Your browser is old and dusty. Try Google Chrome!

Details for slr1828

ORF slr1828
Accession NP_440748.1
Symbol petF, fdx
Category Soluble electron carriers
Definition ferredoxin, petF-like protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -149 -163 15.4376 0.104
NP_440557.1_1 Reverse -325 -344 -2.55715 0.292
NP_440795.1_7 Forward -157 -150 14.6904 0.0123
NP_440795.1_7 Reverse -150 -157 14.6904 0.0123
NP_441418.1_6 Reverse -149 -168 -28.1232 0.203
NP_441418.1_6 Forward -170 -151 -30.6798 0.291
NP_442657.1_1 Forward -28 -11 11.3202 0.245
NP_440897.1_6 Reverse -149 -168 10.4217 0.0705
NP_440897.1_6 Forward -158 -139 -0.197979 0.182
NP_441453.1_4 Reverse -149 -157 16.539 0.00633
NP_441453.1_4 Forward -158 -150 16.539 0.00633
NP_442151.1_6 Forward -158 -144 18.7808 0.00618
NP_442151.1_6 Reverse -149 -163 10.4227 0.123
NP_440120.1_4 Forward -399 -385 14.8476 0.273
NP_442623.1_3 Reverse -150 -169 -10.0303 0.167
NP_440996.1_2 Forward -146 -137 15.241 0.248
NP_442655.1_1 Reverse -144 -163 5.89931 0.157
NP_442655.1_10 Forward -161 -142 -19.0768 0.282
NP_442173.1_1 Forward -157 -149 15.4574 0.00633
NP_442173.1_1 Reverse -150 -158 15.4574 0.00633
NP_442173.1_5 Reverse -352 -362 14.6687 0.287
NP_442752.1_4 Forward -158 -151 13.8055 0.0199
NP_442752.1_4 Reverse -149 -156 13.8055 0.0199
NP_443027.1_4 Forward -160 -150 13.2547 0.0521
NP_442975.1_10 Reverse -103 -117 6.39049 0.178
NP_442975.1_10 Forward -162 -148 4.22722 0.245
NP_442975.1_10 Forward -114 -100 3.93223 0.249
NP_442975.1_10 Reverse -145 -159 2.65393 0.269
NP_440784.1_7 Forward -157 -150 15.9687 0.0123
NP_440784.1_7 Reverse -150 -157 15.9687 0.0123
NP_440061.1_9 Reverse -147 -161 11.5037 0.109
NP_440061.1_9 Forward -160 -146 10.5204 0.124
NP_440110.1_4 Forward -169 -150 7.37428 0.142
NP_442074.1_3 Reverse -187 -200 19.3898 0.178
NP_439979.1_2 Reverse -104 -123 5.89931 0.292
NP_440878.1_4 Reverse -54 -72 10.1472 0.29
NP_440878.1_9 Reverse -139 -158 1.37609 0.18
NP_442062.1_8 Forward -158 -148 17.3846 0.00193
NP_442062.1_8 Reverse -149 -159 10.3048 0.0493
NP_440761.1_4 Reverse -144 -163 -13.7669 0.257
NP_440304.1_4 Forward -160 -150 10.8948 0.051
NP_440304.1_4 Reverse -147 -157 1.84832 0.299
NP_442242.1_4 Forward -157 -150 14.3954 0.0124
NP_442242.1_4 Reverse -150 -157 14.3954 0.0124
NP_440044.1_8 Reverse -150 -169 -3.54046 0.286
NP_441781.1_7 Reverse -70 -89 -2.45882 0.289
NP_440908.1_5 Reverse -49 -66 9.87194 0.254
NP_441035.1_4 Reverse -114 -133 19.8623 0.174
NP_440011.1_1 Reverse -147 -166 14.7491 0.193
NP_441208.1_9 Reverse -146 -160 16.5192 0.0647
NP_442110.1_7 Reverse -149 -163 12.3893 0.0586
NP_442110.1_7 Forward -158 -144 1.76955 0.222
NP_441082.1_2 Reverse -85 -103 12.0155 0.181
NP_440769.1_3 Forward -78 -59 10.1267 0.283
NP_440856.1_4 Forward -165 -146 9.14423 0.0576
NP_440856.1_7 Reverse -104 -123 -2.95047 0.193
NP_440856.1_7 Reverse -95 -114 -8.65367 0.274
NP_441083.1_5 Forward -158 -148 20.3345 0.00053
NP_441083.1_5 Reverse -149 -159 11.2881 0.0159
NP_441738.1_2 Forward -156 -149 15.28 0.0102
NP_441738.1_2 Reverse -151 -158 15.28 0.0102
NP_441738.1_2 Forward -345 -338 8.29857 0.176
NP_441558.1_5 Forward -160 -141 3.73603 0.299
NP_440209.1_1 Reverse -149 -157 18.1123 0.00295
NP_440209.1_1 Forward -158 -150 18.1123 0.00295
NP_442889.1_8 Forward -258 -244 13.7653 0.0588
NP_442889.1_8 Forward -161 -147 11.307 0.0733
NP_442889.1_8 Forward -75 -61 4.8172 0.25
NP_440447.1_1 Forward -163 -145 3.95239 0.242
