse -244 -262 1.19912 0.166
NP_440253.1_2 Forward -186 -168 -2.14413 0.261
NP_440929.1_8 Forward -186 -177 19.2726 0.000701
NP_440929.1_8 Reverse -177 -186 19.2726 0.000701
NP_440929.1_8 Forward -134 -125 7.37455 0.0713
NP_440929.1_8 Reverse -125 -134 6.78456 0.082
NP_440566.1_6 Forward -90 -71 9.53756 0.289
NP_442933.1_6 Forward -39 -20 14.5621 0.284
NP_442933.1_10 Forward -186 -177 17.601 0.00325
NP_442933.1_10 Reverse -177 -186 17.601 0.00325
NP_441751.2_8 Reverse -178 -192 -3.04867 0.134
NP_441751.2_8 Reverse -80 -94 -6.78525 0.283
NP_442554.1_8 Reverse -178 -188 16.2046 0.0065
NP_442554.1_8 Forward -185 -175 13.8447 0.0145
NP_442554.1_8 Reverse -219 -229 6.46988 0.117
NP_442554.1_8 Reverse -126 -136 2.33998 0.274
NP_442075.1_6 Reverse -45 -64 14.0608 0.278
NP_441762.1_7 Forward -187 -175 2.89058 0.0676
NP_441762.1_7 Reverse -176 -188 2.39892 0.0676
NP_442142.1_4 Reverse -174 -187 17.1282 0.0264
NP_442142.1_4 Reverse -295 -308 8.67183 0.111
NP_442142.1_4 Forward -189 -176 6.90188 0.153
NP_442292.1_1 Reverse -178 -187 18.486 0.00229
NP_442292.1_1 Forward -185 -176 9.63616 0.0183
NP_440919.1_7 Reverse -359 -377 8.24673 0.215
NP_442143.1_3 Reverse -80 -99 2.65439 0.244
NP_442476.1_6 Reverse -178 -192 8.25939 0.105
NP_442476.1_6 Reverse -126 -140 0.196253 0.269
NP_443009.1_5 Forward -187 -176 18.3477 0.00265
NP_442741.1_5 Forward -226 -207 19.8623 0.0685
NP_441715.1_4 Reverse -178 -188 17.3846 0.0106
NP_441715.1_4 Forward -185 -175 16.303 0.0117
NP_441448.1_1 Forward -121 -102 6.98095 0.236
NP_440379.1_5 Reverse -64 -83 -2.65548 0.199
NP_440379.1_5 Reverse -168 -187 -7.57203 0.246
NP_441468.1_1 Forward -185 -178 15.8704 0.0124
NP_441468.1_1 Reverse -178 -185 15.8704 0.0124
NP_441020.2_6 Forward -188 -171 10.2653 0.149
NP_441020.2_6 Reverse -123 -140 6.62702 0.26
NP_441015.1_10 Forward -191 -172 6.39097 0.109
NP_441015.1_10 Forward -185 -166 0.687771 0.165
NP_441015.1_10 Forward -121 -102 -9.24366 0.281
NP_441673.1_1 Forward -186 -177 20.8459 0.000698
NP_441673.1_1 Reverse -177 -186 20.8459 0.000698
NP_441673.1_1 Reverse -125 -134 1.67135 0.0404
NP_441673.1_1 Forward -134 -125 1.47469 0.0936
NP_441673.1_1 Reverse -79 -88 -8.06341 0.254
NP_441826.1_2 Reverse -171 -185 13.5693 0.0214
NP_441826.1_2 Forward -192 -178 9.93102 0.0532
NP_442490.1_9 Forward -88 -69 0.0977854 0.178
NP_442490.1_9 Reverse -165 -184 -0.688862 0.179
NP_442868.1_6 Forward -188 -178 19.2529 0.00563
NP_442868.1_6 Reverse -175 -185 0.963343 0.205
NP_442677.1_8 Reverse -151 -169 11.6222 0.18
NP_441612.1_2 Reverse -177 -187 8.54929 0.21
NP_442227.1_2 Reverse -170 -189 -3.04881 0.289
NP_442361.1_3 Reverse -171 -184 18.9972 0.0363
NP_442808.1_1 Reverse -176 -186 18.4657 0.00201
NP_442808.1_1 Forward -135 -125 9.51767 0.0481
NP_442808.1_1 Forward -187 -177 8.63269 0.0481
NP_442808.1_1 Forward -327 -317 3.12618 0.248
NP_442775.1_6 Forward -191 -172 11.1109 0.277
NP_440145.1_1 Reverse -313 -331 18.0137 0.156
NP_442718.1_2 Forward -286 -267 -6.68705 0.295
NP_442542.1_2 Reverse -175 -188 9.45906 0.134
NP_442542.1_2 Reverse -326 -339 5.62415 0.257
NP_442542.1_9 Reverse -170 -184 12.3887 0.11
NP_442050.1_5 Forward -188 -178 14.3359 0.0206
NP_442050.1_5 Reverse -175 -185 9.12434 0.193
NP_442050.1_5 Forward -90 -80 7.84605 0.243
NP_441493.2_10 Forward -197 -178 7.96426 0.249
NP_441114.1_3 Forward -324 -315 7.27622 0.247
NP_440558.1_2 Reverse -215 -234 9.24257 0.102
NP_440558.1_2 Forward -195 -176 -5.40875 0.258
NP_440558.1_2 Reverse -274 -293 -7.37537 0.293
NP_442789.1_4 Forward -188 -169 3.6377 0.162
NP_442789.1_4 Forward -73 -54 -1.08219 0.213
NP_441518.1_3 Reverse -167 -186 -15.0452 0.286
NP_441878.1_6 Forward -187 -177 10.4031 0.0176
NP_441878.1_6 Reverse -176 -186 10.4031 0.0176
NP_441036.1_8 Reverse -176 -186 17.7779 0.000554
NP_441036.1_8 Forward -187 -177 8.33817 0.174
NP_441557.1_5 Forward -186 -177 19.9609 0.000699
NP_441557.1_5 Reverse -177 -186 19.9609 0.000699
NP_441557.1_5 Reverse -125 -134 0.786375 0.106
NP_441557.1_5 Forward -134 -125 0.589713 0.134
NP_441557.1_5 Forward -88 -79 -0.68859 0.229
NP_441445.1_1 Forward -382 -363 0.392778 0.275
NP_442267.1_6 Forward -197 -178 16.0274 0.265
NP_442066.2_4 Forward -186 -167 10.0292 0.0702
NP_442066.2_9 Forward -321 -308 6.50913 0.284
NP_442419.1_2 Forward -191 -172 -2.45882 0.247
NP_441308.1_8 Reverse -175 -185 10.1081 0.22
NP_440101.1_3 Forward -93 -74 0.58944 0.297
NP_440101.1_5 Reverse -170 -189 6.19431 0.192
NP_440101.1_10 Forward -233 -214 4.12936 0.225
NP_441458.1_10 Reverse -168 -187 13.0775 0.0856
NP_441458.1_10 Forward -143 -124 3.44104 0.251
NP_442830.1_5 Forward -327 -313 5.99717 0.22
NP_442183.1_1 Forward -186 -172 9.93102 0.0903
NP_442183.1_1 Reverse -177 -191 7.47274 0.141
NP_441549.1_9 Forward -190 -172 5.62401 0.0925
NP_442347.1_2 Reverse -178 -187 12.4878 0.056
NP_442347.1_2 Forward -185 -176 11.1111 0.056
NP_442645.1_2 Forward -194 -175 -12.0953 0.144
NP_442645.1_2 Forward -382 -363 -15.1435 0.19
NP_442645.1_2 Reverse -216 -235 -20.65 0.288
NP_441037.1_4 Forward -115 -105 7.61007 0.237
NP_441037.1_4 Reverse -175 -185 7.02532 0.237
NP_442594.1_8 Forward -122 -103 8.25926 0.206
NP_441633.1_3 Forward -188 -175 10.7374 0.0286
NP_441633.1_3 Reverse -175 -188 -3.71729 0.177
NP_440136.1_2 Forward -185 -178 15.9687 0.0123
NP_440136.1_2 Reverse -178 -185 15.9687 0.0123
NP_442590.1_10 Forward -192 -173 11.8975 0.15
NP_442998.1_8 Reverse -26 -45 14.0599 0.271
NP_442998.1_10 Forward -184 -177 15.5754 0.0102
NP_442998.1_10 Reverse -179 -186 15.5754 0.0102
NP_442998.1_10 Forward -132 -125 6.0373 0.205
NP_440899.1_2 Reverse -166 -185 7.27514 0.231
NP_440299.1_1 Reverse -173 -186 20.1765 0.00128
NP_440299.1_1 Forward -190 -177 17.9149 0.00502
NP_440299.1_1 Reverse -75 -88 4.64028 0.205
NP_441799.1_1 Forward -190 -176 11.012 0.0629
NP_441799.1_1 Forward -138 -124 6.48882 0.17
NP_441799.1_1 Reverse -173 -187 4.03056 0.269
NP_441007.1_5 Reverse -178 -197 12.1925 0.203
NP_441007.1_10 Forward -191 -178 -0.964025 0.296
NP_442201.1_10 Reverse -166 -185 -14.3569 0.281
NP_442333.2_5 Reverse -166 -185 -12.2919 0.249
NP_440256.1_1 Forward -189 -170 12.2908 0.0121
NP_440256.1_1 Reverse -174 -193 7.37428 0.0259
NP_440256.1_1 Reverse -76 -95 1.76941 0.0717
NP_440256.1_1 Reverse -122 -141 -0.590531 0.095
NP_440256.1_1 Reverse -313 -332 -8.94866 0.27
NP_441559.1_8 Forward -191 -177 3.04785 0.143
NP_441559.1_8 Reverse -172 -186 2.45787 0.143
NP_441559.1_8 Forward -330 -316 -5.60527 0.267
NP_441559.1_8 Forward -139 -125 -6.19526 0.275
NP_441559.1_8 Forward -331 -317 -6.98191 0.281
NP_440915.1_6 Reverse -173 -187 5.70279 0.0879
NP_440915.1_6 Forward -190 -176 2.85119 0.111
NP_440915.1_6 Reverse -75 -89 -0.688726 0.205
NP_440915.1_6 Forward -176 -162 -3.24533 0.292
NP_442158.1_4 Forward -295 -285 12.7631 0.242
NP_442785.1_7 Reverse -175 -189 11.2093 0.228
NP_441704.1_8 Forward -197 -178 6.58682 0.258
NP_442031.1_5 Forward -200 -181 4.32602 0.298
NP_440702.1_2 Forward -188 -169 -0.295539 0.257
NP_440026.1_4 Forward -189 -170 14.4541 0.239
NP_441939.1_3 Forward -87 -68 19.3707 0.0118
NP_441939.1_3 Reverse -80 -99 8.84924 0.161
NP_441494.1_6 Reverse -219 -232 5.91914 0.292
NP_442386.1_9 Reverse -176 -185 15.7322 0.0144
NP_442386.1_9 Forward -187 -178 13.8639 0.0289
NP_440570.1_5 Reverse -69 -88 -2.75381 0.28
NP_441750.1_4 Reverse -75 -94 5.01433 0.2
NP_441340.1_5 Forward -185 -178 15.6737 0.0124
NP_441340.1_5 Reverse -178 -185 15.6737 0.0124
NP_441340.1_5 Reverse -126 -133 4.07068 0.239
NP_441947.1_4 Reverse -166 -185 12.5858 0.234
NP_442484.1_2 Reverse -102 -121 2.0644 0.226
NP_440168.1_9 Forward -188 -169 0.58944 0.264
NP_440327.1_6 Forward -88 -69 2.45773 0.296
NP_442240.1_1 Forward -194 -175 6.09517 0.258
NP_442240.1_2 Forward -185 -166 -4.13045 0.0842
NP_440586.1_8 Forward -185 -178 13.2151 0.026
NP_440586.1_8 Reverse -178 -185 13.2151 0.026
NP_442251.1_6 Forward -185 -178 15.2804 0.0124