NP_440447.1_6 Reverse -141 -159 4.6407 0.163
NP_440056.1_9 Reverse -144 -163 12.8967 0.295
NP_441713.1_1 Reverse -143 -162 1.96607 0.0651
NP_441713.1_3 Reverse -104 -123 4.916 0.253
NP_442570.1_3 Forward -195 -176 10.5209 0.108
NP_441792.1_1 Forward -165 -146 9.24257 0.157
NP_441716.1_1 Forward -158 -144 13.1759 0.0689
NP_441327.1_1 Reverse -340 -359 12.671 0.184
NP_441327.1_1 Forward -361 -342 6.61611 0.25
NP_441327.1_5 Forward -148 -139 15.0444 0.191
NP_442111.1_4 Reverse -148 -162 22.6157 0.000842
NP_442111.1_4 Forward -159 -145 9.34103 0.0609
NP_441163.1_1 Forward -47 -30 4.85634 0.284
NP_440906.1_5 Forward -157 -150 15.8704 0.0124
NP_440906.1_5 Reverse -150 -157 15.8704 0.0124
NP_440747.1_10 Reverse -146 -158 24.7201 0.00036
NP_440747.1_10 Forward -161 -149 17.1486 0.000663
NP_441130.1_7 Forward -171 -157 15.5352 0.287
NP_441486.1_1 Reverse -146 -160 -2.45868 0.175
NP_441486.1_1 Forward -161 -147 -2.55701 0.175
NP_442634.1_4 Forward -160 -146 7.86607 0.0479
NP_442634.1_4 Reverse -147 -161 -1.27871 0.149
NP_441265.1_3 Reverse -143 -157 3.04785 0.181
NP_441265.1_3 Forward -164 -150 2.94952 0.181
NP_440057.1_6 Reverse -57 -76 10.3122 0.29
NP_441014.1_5 Reverse -144 -162 9.55725 0.275
NP_441012.1_4 Reverse -115 -128 6.4108 0.279
NP_443018.1_3 Forward -157 -150 14.8871 0.0123
NP_443018.1_3 Reverse -150 -157 14.8871 0.0123
NP_440376.1_1 Forward -158 -149 19.4693 0.000692
NP_440376.1_1 Reverse -149 -158 19.4693 0.000692
NP_441857.1_5 Reverse -142 -160 1.39578 0.297
NP_441588.1_4 Forward -156 -146 9.02648 0.14
NP_442687.1_7 Forward -159 -149 9.02648 0.0994
NP_442687.1_7 Reverse -148 -158 8.92815 0.0994
NP_442191.1_4 Reverse -150 -164 18.2649 0.00956
NP_442946.1_2 Forward -384 -365 17.0107 0.116
NP_441013.1_2 Forward -163 -145 -4.30741 0.298
NP_441013.1_2 Forward -127 -109 -4.40575 0.298
NP_442658.1_1 Forward -160 -150 14.2375 0.0237
NP_442658.1_1 Reverse -147 -157 6.76441 0.214
NP_442782.1_2 Reverse -149 -163 8.16106 0.198
NP_442782.1_2 Forward -116 -102 4.91614 0.25
NP_440656.1_2 Forward -291 -272 3.14605 0.221
NP_441414.1_9 Reverse -149 -168 -2.95047 0.126
NP_441414.1_9 Forward -158 -139 -6.29373 0.192
NP_442937.1_5 Forward -121 -102 6.29264 0.282
NP_441958.1_5 Forward -159 -149 21.2195 0.000805
NP_441958.1_5 Reverse -148 -158 12.2714 0.00183
NP_440203.1_5 Forward -155 -145 14.2375 0.0886
NP_440203.1_5 Reverse -309 -319 8.43603 0.299
NP_439905.1_1 Reverse -105 -118 8.47575 0.234
NP_440984.1_7 Forward -163 -149 10.0294 0.126
NP_441162.1_3 Forward -126 -107 13.6675 0.181
NP_439990.1_5 Reverse -144 -157 20.7671 0.00296
NP_439990.1_5 Forward -163 -150 10.639 0.128
NP_442376.1_2 Reverse -144 -163 -13.2752 0.292
NP_442911.1_2 Reverse -139 -158 4.52268 0.0378
NP_442911.1_2 Forward -168 -149 -0.885524 0.0793
NP_440153.1_5 Reverse -150 -164 5.30946 0.191
NP_442064.1_1 Reverse -144 -163 -4.03212 0.178
NP_443055.1_6 Reverse -135 -153 0.411736 0.243
NP_440993.1_2 Forward -163 -147 3.69678 0.256
NP_440993.1_3 Forward -168 -149 15.5349 0.0527
NP_440993.1_3 Reverse -139 -158 6.48849 0.148
NP_440602.1_2 Reverse -144 -163 3.6377 0.263
NP_442210.1_5 Forward -269 -250 11.2092 0.22
NP_441099.1_5 Reverse -139 -158 -8.45701 0.194
NP_442438.1_10 Forward -163 -149 1.76955 0.188
NP_442438.1_10 Reverse -144 -158 0.786239 0.213
NP_442566.1_2 Reverse -111 -130 0.786102 0.289
NP_440484.1_3 Forward -160 -146 10.7177 0.242
NP_440147.1_4 Reverse -147 -160 18.4072 0.00407