NP_442251.1_6 Reverse -178 -185 15.2804 0.0124
NP_441262.1_3 Reverse -177 -184 14.7888 0.0223
NP_441262.1_3 Forward -186 -179 14.7888 0.0223
NP_441262.1_3 Reverse -125 -132 5.34899 0.181
NP_443051.1_1 Reverse -176 -185 10.4228 0.00754
NP_443051.1_1 Forward -187 -178 10.4228 0.00754
NP_443051.1_1 Forward -89 -80 0.196389 0.213
NP_439937.1_9 Reverse -176 -193 -8.31994 0.176
NP_440439.1_1 Forward -189 -176 11.4257 0.033
NP_440439.1_1 Reverse -174 -187 8.37742 0.0537
NP_440439.1_1 Forward -137 -124 -1.55401 0.273
NP_440372.1_2 Forward -185 -178 16.3621 0.0124
NP_440372.1_2 Reverse -178 -185 16.3621 0.0124
NP_440372.1_2 Reverse -126 -133 4.36568 0.205
NP_440271.1_2 Reverse -308 -327 2.75272 0.28
NP_440171.1_3 Reverse -313 -332 1.47442 0.294
NP_441138.1_5 Forward -53 -40 9.89744 0.238
NP_441181.1_6 Forward -379 -361 6.41066 0.219
NP_440991.1_5 Forward -61 -42 19.8623 0.168
NP_441803.1_2 Reverse -172 -191 6.78429 0.149
NP_439977.1_5 Reverse -61 -80 9.24257 0.0937
NP_439977.1_5 Reverse -171 -190 -2.55715 0.284
NP_441572.1_7 Reverse -171 -190 8.84924 0.074
NP_440267.1_2 Reverse -142 -156 7.96378 0.182
NP_442384.1_10 Reverse -177 -190 22.4387 0.00194
NP_442384.1_10 Forward -186 -173 15.7522 0.00946
NP_442384.1_10 Reverse -125 -138 4.24752 0.163
NP_441877.1_7 Forward -191 -172 0.785326 0.254
NP_441018.1_7 Forward -190 -171 17.404 0.069
NP_441018.1_7 Forward -237 -218 9.83255 0.218
NP_442262.1_10 Forward -185 -178 14.1988 0.0123
NP_442262.1_10 Reverse -178 -185 14.1988 0.0123
NP_441689.1_5 Reverse -175 -185 8.53436 0.132
NP_441689.1_5 Forward -188 -178 5.78111 0.197
NP_442244.1_3 Forward -183 -164 9.63589 0.148
NP_440163.1_10 Reverse -174 -184 16.303 0.0762
NP_440344.1_10 Reverse -170 -187 9.87194 0.00789
NP_440344.1_10 Forward -193 -176 -8.51595 0.129
NP_440344.1_10 Reverse -118 -135 -12.4492 0.254
NP_440531.1_6 Reverse -169 -188 9.63589 0.074
NP_440531.1_6 Forward -142 -123 5.01433 0.118
NP_442917.1_1 Reverse -23 -42 7.96345 0.254
NP_440487.1_1 Forward -189 -170 4.22769 0.127
NP_441965.1_3 Forward -196 -177 13.8641 0.076
NP_441965.1_10 Forward -189 -173 6.15506 0.185
NP_442693.1_7 Reverse -176 -195 10.2259 0.227
NP_440297.1_9 Forward -185 -175 9.32148 0.0917
NP_440297.1_9 Reverse -178 -188 -0.118297 0.282
NP_441592.1_4 Reverse -183 -202 -3.63879 0.286
NP_440894.1_10 Reverse -172 -191 2.55606 0.288
NP_442067.1_4 Reverse -166 -185 14.7491 0.0735
NP_440999.1_9 Reverse -173 -187 13.1759 0.0329
NP_440999.1_9 Reverse -103 -117 2.94952 0.14
NP_440999.1_9 Forward -190 -176 0.0979218 0.193
NP_440999.1_9 Forward -138 -124 -2.45868 0.27
NP_440888.1_2 Forward -186 -172 17.6002 0.00354
NP_440888.1_2 Reverse -177 -191 17.1085 0.00462
NP_440888.1_2 Reverse -107 -121 6.39049 0.236
NP_440600.1_4 Forward -194 -176 -1.65248 0.174
NP_440491.1_1 Forward -189 -170 9.93819 0.205
NP_440052.1_5 Reverse -360 -379 -4.72043 0.265
NP_442948.1_2 Reverse -176 -195 11.7992 0.128
NP_442033.1_10 Reverse -175 -194 -4.81876 0.179
NP_441543.1_2 Forward -185 -176 18.486 0.00236
NP_441543.1_2 Reverse -178 -187 16.9127 0.00359
NP_442845.1_2 Forward -186 -172 7.47274 0.195
NP_442845.1_2 Forward -198 -184 3.24451 0.298
NP_441319.1_8 Reverse -171 -189 9.0656 0.223
NP_441469.1_8 Reverse -176 -185 16.126 0.00797
NP_441469.1_8 Forward -187 -178 6.48957 0.227
NP_443064.1_6 Reverse -177 -187 12.5669 0.0796
NP_442578.1_7 Forward -185 -178 14.5921 0.026
NP_442578.1_7 Reverse -178 -185 14.5921 0.026
NP_440710.1_1 Reverse -169 -187 -1.16082 0.179
NP_440220.1_4 Forward -294 -275 -1.57461 0.264
NP_441462.1_2 Forward -186 -176 11.5831 0.00406
NP_441462.1_2 Reverse -177 -187 11.5831 0.00406
NP_441462.1_2 Reverse -125 -135 0.766681 0.125
NP_441621.1_7 Forward -188 -174 -3.44199 0.188
NP_443062.1_1 Reverse -177 -195 5.42569 0.229
NP_443062.1_6 Forward -194 -175 16.4207 0.0652
NP_443062.1_6 Reverse -117 -136 3.14605 0.243
NP_441601.1_4 Reverse -170 -189 -1.86883 0.293
NP_442204.1_1 Forward -190 -179 9.79344 0.0736
NP_442204.1_1 Reverse -173 -184 9.69511 0.0736
NP_442204.1_5 Reverse -167 -186 1.17943 0.241
NP_441560.1_10 Reverse -169 -188 9.24257 0.235
NP_441351.1_8 Reverse -133 -152 6.4893 0.202
NP_440516.1_2 Reverse -171 -189 -2.83245 0.299
NP_440516.1_6 Forward -326 -312 7.07881 0.284
NP_440516.1_8 Forward -186 -177 16.9127 0.00442
NP_440516.1_8 Reverse -177 -186 16.9127 0.00442
NP_440516.1_8 Reverse -125 -134 7.47288 0.0581
NP_440516.1_8 Forward -134 -125 5.3096 0.116
NP_442428.1_5 Forward -185 -178 15.8704 0.0124
NP_442428.1_5 Reverse -178 -185 15.8704 0.0124
NP_442823.1_8 Forward -93 -74 9.83255 0.299
NP_441867.1_2 Reverse -319 -338 -20.0601 0.291
NP_440673.1_2 Reverse -361 -380 9.90183 0.228
NP_440673.1_3 Forward -184 -177 12.4288 0.0426
NP_440673.1_3 Reverse -179 -186 12.4288 0.0426
NP_441052.1_2 Reverse -177 -187 19.9412 0.00106
NP_441052.1_2 Forward -186 -176 10.5014 0.0285
NP_441052.1_2 Forward -134 -124 0.57002 0.256
NP_442219.1_9 Reverse -178 -187 17.7976 0.00718
NP_442219.1_9 Forward -185 -176 8.35786 0.0681
NP_442219.1_9 Forward -87 -78 5.70292 0.135
NP_442219.1_9 Forward -133 -124 5.01461 0.193
NP_440436.1_4 Forward -185 -176 18.1905 0.00233
NP_440436.1_4 Reverse -178 -187 17.2072 0.00233
NP_441884.1_8 Reverse -176 -195 -0.787193 0.138
NP_441884.1_9 Reverse -174 -193 -14.6519 0.138
NP_441884.1_9 Forward -172 -153 -21.535 0.25
NP_441884.1_9 Forward -189 -170 -22.3217 0.277
NP_441719.1_4 Forward -185 -178 16.3621 0.0124
NP_441719.1_4 Reverse -178 -185 16.3621 0.0124
NP_441004.1_1 Forward -88 -69 -14.0619 0.263
NP_441004.1_4 Reverse -325 -335 8.63316 0.269
NP_441004.1_5 Reverse -313 -327 9.63603 0.252
NP_442366.1_3 Forward -187 -169 -2.3408 0.226
NP_442139.1_7 Forward -238 -219 8.55425 0.253
NP_440129.1_10 Reverse -170 -184 6.48943 0.177
NP_442873.1_3 Reverse -167 -186 10.7167 0.169
NP_442873.1_3 Reverse -363 -382 5.11187 0.262
NP_441115.1_4 Reverse -176 -194 8.96649 0.229
NP_442694.1_4 Forward -77 -68 11.6028 0.277
NP_442206.1_10 Forward -186 -171 4.69978 0.178
NP_442206.1_10 Reverse -177 -192 1.06154 0.238
NP_443054.1_2 Forward -188 -174 1.08123 0.251
NP_441851.1_10 Reverse -176 -186 16.008 0.00552
NP_441851.1_10 Forward -187 -177 15.8113 0.00552
NP_442814.1_2 Reverse -317 -336 4.32602 0.294
NP_442622.1_8 Reverse -177 -195 -18.7621 0.268
NP_442856.1_7 Reverse -168 -187 -3.04881 0.24
NP_441668.1_4 Forward -196 -177 3.14605 0.187
NP_441668.1_4 Forward -243 -224 -1.86883 0.283
NP_442515.1_1 Reverse -176 -190 0.392915 0.193
NP_442515.1_1 Forward -187 -173 -4.81863 0.298
NP_441683.1_5 Reverse -153 -172 12.8808 0.165
NP_440940.1_7 Reverse -167 -185 3.8533 0.271
NP_441349.1_10 Forward -196 -177 11.7992 0.022
NP_440432.1_2 Reverse -171 -190 -1.86883 0.249
NP_442843.1_1 Forward -307 -288 -9.83364 0.271
NP_439960.1_10 Reverse -170 -188 0.805796 0.207
NP_441124.1_5 Forward -394 -384 10.2389 0.289
NP_442450.1_5 Reverse -175 -185 9.32148 0.115
NP_442168.1_5 Reverse -97 -116 2.0644 0.232
NP_440588.1_2 Forward -195 -176 5.211 0.0708
NP_442006.1_2 Forward -374 -357 -17.7591 0.282
NP_441003.1_9 Reverse -168 -187 7.07928 0.237
NP_441570.1_1 Forward -186 -168 10.1472 0.0095
NP_441570.1_1 Reverse -177 -195 1.88744 0.0281
NP_441078.1_4 Forward -186 -177 19.6659 0.0007
NP_441078.1_4 Reverse -177 -186 19.6659 0.0007
NP_441078.1_4 Reverse -125 -134 0.491382 0.188
NP_441078.1_4 Forward -134 -125 0.29472 0.205
NP_441078.1_4 Forward -88 -79 -1.27858 0.246
NP_441078.1_4 Reverse -79 -88 -2.06522 0.295
NP_442729.1_5 Forward -181 -171 11.3864 0.235
NP_442729.1_8 Reverse -173 -186 8.08242 0.125
NP_440526.1_3 Reverse -178 -189 0.943182 0.267
NP_440526.1_3 Reverse -219 -230 0.844851 0.267
NP_441432.1_8 Forward -187 -178 16.8143 0.00595
NP_441432.1_8 Forward -89 -80 12.7828 0.0354
NP_441432.1_8 Reverse -176 -185 8.25953 0.0755
NP_441432.1_8 Reverse -124 -133 4.62128 0.201
NP_441432.1_8 Forward -228 -219 3.44131 0.245
NP_442320.1_8 Reverse -171 -185 4.91614 0.0442