NP_440147.1_4 Forward -160 -147 10.344 0.0355
NP_441550.1_8 Forward -160 -150 15.8108 0.0132
NP_441550.1_8 Reverse -147 -157 14.6309 0.0132
NP_441916.1_7 Reverse -149 -159 18.9579 0.00144
NP_441916.1_7 Forward -158 -148 10.3048 0.0261
NP_441041.1_4 Reverse -149 -168 -5.50708 0.154
NP_441041.1_4 Forward -158 -139 -11.8986 0.254
NP_441041.1_7 Forward -161 -149 13.3454 0.0485
NP_441041.1_7 Reverse -146 -158 8.58373 0.133
NP_442004.1_6 Forward -158 -144 5.80112 0.181
NP_441725.1_4 Forward -163 -149 13.7653 0.0693
NP_441725.1_5 Forward -157 -147 2.04498 0.115
NP_441725.1_5 Reverse -150 -160 1.94665 0.115
NP_441725.1_5 Reverse -307 -317 -0.216628 0.241
NP_439966.1_7 Forward -160 -150 14.3359 0.0203
NP_439966.1_7 Reverse -147 -157 7.25606 0.15
NP_442941.1_3 Reverse -150 -160 19.2529 0.00262
NP_442941.1_3 Forward -157 -147 11.0914 0.0116
NP_440289.1_2 Forward -161 -148 3.16588 0.0811
NP_440983.1_5 Reverse -107 -126 -5.99873 0.274
NP_441514.1_6 Forward -317 -310 12.8221 0.252
NP_442281.1_1 Forward -163 -149 16.5185 0.00772
NP_442281.1_1 Reverse -144 -158 9.53707 0.0685
NP_441334.1_7 Forward -175 -156 -14.7502 0.275
NP_441334.1_7 Reverse -147 -166 -19.9617 0.275
NP_441079.1_1 Forward -114 -95 16.0274 0.211
NP_441079.1_7 Forward -39 -20 4.52188 0.152
NP_442256.1_2 Reverse -147 -165 -0.374176 0.14
NP_440437.1_1 Forward -164 -145 -2.75381 0.224
NP_442012.1_1 Forward -164 -145 3.6377 0.179
NP_441556.1_10 Reverse -144 -158 13.4339 0.178
NP_442982.1_5 Forward -168 -149 -1.37718 0.266
NP_441644.1_6 Reverse -149 -159 19.0557 0.000803
NP_441644.1_6 Forward -158 -148 17.3841 0.00127
NP_441644.1_6 Reverse -178 -188 6.96107 0.141
NP_442215.1_2 Reverse -147 -163 9.10498 0.0601
NP_442215.1_2 Forward -172 -156 -1.90808 0.189
NP_442215.1_2 Forward -160 -144 -2.10475 0.192
NP_442215.1_2 Forward -189 -173 -5.25134 0.248
NP_442029.1_6 Reverse -144 -163 11.9958 0.155
NP_442029.1_6 Forward -163 -144 4.03102 0.274
NP_440929.1_8 Forward -158 -149 19.2726 0.000701
NP_440929.1_8 Reverse -149 -158 19.2726 0.000701
NP_442933.1_10 Forward -158 -149 17.601 0.00325
NP_442933.1_10 Reverse -149 -158 17.601 0.00325
NP_441751.2_8 Reverse -150 -164 -2.16369 0.132
NP_441751.2_8 Forward -157 -143 -2.36035 0.132
NP_442554.1_8 Reverse -150 -160 17.2863 0.00543
NP_442554.1_8 Forward -157 -147 15.3197 0.00882
NP_442554.1_8 Forward -186 -176 2.53664 0.268
NP_441762.1_7 Forward -159 -147 0.530633 0.0747
NP_441762.1_7 Reverse -148 -160 -6.84419 0.284
NP_442142.1_4 Forward -161 -148 12.9 0.0406
NP_442142.1_4 Reverse -146 -159 12.8017 0.0409
NP_442142.1_4 Reverse -175 -188 3.16532 0.265
NP_442292.1_1 Forward -157 -148 18.486 0.00229
NP_442292.1_1 Reverse -150 -159 17.5026 0.00435
NP_442476.1_1 Reverse -18 -37 11.0289 0.276
NP_440895.1_6 Reverse -143 -156 19.8821 0.0221
NP_441523.1_6 Forward -162 -143 23.2056 0.0237
NP_443009.1_5 Reverse -148 -159 14.5128 0.02
NP_443009.1_5 Forward -159 -148 10.1862 0.0792
NP_443009.1_5 Forward -316 -305 3.5981 0.286
NP_443009.1_5 Reverse -183 -194 3.49977 0.292
NP_441726.1_7 Reverse -226 -245 5.50599 0.248
NP_441715.1_4 Reverse -150 -160 16.7946 0.0106
NP_441715.1_4 Forward -157 -147 7.94484 0.107
NP_441448.1_1 Forward -124 -105 13.1758 0.165
NP_441448.1_1 Reverse -105 -124 11.2092 0.184
NP_441448.1_1 Forward -112 -93 3.6377 0.292
NP_442076.1_3 Forward -130 -112 26.0769 0.00186
NP_441198.1_8 Forward -317 -307 11.1228 0.222
NP_440464.1_10 Forward -157 -147 13.0082 0.169