NP_442320.1_8 Forward -192 -178 -4.4253 0.168
NP_441732.1_2 Reverse -173 -189 11.7599 0.00594
NP_441732.1_2 Forward -190 -174 -16.0677 0.164
NP_442003.1_9 Forward -185 -166 5.211 0.24
NP_440760.1_1 Reverse -177 -196 -13.1769 0.0989
NP_440760.1_1 Forward -88 -69 -22.5183 0.261
NP_442797.1_7 Reverse -170 -188 1.39578 0.259
NP_442353.1_4 Reverse -171 -190 -0.886293 0.293
NP_440913.1_1 Forward -188 -170 11.1305 0.168
NP_441072.1_2 Forward -384 -365 12.4875 0.173
NP_440713.1_4 Forward -184 -165 3.83436 0.237
NP_440713.1_4 Forward -196 -177 1.76941 0.279
NP_440713.1_4 Forward -120 -101 0.982764 0.298
NP_442489.1_2 Reverse -114 -133 7.57094 0.172
NP_442489.1_2 Reverse -102 -121 1.17943 0.293
NP_442489.1_7 Forward -186 -177 20.1576 0.000695
NP_442489.1_7 Reverse -177 -186 20.1576 0.000695
NP_442489.1_7 Forward -134 -125 0.983037 0.121
NP_442489.1_7 Reverse -125 -134 0.983037 0.121
NP_441452.1_1 Reverse -166 -185 12.7825 0.292
NP_442079.1_7 Forward -185 -166 9.14423 0.113
NP_442079.1_7 Forward -81 -62 5.211 0.178
NP_440559.1_1 Reverse -178 -187 17.4043 0.00658
NP_440559.1_1 Forward -185 -176 8.75118 0.0586
NP_441659.2_8 Reverse -177 -187 18.1713 0.00133
NP_441659.2_8 Forward -186 -176 11.9764 0.0147
NP_441659.2_8 Forward -134 -124 5.48657 0.106
NP_441659.2_8 Reverse -101 -111 -0.118297 0.287
NP_442913.1_10 Forward -195 -176 -1.18052 0.167
NP_441040.1_2 Forward -143 -124 -6.49039 0.182
NP_441040.1_2 Forward -188 -169 -15.6352 0.286
NP_442849.1_1 Reverse -123 -137 8.16106 0.282
NP_439956.1_7 Forward -239 -220 7.86593 0.257
NP_439956.1_7 Forward -192 -173 1.57275 0.287
NP_442008.1_2 Reverse -174 -193 8.16093 0.2
NP_442776.1_8 Forward -141 -122 16.6165 0.18
NP_440779.1_5 Reverse -218 -235 -15.0058 0.3
NP_442346.1_5 Forward -187 -177 16.6963 0.00248
NP_442346.1_5 Reverse -176 -186 9.02648 0.118
NP_442346.1_5 Forward -228 -218 4.69992 0.276
NP_440352.1_5 Forward -254 -235 9.83295 0.289
NP_440545.1_3 Forward -190 -173 12.9202 0.0193
NP_440545.1_3 Reverse -173 -190 -0.452814 0.154
NP_441856.1_3 Forward -189 -170 -3.14714 0.278
NP_440025.1_3 Reverse -91 -105 9.93309 0.29
NP_441710.1_9 Forward -141 -122 10.0284 0.269
NP_440459.1_2 Forward -182 -165 7.70866 0.283
NP_440459.1_2 Reverse -123 -140 7.31533 0.296
NP_441653.1_2 Forward -197 -178 10.5839 0.129
NP_440010.1_4 Forward -196 -177 3.04693 0.221
NP_440010.1_4 Forward -190 -171 -3.34455 0.297
NP_440010.1_10 Reverse -165 -184 9.83255 0.209
NP_441943.1_8 Forward -182 -163 -13.3736 0.265
NP_442603.1_7 Reverse -177 -191 18.2885 0.016
NP_442603.1_7 Forward -186 -172 11.602 0.114
NP_442603.1_7 Forward -253 -239 8.84875 0.162
NP_442828.1_7 Reverse -123 -142 -5.99873 0.288
NP_441888.1_7 Forward -191 -177 13.5693 0.0743
NP_441888.1_7 Reverse -172 -186 3.8345 0.225
NP_441948.1_4 Reverse -170 -188 4.73903 0.0894
NP_441502.1_3 Forward -188 -169 4.62101 0.299
NP_441833.1_4 Forward -185 -178 15.9687 0.0124
NP_441833.1_4 Reverse -178 -185 15.9687 0.0124
NP_441112.1_6 Reverse -167 -186 -1.08219 0.295
NP_442162.1_9 Forward -185 -178 16.2637 0.0124
NP_442162.1_9 Reverse -178 -185 16.2637 0.0124
NP_442162.1_9 Reverse -126 -133 3.4807 0.246
NP_442162.1_9 Forward -133 -126 3.38237 0.276
NP_440788.1_8 Forward -259 -240 7.7676 0.286
NP_440671.1_4 Reverse -171 -185 12.4876 0.107
NP_440671.1_5 Reverse -165 -179 14.9452 0.236
NP_440224.1_1 Reverse -166 -185 0.58944 0.133
NP_442140.1_3 Reverse -178 -188 10.3048 0.0902
NP_442140.1_3 Forward -185 -175 8.33817 0.119
NP_440875.1_9 Forward -184 -174 9.05339 0.233
NP_441813.1_5 Forward -188 -178 18.1713 0.00743
NP_441813.1_5 Reverse -175 -185 17.188 0.00979
NP_441813.1_5 Forward -136 -126 6.76487 0.0792
NP_440590.1_4 Reverse -178 -191 14.2773 0.011
NP_440590.1_4 Forward -185 -172 4.8375 0.0585
NP_440590.1_4 Reverse -126 -139 -6.07724 0.299
NP_440567.1_1 Forward -185 -171 14.2576 0.0187
NP_442497.1_10 Forward -185 -176 10.4228 0.0087
NP_442497.1_10 Reverse -178 -187 10.4228 0.0087