NP_441468.1_1 Forward -157 -150 15.8704 0.0124
NP_441468.1_1 Reverse -150 -157 15.8704 0.0124
NP_441020.2_6 Reverse -147 -164 10.8552 0.133
NP_441015.1_10 Reverse -144 -163 -3.73712 0.191
NP_441015.1_10 Forward -163 -144 -7.86702 0.272
NP_441673.1_1 Forward -158 -149 20.8459 0.000698
NP_441673.1_1 Reverse -149 -158 20.8459 0.000698
NP_441876.1_2 Forward -306 -287 11.3075 0.268
NP_441826.1_2 Forward -164 -150 -1.77037 0.254
NP_441826.1_2 Reverse -143 -157 -2.65535 0.273
NP_441330.1_1 Forward -163 -144 5.11266 0.0304
NP_442490.1_9 Forward -170 -151 -7.4737 0.278
NP_441764.1_8 Forward -148 -138 12.5549 0.284
NP_442868.1_6 Forward -160 -150 10.4031 0.038
NP_442868.1_6 Reverse -147 -157 9.81313 0.038
NP_442719.1_2 Forward -48 -30 -9.51964 0.266
NP_442719.1_2 Reverse -33 -51 -11.0929 0.287
NP_441251.1_7 Reverse -334 -347 11.229 0.27
NP_440785.1_2 Reverse -120 -139 8.45592 0.223
NP_441612.1_2 Forward -158 -148 8.54929 0.21
NP_442361.1_3 Forward -164 -151 10.049 0.272
NP_442808.1_1 Forward -159 -149 8.73102 0.0481
NP_442808.1_1 Reverse -148 -158 8.63269 0.0481
NP_440145.1_3 Reverse -139 -158 7.47261 0.0466
NP_442718.1_2 Forward -113 -94 -0.197208 0.212
NP_442542.1_9 Forward -120 -106 8.25877 0.166
NP_442542.1_9 Forward -180 -166 6.78381 0.223
NP_442050.1_5 Forward -160 -150 15.9091 0.0091
NP_442050.1_5 Reverse -147 -157 7.64939 0.243
NP_440558.1_2 Forward -167 -148 -0.787193 0.204
NP_440558.1_2 Reverse -175 -194 -1.86883 0.218
NP_441878.1_6 Forward -159 -149 10.5014 0.0176
NP_441878.1_6 Reverse -148 -158 10.4031 0.0176
NP_441878.1_6 Reverse -177 -187 0.766681 0.134
NP_441878.1_6 Reverse -160 -170 -7.68978 0.255
NP_441036.1_8 Forward -159 -149 15.713 0.00724
NP_441036.1_8 Reverse -148 -158 8.33817 0.174
NP_442650.1_2 Forward -158 -144 8.25939 0.13
NP_441557.1_5 Forward -158 -149 19.9609 0.000699
NP_441557.1_5 Reverse -149 -158 19.9609 0.000699
NP_441445.1_1 Forward -196 -177 0.294447 0.278
NP_441590.1_4 Forward -340 -321 5.2102 0.279
NP_442066.2_4 Reverse -149 -168 -8.45701 0.294
NP_441433.1_8 Forward -127 -108 1.67108 0.236
NP_441739.1_2 Forward -348 -332 8.21931 0.193
NP_440101.1_3 Forward -163 -144 0.884433 0.289
NP_442166.1_7 Reverse -150 -164 13.3726 0.175
NP_441819.1_5 Forward -381 -362 8.45061 0.295
NP_441574.1_1 Reverse -101 -120 -5.99873 0.272
NP_442347.1_2 Forward -157 -148 12.4878 0.056
NP_442347.1_2 Reverse -150 -159 3.34298 0.284
NP_442347.1_10 Reverse -179 -193 16.5185 0.182
NP_440547.1_1 Reverse -348 -367 9.93006 0.237
NP_441037.1_4 Reverse -147 -157 7.9999 0.237
NP_441037.1_4 Forward -160 -150 7.22024 0.237
NP_440235.1_6 Reverse -128 -138 17.4963 0.176
NP_441633.1_3 Reverse -147 -160 1.10092 0.109
NP_441633.1_3 Forward -160 -147 -3.71729 0.177
NP_440136.1_2 Forward -157 -150 15.9687 0.0123
NP_440136.1_2 Reverse -150 -157 15.9687 0.0123
NP_442590.1_10 Forward -132 -113 4.71934 0.272
NP_442998.1_5 Reverse -274 -284 12.0747 0.176
NP_442998.1_10 Forward -156 -149 15.5754 0.0102
NP_442998.1_10 Reverse -151 -158 15.5754 0.0102
NP_440299.1_1 Reverse -145 -158 22.3398 0.000547
NP_440299.1_1 Forward -162 -149 11.1301 0.0518
NP_441799.1_1 Reverse -145 -159 9.83206 0.0838
NP_441799.1_1 Forward -162 -148 7.76712 0.133
NP_442802.1_2 Forward -126 -107 14.8466 0.212
NP_442504.1_2 Reverse -13 -32 9.43923 0.126
NP_441007.1_10 Forward -163 -150 1.29759 0.203
NP_442201.1_10 Forward -169 -150 -14.9469 0.295
NP_440256.1_1 Reverse -146 -165 15.6341 0.00669
NP_440256.1_1 Forward -161 -142 -7.17871 0.231
NP_440456.1_9 Forward -49 -30 4.32602 0.232
NP_441559.1_8 Forward -163 -149 10.9143 0.0574
NP_441559.1_8 Reverse -144 -158 2.65453 0.143
NP_441559.1_8 Reverse -383 -397 -7.47356 0.294
NP_440915.1_6 Reverse -145 -159 12.7826 0.0206
NP_440915.1_6 Forward -162 -148 10.6193 0.0301
NP_442158.1_4 Reverse -140 -150 15.9097 0.129
NP_442785.1_7 Forward -160 -146 10.7177 0.228
NP_441866.1_6 Reverse -286 -305 8.25844 0.258
NP_441704.1_4 Forward -124 -105 13.1758 0.298
NP_441704.1_8 Reverse -138 -157 11.5033 0.14
NP_442452.1_8 Forward -164 -150 11.897 0.273
NP_440748.1_3 Forward -284 -265 16.8141 0.189
NP_442031.1_9 Forward -89 -70 12.9783 0.179
NP_442150.1_8 Forward -244 -225 15.6633 0.267
NP_440695.1_5 Reverse -149 -168 0.196116 0.284
NP_441939.1_3 Reverse -150 -169 19.8623 0.0103
NP_441939.1_3 Forward -192 -173 4.916 0.298
NP_441494.1_6 Forward -163 -150 6.01747 0.289
NP_440677.1_6 Forward -167 -148 8.94757 0.27
NP_442386.1_9 Reverse -148 -157 13.8639 0.0289
NP_442386.1_9 Forward -159 -150 6.39082 0.219
NP_441750.1_4 Reverse -101 -120 4.52268 0.21
NP_441340.1_5 Forward -157 -150 15.6737 0.0124
NP_441340.1_5 Reverse -150 -157 15.6737 0.0124
NP_441340.1_9 Forward -148 -138 17.7031 0.194
NP_442484.1_2 Forward -169 -150 1.27776 0.238
NP_440327.1_6 Reverse -107 -126 3.04771 0.285
NP_440251.1_6 Forward -34 -16 14.0376 0.3
NP_441254.1_1 Forward -350 -337 21.0615 0.0371
NP_442240.1_2 Reverse -150 -169 -10.0303 0.137
NP_442950.1_1 Reverse -161 -180 -4.72043 0.244
NP_440586.1_8 Forward -157 -150 13.2151 0.026
NP_440586.1_8 Reverse -150 -157 13.2151 0.026
NP_442251.1_6 Forward -157 -150 15.2804 0.0124
NP_442251.1_6 Reverse -150 -157 15.2804 0.0124
NP_442959.1_4 Reverse -172 -191 8.84924 0.216
NP_442959.1_5 Reverse -195 -214 9.53756 0.224
NP_441262.1_3 Reverse -149 -156 14.7888 0.0223
NP_441262.1_3 Forward -158 -151 14.7888 0.0223
NP_440027.1_8 Reverse -146 -165 8.55343 0.246
NP_443051.1_1 Forward -159 -150 19.5676 0.00335
NP_443051.1_1 Reverse -148 -157 10.4228 0.00754
NP_439937.1_8 Forward -118 -99 -2.0655 0.254
NP_439937.1_9 Forward -159 -142 -6.74666 0.157
NP_442294.1_3 Reverse -28 -42 16.0269 0.17
NP_440408.1_3 Reverse -101 -120 -6.09707 0.295
NP_440408.1_7 Reverse -149 -168 13.4708 0.185
NP_440439.1_1 Forward -161 -148 10.934 0.0339
NP_440439.1_1 Reverse -146 -159 0.0192843 0.203
NP_439943.1_7 Reverse -144 -163 18.879 0.045
NP_440372.1_2 Forward -157 -150 16.3621 0.0124
NP_440372.1_2 Reverse -150 -157 16.3621 0.0124
NP_441138.1_5 Forward -243 -230 3.59498 0.297
NP_441946.1_9 Reverse -216 -233 15.6528 0.241
NP_441789.1_7 Forward -341 -322 -5.01617 0.293
NP_440819.1_5 Reverse -273 -281 7.98423 0.228
NP_440316.1_10 Reverse -177 -187 7.84651 0.245
NP_442148.1_8 Reverse -152 -171 23.4022 0.0239
NP_441803.1_2 Forward -163 -144 4.52268 0.177
NP_439977.1_5 Forward -164 -145 0.58944 0.207
NP_439977.1_5 Reverse -143 -162 -0.000545616 0.217
NP_441572.1_7 Forward -164 -145 4.71934 0.0931
NP_440267.1_2 Forward -163 -149 11.5037 0.125
NP_442384.1_10 Reverse -149 -162 18.8988 0.00338
NP_442384.1_10 Forward -158 -145 17.4239 0.00585
NP_440221.1_8 Reverse -284 -303 11.7992 0.295
NP_441018.1_7 Reverse -145 -164 7.66927 0.268
NP_442262.1_10 Forward -157 -150 14.1988 0.0123
NP_442262.1_10 Reverse -150 -157 14.1988 0.0123
NP_441689.1_5 Forward -160 -150 8.3377 0.132
NP_441689.1_5 Reverse -147 -157 5.78111 0.197