NP_440821.1_4 Reverse -175 -185 19.0562 0.00399
NP_440821.1_4 Forward -188 -178 9.41981 0.0286
NP_440227.1_6 Reverse -23 -37 17.2957 0.212
NP_441239.1_9 Reverse -175 -187 13.3137 0.037
NP_441239.1_9 Forward -188 -176 7.80712 0.148
NP_441239.1_9 Forward -382 -370 6.33216 0.193
NP_441239.1_9 Reverse -216 -228 3.97222 0.269
NP_441239.1_9 Forward -136 -124 3.87389 0.272
NP_441951.1_4 Forward -186 -167 1.17943 0.287
NP_441892.1_1 Reverse -209 -226 5.74204 0.0999
NP_441892.1_1 Reverse -168 -185 3.87375 0.119
NP_440665.1_1 Reverse -165 -184 -12.0953 0.244
NP_440604.1_6 Forward -186 -167 3.14605 0.133
NP_440796.1_3 Reverse -170 -188 7.29487 0.29
NP_442193.1_8 Reverse -174 -193 13.7649 0.211
NP_441541.1_1 Reverse -25 -43 -4.58163 0.279
NP_440833.1_6 Reverse -289 -303 16.3219 0.134
NP_442138.1_10 Forward -186 -167 -3.54046 0.242
NP_440546.1_4 Forward -186 -176 11.8882 0.0679
NP_440546.1_4 Reverse -177 -187 10.046 0.109
NP_442349.1_6 Reverse -159 -178 6.4893 0.214
NP_440675.1_1 Forward -189 -170 5.89931 0.208
NP_440462.1_6 Reverse -175 -185 15.418 0.0142
NP_440462.1_6 Forward -188 -178 9.61647 0.0429
NP_440462.1_6 Forward -136 -126 4.79825 0.183
NP_442611.1_1 Forward -186 -167 -1.08219 0.274
NP_440868.1_4 Forward -190 -178 10.5604 0.0364
NP_440868.1_4 Reverse -173 -185 8.6921 0.0582
NP_440868.1_4 Forward -138 -126 0.727295 0.201
NP_441474.1_1 Reverse -167 -186 -2.06626 0.27
NP_442402.1_4 Forward -322 -303 -0.787962 0.189
NP_442402.1_4 Reverse -181 -200 -1.57461 0.194
NP_442402.1_6 Reverse -313 -322 14.8477 0.241
NP_442402.1_10 Reverse -165 -175 12.9592 0.204
NP_441084.1_6 Reverse -216 -230 14.7737 0.0972
NP_440696.1_3 Forward -227 -209 -1.06249 0.251
NP_440696.1_3 Forward -190 -172 -2.63579 0.278
NP_442039.1_4 Forward -185 -178 15.1821 0.0124
NP_442039.1_4 Reverse -178 -185 15.1821 0.0124
NP_442837.1_3 Forward -185 -178 15.7721 0.0124
NP_442837.1_3 Reverse -178 -185 15.7721 0.0124
NP_440160.1_1 Forward -354 -335 10.4377 0.244
NP_442053.1_1 Forward -186 -177 18.3876 0.0007
NP_442053.1_1 Reverse -177 -186 18.3876 0.0007
NP_442053.1_1 Forward -134 -125 13.2744 0.0188
NP_440505.1_3 Forward -188 -178 18.3679 0.00213
NP_440505.1_3 Reverse -175 -185 13.8447 0.0247
NP_441102.1_1 Forward -185 -166 4.52268 0.267
NP_441203.1_1 Forward -185 -166 -19.6667 0.297
NP_441408.2_7 Reverse -216 -235 -0.39387 0.234
NP_440914.1_1 Reverse -177 -187 17.5935 0.000537
NP_440914.1_1 Forward -186 -176 8.6151 0.186
NP_440914.1_1 Forward -373 -363 8.41992 0.191
NP_440914.1_1 Forward -134 -124 6.07773 0.297
NP_441011.1_8 Forward -185 -176 16.9127 0.00602
NP_441011.1_8 Reverse -126 -135 9.83282 0.117
NP_441011.1_8 Reverse -178 -187 8.25953 0.144
NP_442101.1_10 Reverse -169 -188 -6.78538 0.201
NP_442533.1_1 Forward -189 -170 3.83436 0.0838
NP_442533.1_1 Forward -119 -100 -13.0786 0.236
NP_442533.1_6 Forward -186 -177 17.2076 0.00137
NP_442533.1_6 Reverse -177 -186 17.2076 0.00137
NP_442533.1_6 Forward -227 -218 5.11294 0.155
NP_442533.1_6 Forward -134 -125 4.91628 0.165
NP_442533.1_6 Reverse -371 -380 2.94966 0.232
NP_442541.1_10 Reverse -218 -232 2.65393 0.254
NP_443016.1_1 Reverse -358 -377 -4.81876 0.237
NP_441219.1_6 Reverse -124 -142 10.1472 0.255
NP_441482.1_7 Forward -192 -178 7.07942 0.0257
NP_441482.1_7 Reverse -171 -185 0.589577 0.0554
NP_441482.1_7 Reverse -218 -232 -11.8985 0.286
NP_441482.1_7 Forward -140 -126 -12.0951 0.29
NP_439944.1_9 Reverse -178 -188 10.5014 0.0887
NP_439944.1_9 Forward -185 -175 10.3048 0.0887
NP_441028.1_6 Reverse -166 -176 6.27276 0.23
NP_440116.1_8 Reverse -178 -197 -2.16383 0.126
NP_440115.1_6 Forward -189 -179 15.0247 0.0505
NP_440007.1_9 Forward -377 -363 6.29277 0.229
NP_440007.1_9 Reverse -173 -187 3.73617 0.267
NP_441602.1_3 Forward -191 -172 6.88262 0.127
NP_441972.1_5 Reverse -178 -197 -6.78538 0.235
NP_441106.1_1 Reverse -176 -185 18.191 0.0028
NP_441106.1_1 Forward -187 -178 9.63616 0.0311
NP_441869.1_2 Forward -141 -122 11.3075 0.239