NP_440344.1_10 Reverse -142 -159 1.31714 0.0311
NP_440344.1_10 Forward -165 -148 -6.64766 0.114
NP_440531.1_6 Forward -166 -147 -4.03212 0.273
NP_440531.1_6 Reverse -170 -189 -4.03212 0.273
NP_442910.1_1 Reverse -142 -161 2.45773 0.118
NP_441965.1_10 Forward -161 -145 3.79511 0.253
NP_441640.1_8 Forward -157 -138 -5.99873 0.295
NP_440297.1_9 Forward -157 -147 -0.118297 0.282
NP_440297.1_9 Forward -186 -176 -0.216628 0.282
NP_440297.1_9 Reverse -150 -160 -0.216628 0.282
NP_440100.1_3 Forward -165 -146 -0.787193 0.166
NP_440999.1_9 Forward -162 -148 10.226 0.0548
NP_440999.1_9 Reverse -145 -159 0.687908 0.177
NP_440888.1_2 Reverse -149 -163 15.9285 0.00837
NP_440888.1_2 Forward -158 -144 9.04542 0.139
NP_440888.1_2 Forward -276 -262 6.68548 0.223
NP_441771.1_8 Forward -40 -21 11.6973 0.11
NP_440600.1_4 Forward -166 -148 -0.964162 0.16
NP_440491.1_1 Reverse -161 -180 12.0823 0.157
NP_440491.1_1 Reverse -146 -165 11.0102 0.178
NP_440052.1_5 Forward -169 -150 -2.0655 0.212
NP_439969.1_3 Reverse -144 -163 -0.000545616 0.27
NP_442948.1_2 Forward -159 -140 4.71934 0.258
NP_442277.1_4 Forward -167 -148 4.81688 0.184
NP_442033.1_10 Forward -160 -141 -9.73531 0.221
NP_440575.1_1 Forward -143 -124 15.2399 0.0802
NP_440575.1_1 Forward -142 -123 -1.77127 0.29
NP_440575.1_8 Reverse -133 -152 -1.08219 0.219
NP_440575.1_8 Reverse -132 -151 -5.21209 0.27
NP_441543.1_2 Forward -157 -148 16.9127 0.00359
NP_441543.1_2 Reverse -150 -159 15.9293 0.00518
NP_442845.1_2 Reverse -143 -157 11.3077 0.131
NP_442845.1_2 Forward -193 -179 4.91614 0.249
NP_441319.1_9 Reverse -149 -168 17.6007 0.226
NP_441469.1_8 Reverse -177 -186 7.66954 0.227
NP_441469.1_8 Forward -159 -150 6.5879 0.227
NP_441469.1_8 Reverse -148 -157 6.48957 0.227
NP_443064.1_6 Forward -158 -148 12.5669 0.0796
NP_443064.1_6 Reverse -149 -159 10.8217 0.13
NP_442578.1_7 Forward -157 -150 14.5921 0.026
NP_442578.1_7 Reverse -150 -157 14.5921 0.026
NP_440710.1_1 Forward -166 -148 -8.43732 0.264
NP_441462.1_2 Reverse -149 -159 20.2362 0.000805
NP_441462.1_2 Forward -158 -148 11.5831 0.00406
NP_441462.1_5 Forward -399 -380 0.982764 0.291
NP_441621.1_7 Forward -127 -113 -3.147 0.188
NP_441621.1_7 Reverse -147 -161 -5.21195 0.248
NP_443062.1_1 Reverse -149 -167 16.054 0.0326
NP_443062.1_1 Forward -158 -140 3.67056 0.289
NP_443062.1_6 Reverse -141 -160 7.27595 0.171
NP_440349.1_3 Reverse -102 -121 9.7334 0.299
NP_442204.1_1 Forward -162 -151 21.1015 0.0035
NP_442204.1_1 Reverse -145 -156 8.7118 0.0852
NP_442537.1_3 Reverse -95 -114 12.0942 0.263
NP_440516.1_2 Reverse -143 -161 3.85406 0.143
NP_440516.1_8 Forward -158 -149 16.9127 0.00442
NP_440516.1_8 Reverse -149 -158 16.9127 0.00442
NP_442428.1_5 Forward -157 -150 15.8704 0.0124
NP_442428.1_5 Reverse -150 -157 15.8704 0.0124
NP_441443.1_1 Reverse -160 -179 -6.09707 0.3
NP_440673.1_3 Forward -156 -149 12.4288 0.0426
NP_440673.1_3 Reverse -151 -158 12.4288 0.0426
NP_440865.1_9 Forward -292 -273 -1.86883 0.179
NP_441052.1_2 Forward -158 -148 19.9412 0.00106
NP_441052.1_2 Reverse -149 -159 10.4031 0.0285
NP_441052.1_2 Forward -187 -177 2.53664 0.201
NP_441052.1_2 Reverse -178 -188 0.963343 0.255
NP_442219.1_8 Forward -59 -40 9.03681 0.234
NP_442219.1_9 Forward -157 -148 17.7976 0.00718
NP_442219.1_9 Reverse -150 -159 8.25953 0.0681
NP_440436.1_4 Forward -157 -148 17.2072 0.00233
NP_440436.1_4 Reverse -150 -159 9.24241 0.0871
NP_440436.1_4 Reverse -105 -114 5.50585 0.195