NP_439903.1_6 Reverse -174 -193 1.57197 0.243
NP_442588.1_1 Forward -230 -211 17.2074 0.131
NP_441286.1_1 Forward -187 -175 14.4936 0.00418
NP_441286.1_1 Reverse -176 -188 3.38223 0.0467
NP_442674.1_3 Reverse -169 -188 5.01354 0.278
NP_440670.1_8 Forward -186 -177 18.3876 0.000699
NP_440670.1_8 Reverse -177 -186 18.3876 0.000699
NP_440670.1_8 Reverse -125 -134 8.65285 0.0627
NP_440670.1_8 Forward -134 -125 6.29291 0.124
NP_441705.1_3 Reverse -302 -321 -5.01543 0.291
NP_441930.1_1 Forward -177 -158 5.01433 0.299
NP_440886.1_7 Reverse -176 -186 17.7774 0.0011
NP_440886.1_7 Forward -187 -177 7.94438 0.0805
NP_440886.1_7 Forward -135 -125 6.96107 0.112
NP_440886.1_7 Reverse -170 -180 4.20782 0.249
NP_440268.1_8 Forward -162 -143 12.8808 0.247
NP_442614.1_2 Reverse -125 -139 9.2427 0.242
NP_442072.1_9 Forward -187 -169 -22.7936 0.259
NP_442072.1_9 Reverse -176 -194 -23.482 0.297
NP_440907.2_8 Forward -185 -175 7.84605 0.117
NP_441021.1_1 Reverse -178 -197 -8.94866 0.204
NP_441463.1_3 Forward -196 -177 -7.17871 0.255
NP_441463.1_3 Reverse -167 -186 -10.1286 0.289
NP_441463.1_6 Forward -188 -174 5.54623 0.287
NP_441626.1_2 Forward -185 -178 15.7721 0.0124
NP_441626.1_2 Reverse -178 -185 15.7721 0.0124
NP_441626.1_2 Reverse -80 -87 5.05399 0.238
NP_442365.1_7 Reverse -173 -192 6.68596 0.108
NP_442365.1_7 Reverse -75 -94 1.86774 0.168
NP_442365.1_7 Forward -190 -171 -0.295539 0.177
NP_442794.1_1 Forward -190 -178 10.4621 0.0721
NP_442794.1_1 Reverse -173 -185 10.1671 0.0721
NP_442794.1_1 Forward -86 -74 5.54551 0.216
NP_442794.1_1 Forward -126 -114 3.87389 0.283
NP_441401.1_4 Reverse -40 -53 13.4906 0.273
NP_442615.1_1 Reverse -116 -134 -4.8974 0.197
NP_441962.1_4 Forward -191 -172 -9.34199 0.215
NP_440387.1_1 Forward -186 -170 5.6634 0.0311
NP_440387.1_1 Reverse -177 -193 5.36841 0.0325
NP_441431.1_2 Reverse -215 -229 9.24208 0.19
NP_441431.1_2 Forward -137 -123 7.66879 0.237
NP_441836.1_2 Forward -94 -75 -0.39387 0.212
NP_441993.1_1 Forward -233 -214 5.45515 0.201
NP_441993.1_1 Forward -186 -167 3.70092 0.23
NP_441993.1_1 Forward -88 -69 0.874656 0.29
NP_440082.1_5 Forward -41 -22 15.0377 0.269
NP_442090.1_2 Reverse -10 -29 8.16414 0.281
NP_442090.1_10 Forward -179 -166 10.8357 0.281
NP_442323.1_7 Forward -191 -172 5.70185 0.202
NP_441510.2_7 Reverse -171 -185 10.1271 0.281
NP_440293.1_3 Forward -229 -210 -3.83545 0.254
NP_440293.1_10 Reverse -123 -142 0.392778 0.219
NP_440766.1_4 Forward -190 -176 8.75105 0.0871
NP_440766.1_4 Reverse -173 -187 8.25939 0.0871
NP_439988.1_3 Reverse -360 -374 9.43936 0.249
NP_441979.1_5 Reverse -171 -190 -11.0136 0.228
NP_442743.1_4 Forward -185 -166 -7.27704 0.279
NP_440643.1_6 Reverse -68 -87 9.73422 0.123
NP_440457.1_1 Reverse -173 -185 8.29878 0.101
NP_440457.1_1 Forward -190 -178 8.20045 0.101
NP_442940.1_2 Reverse -162 -181 8.25926 0.167
NP_440798.1_6 Forward -185 -172 3.85419 0.147
NP_441801.1_4 Forward -323 -313 2.53664 0.292
NP_440801.1_9 Forward -85 -71 12.0596 0.294
NP_441984.1_3 Reverse -214 -232 7.59063 0.245
NP_441436.1_8 Forward -187 -168 7.7676 0.293
NP_442509.1_9 Forward -186 -176 16.2041 0.00739
NP_442509.1_9 Reverse -125 -135 13.0576 0.0661
NP_442509.1_9 Reverse -177 -187 8.14104 0.192
NP_440185.1_9 Forward -181 -164 14.8868 0.264
NP_440554.1_4 Forward -185 -175 14.6313 0.02
NP_440554.1_4 Reverse -178 -188 8.92815 0.0646
NP_442737.1_5 Forward -187 -168 12.3942 0.262
NP_441885.1_5 Reverse -177 -187 20.9245 0.000538
NP_441885.1_5 Forward -186 -176 11.4848 0.00668
NP_441885.1_5 Forward -88 -78 8.82982 0.0308
NP_441885.1_5 Forward -134 -124 1.55333 0.109
NP_441885.1_5 Reverse -125 -135 -0.216628 0.189
NP_440478.1_10 Reverse -175 -189 11.701 0.181
NP_441614.1_8 Reverse -206 -225 20.4523 0.289
NP_442341.1_7 Forward -187 -173 17.7975 0.0111
NP_442341.1_7 Reverse -176 -190 10.816 0.0596
NP_442341.1_7 Forward -135 -121 4.81781 0.177
NP_442341.1_9 Forward -136 -122 5.21053 0.277
NP_442341.1_9 Reverse -175 -189 4.62054 0.296
NP_441756.1_5 Reverse -173 -192 -4.72043 0.295
NP_441756.1_5 Reverse -75 -94 -5.01543 0.298
NP_441756.1_5 Forward -138 -119 -5.11376 0.298
NP_441173.1_9 Reverse -167 -175 10.1471 0.261
NP_443000.1_7 Forward -188 -178 19.9412 0.00223
NP_443000.1_7 Reverse -175 -185 8.73149 0.0437
NP_443000.1_7 Forward -90 -80 7.94484 0.0589
NP_440507.2_3 Forward -195 -176 6.98015 0.293
NP_441842.1_10 Reverse -170 -184 8.65272 0.213
NP_440275.1_3 Forward -188 -178 15.123 0.0182
NP_440275.1_3 Reverse -175 -185 8.4365 0.0602
NP_440091.1_1 Reverse -173 -185 1.41561 0.197
NP_441307.1_4 Forward -166 -147 4.12936 0.214
NP_440679.1_10 Forward -120 -101 -14.6519 0.242
NP_443010.1_10 Reverse -174 -191 2.28762 0.277
NP_439962.1_4 Reverse -147 -166 -5.70374 0.28
NP_439962.1_4 Reverse -169 -188 -6.88371 0.285
NP_440175.1_4 Forward -382 -363 -11.2103 0.185
NP_440149.1_8 Forward -186 -167 9.83255 0.0515
NP_440149.1_8 Reverse -177 -196 3.24438 0.0975
NP_441804.1_8 Forward -290 -271 19.8623 0.22
NP_441105.1_3 Forward -197 -178 0.58944 0.124
NP_441105.1_3 Forward -121 -102 -4.91709 0.209
NP_441105.1_3 Reverse -166 -185 -9.24366 0.286
NP_441105.1_3 Forward -238 -219 -9.83364 0.297
NP_442373.1_6 Forward -182 -163 14.6508 0.206
NP_440216.1_1 Forward -186 -172 7.57108 0.00935
NP_440216.1_1 Reverse -177 -191 0.392915 0.0284
NP_440216.1_1 Reverse -125 -139 -1.77037 0.0383
NP_440216.1_1 Reverse -79 -93 -11.8001 0.219
NP_440172.1_1 Reverse -177 -187 15.0247 0.00945
NP_440172.1_1 Forward -186 -176 8.73149 0.0586
NP_440172.1_1 Forward -134 -124 2.53664 0.277
NP_442788.1_7 Reverse -126 -145 11.2092 0.27
NP_442015.1_10 Forward -190 -177 21.5538 0.00329
NP_442015.1_10 Reverse -173 -186 19.1938 0.00444
NP_442015.1_10 Reverse -75 -88 2.08423 0.202
NP_442015.1_10 Forward -138 -125 -0.472371 0.268
NP_441226.1_7 Forward -185 -178 14.4934 0.0123
NP_441226.1_7 Reverse -178 -185 14.4934 0.0123
NP_441226.1_7 Reverse -126 -133 9.77352 0.131
NP_441757.1_2 Reverse -162 -180 9.75391 0.276
NP_441111.1_7 Forward -185 -177 18.7023 0.00294
NP_441111.1_7 Reverse -178 -186 18.7023 0.00294
NP_441111.1_7 Reverse -126 -134 -0.472234 0.131
NP_441111.1_7 Reverse -80 -88 -0.472234 0.131
NP_441111.1_7 Forward -133 -125 -0.668896 0.274
NP_441766.1_2 Forward -186 -177 17.5026 0.00297
NP_441766.1_2 Reverse -177 -186 17.5026 0.00297
NP_441766.1_2 Forward -134 -125 4.52295 0.179
NP_442417.1_5 Forward -186 -172 19.4691 0.0165
NP_440416.1_9 Reverse -170 -189 14.7491 0.0133
NP_440416.1_9 Forward -193 -174 -9.14533 0.127
NP_440416.1_9 Reverse -118 -137 -10.4236 0.141
NP_440416.1_9 Forward -95 -76 -17.8968 0.248
NP_443052.1_8 Reverse -167 -186 -8.94866 0.182
NP_443052.1_9 Reverse -170 -189 -3.73712 0.251
NP_442403.1_9 Forward -189 -170 5.50599 0.211
NP_440591.1_9 Forward -187 -169 8.86894 0.173
NP_442154.1_1 Reverse -318 -336 -18.9587 0.288
NP_440261.1_5 Forward -185 -172 -1.06236 0.0655
NP_440261.1_5 Reverse -126 -139 -2.93064 0.0983
NP_440261.1_5 Reverse -178 -191 -4.20895 0.142
NP_440988.1_10 Reverse -175 -189 7.31914 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTCCGTTTGAGACTTTAGATGTGCTGGCCGATGCGGAAATTCGTCAGGGTATTAAGGAATATTCCAATTGGCCCACCATTCCCCAGGTTTACGTCAATGGTGAATTTGTCGGTGGTTCTGACATCATGATTGAGCTCTATCAAAATGGTGAGCTGCAGGAAATGTTAGAAGTGGCCTTGGCTTCCTAGGGCTTCACATTCGGTGCATAACGCTGGCGATCGCCGTGGGGGGAAGCTCTCATCTGTGGAGGGCTTCTTTCACTCCCGCCGTTCGCCAATAAGATGGCGGAGACGGTGGGATATAATCGGACAGGCTTTCGCTAGGGCGTTGTTTGCACCTCAGCGACTTTGCTGCTTGTTTAACTCTAATTATTGTTTAACTACTTAGAAATCAATTCCC

CDS

ATGGCACAAGGTAAAGGTTTCGGATTCGGCCTCGGTAAAATTAAGGAATTACAGGAAGCTTTCCAAAAAGCCCAACAGGTTCAAGAAGGGGCCAAAGTGCTCCAGGAAGAACTGGAAAGAATGGAAATTCCTGGCAAAAGTGCCGATGGATTGGTGACAGTGTTGATGAGTGGCAACCAAGAACCCCTCAGTATTGAAATTGATCCCAGTGCCCTTGAAAAAGGAGCAGAAGGACTATCGGCATCCGTCACCGAAGCGATGAAAGCGGCCTATGCTGAGTCCACGGAAACCATGCGCTCTAAAATGGAAGAGTTAACCAGCGGTTTGAATTTACCCGGTATGTAG

Protein

MAQGKGFGFGLGKIKELQEAFQKAQQVQEGAKVLQEELERMEIPGKSADGLVTVLMSGNQEPLSIEIDPSALEKGAEGLSASVTEAMKAAYAESTETMRSKMEELTSGLNLPGM