NP_441884.1_8 Reverse -148 -167 -9.63698 0.268
NP_442864.1_3 Reverse -143 -162 8.94757 0.212
NP_440648.1_1 Reverse -149 -168 14.8474 0.0772
NP_441719.1_4 Forward -157 -150 16.3621 0.0124
NP_441719.1_4 Reverse -150 -157 16.3621 0.0124
NP_441004.1_1 Reverse -107 -126 -10.817 0.226
NP_442366.1_3 Forward -159 -141 6.70565 0.0773
NP_442366.1_3 Reverse -148 -166 4.9357 0.0899
NP_442366.1_3 Forward -194 -176 2.0841 0.135
NP_442366.1_5 Reverse -146 -156 14.0409 0.0497
NP_440129.1_4 Reverse -152 -170 15.7513 0.171
NP_440129.1_10 Forward -165 -151 5.30946 0.185
NP_440296.1_6 Forward -35 -17 10.9836 0.295
NP_440296.1_10 Reverse -146 -165 -13.6686 0.269
NP_441115.1_4 Forward -159 -141 13.588 0.0741
NP_441115.1_4 Reverse -148 -166 10.2448 0.183
NP_442694.1_4 Reverse -30 -39 15.536 0.164
NP_442206.1_10 Reverse -149 -164 4.40479 0.178
NP_442206.1_10 Forward -158 -143 2.14318 0.205
NP_442854.1_4 Forward -163 -144 13.2733 0.224
NP_440328.1_4 Forward -164 -145 6.19431 0.134
NP_443054.1_2 Forward -160 -146 -0.393733 0.294
NP_442430.1_10 Forward -168 -149 9.83173 0.277
NP_441966.1_8 Reverse -143 -161 -5.68405 0.261
NP_441851.1_10 Reverse -148 -158 15.8113 0.00552
NP_441851.1_10 Forward -159 -149 8.53483 0.114
NP_442208.1_5 Reverse -147 -166 0.294447 0.248
NP_442856.1_7 Forward -167 -148 4.916 0.131
NP_441668.1_4 Reverse -30 -49 -1.57384 0.277
NP_442515.1_1 Reverse -148 -162 -4.62196 0.298
NP_440593.1_3 Forward -163 -144 -7.57203 0.297
NP_441982.1_6 Forward -43 -34 12.5809 0.274
NP_440165.1_5 Reverse -148 -167 -6.29373 0.231
NP_441349.1_10 Reverse -139 -158 9.14423 0.0248
NP_441349.1_10 Forward -168 -149 -0.983855 0.0981
NP_441349.1_10 Reverse -60 -79 -2.55715 0.121
NP_441409.1_6 Reverse -143 -162 10.2259 0.024
NP_440432.1_9 Reverse -150 -165 -2.97003 0.177
NP_442843.1_1 Forward -186 -167 -5.31042 0.244
NP_440474.1_8 Reverse -247 -261 7.27547 0.207
NP_440431.1_3 Forward -159 -140 7.17762 0.0886
NP_442450.1_5 Reverse -147 -157 7.55152 0.13
NP_440588.1_2 Reverse -140 -159 11.7008 0.0311
NP_440588.1_2 Forward -167 -148 6.88262 0.0535
NP_441031.1_8 Forward -121 -102 1.86774 0.205
NP_440943.1_1 Reverse -331 -350 20.059 0.0818
NP_442006.1_2 Reverse -155 -172 -18.1524 0.288
NP_441003.1_9 Reverse -169 -188 9.93088 0.213
NP_442243.1_1 Forward -164 -146 3.75497 0.2
NP_441570.1_1 Reverse -149 -167 -0.964162 0.0525
NP_440078.1_4 Reverse -138 -157 13.1758 0.19
NP_440078.1_10 Reverse -113 -132 2.16274 0.279
NP_441078.1_4 Forward -158 -149 19.6659 0.0007
NP_441078.1_4 Reverse -149 -158 19.6659 0.0007
NP_442388.1_3 Reverse -166 -185 7.47261 0.282
NP_441663.1_8 Forward -164 -145 12.4875 0.0718
NP_442348.1_2 Reverse -338 -347 17.011 0.055
NP_442348.1_2 Reverse -29 -38 7.37455 0.28
NP_440707.1_6 Forward -166 -147 14.6499 0.172
NP_441091.1_5 Forward -162 -143 3.93269 0.282
NP_440526.1_3 Forward -157 -146 8.02298 0.126
NP_441432.1_8 Reverse -148 -157 16.8143 0.00595
NP_441432.1_8 Forward -159 -150 16.8143 0.00595
NP_442320.1_8 Reverse -143 -157 -2.06536 0.0851
NP_441732.1_2 Forward -162 -146 3.00846 0.0141
NP_441732.1_2 Reverse -145 -161 -7.51295 0.0859
NP_441732.1_5 Reverse -190 -204 11.5043 0.21
NP_440760.1_1 Forward -158 -139 -14.9469 0.138
NP_440760.1_1 Reverse -149 -168 -21.6334 0.24
NP_442178.1_8 Forward -90 -72 14.0805 0.266
NP_440713.1_4 Forward -168 -149 4.12936 0.231
NP_442489.1_7 Forward -158 -149 20.1576 0.000695
NP_442489.1_7 Reverse -149 -158 20.1576 0.000695
NP_440559.1_1 Forward -157 -148 17.4043 0.00658
NP_440559.1_1 Reverse -150 -159 8.65285 0.0586
NP_441659.2_8 Reverse -149 -159 20.9245 0.000805
NP_441659.2_8 Forward -158 -148 18.1713 0.00133
NP_442913.1_10 Forward -167 -148 16.7157 0.0136
NP_441040.1_5 Forward -163 -144 2.94938 0.275
NP_442008.1_2 Reverse -146 -165 17.109 0.0705
NP_440708.1_6 Forward -168 -149 -6.88371 0.24
NP_442776.1_1 Forward -169 -150 4.81767 0.268
NP_442346.1_5 Reverse -148 -158 16.6963 0.00248
NP_442346.1_5 Forward -159 -149 16.303 0.00248
NP_442346.1_5 Forward -188 -178 6.46988 0.201
NP_442346.1_5 Reverse -100 -110 6.46988 0.201
NP_442346.1_5 Reverse -112 -122 4.40493 0.29
NP_442346.1_5 Reverse -177 -187 4.20827 0.296
NP_440352.1_5 Forward -156 -137 13.5318 0.186
NP_440545.1_3 Reverse -145 -162 20.885 0.00658
NP_440545.1_3 Forward -162 -145 0.432165 0.139
NP_441629.1_3 Forward -165 -146 -0.29631 0.24
NP_441923.1_6 Reverse -114 -128 8.35772 0.278
NP_440459.1_2 Forward -160 -143 7.80699 0.278
NP_440010.1_4 Reverse -97 -116 4.42355 0.22
NP_440010.1_10 Reverse -381 -400 9.3409 0.209
NP_441943.1_5 Forward -155 -136 14.6477 0.265
NP_442603.1_7 Forward -158 -144 11.307 0.117
NP_442603.1_7 Reverse -149 -163 10.5204 0.125
NP_441888.1_7 Forward -163 -149 3.8345 0.225
NP_441502.1_3 Forward -160 -141 8.45592 0.215
NP_441833.1_4 Forward -157 -150 15.9687 0.0124
NP_441833.1_4 Reverse -150 -157 15.9687 0.0124
NP_441895.1_10 Forward -400 -381 -27.7299 0.29
NP_442162.1_9 Forward -157 -150 16.2637 0.0124
NP_442162.1_9 Reverse -150 -157 16.2637 0.0124
NP_440671.1_4 Reverse -143 -157 8.84938 0.188
NP_442199.1_5 Forward -166 -147 -0.885524 0.177
NP_442140.1_3 Forward -157 -147 12.2714 0.0632
NP_442140.1_3 Reverse -150 -160 4.69992 0.238
NP_441609.1_1 Reverse -48 -67 -2.95047 0.298
NP_440875.1_9 Reverse -151 -161 16.5483 0.0145
NP_441813.1_5 Forward -160 -150 18.1713 0.00743
NP_441813.1_5 Reverse -147 -157 8.63316 0.0367
NP_442028.1_1 Forward -29 -16 10.9479 0.251
NP_440590.1_4 Forward -157 -144 12.9006 0.013
NP_440590.1_4 Reverse -150 -163 4.44418 0.0601
NP_440567.1_1 Reverse -150 -164 6.78443 0.0803
NP_440567.1_1 Forward -157 -143 6.58777 0.0816
NP_440035.1_6 Reverse -86 -105 7.7676 0.283
NP_442497.1_10 Reverse -150 -159 17.601 0.00813
NP_442497.1_10 Forward -157 -148 10.4228 0.0087
NP_440821.1_4 Reverse -147 -157 9.41981 0.0286
NP_440821.1_4 Forward -160 -150 2.24165 0.131
NP_441239.1_9 Forward -160 -148 13.0187 0.0389
NP_441239.1_9 Reverse -147 -159 3.38223 0.285
NP_441009.1_4 Reverse -149 -168 18.4857 0.131
NP_441727.1_3 Reverse -142 -161 3.93269 0.275
NP_441892.1_1 Forward -167 -150 -2.41943 0.221
NP_440604.1_6 Reverse -149 -168 15.3391 0.0305
NP_442044.1_1 Forward -163 -144 -14.1602 0.283
NP_442643.1_1 Reverse -143 -162 -11.4069 0.231
NP_441769.1_3 Forward -36 -17 -6.78612 0.282
NP_442216.1_4 Reverse -308 -316 8.37716 0.255
NP_440354.1_5 Reverse -146 -165 6.58763 0.174
NP_440546.1_4 Reverse -149 -159 13.5365 0.0459
NP_440546.1_4 Forward -158 -148 10.046 0.109
NP_440546.1_6 Forward -120 -101 11.3075 0.245
NP_439974.1_6 Reverse -57 -76 20.354 0.195
NP_442041.1_5 Forward -116 -97 3.34271 0.244
NP_441230.1_5 Forward -163 -144 3.14605 0.205
NP_440462.1_6 Forward -160 -150 18.7612 0.00454
NP_440462.1_6 Reverse -147 -157 1.35667 0.294
NP_442340.1_3 Reverse -106 -125 4.62101 0.113
NP_442340.1_3 Forward -120 -101 -9.34199 0.275
NP_442611.1_1 Reverse -149 -168 16.1257 0.0485
NP_440868.1_4 Forward -162 -150 8.00379 0.0602
NP_440868.1_4 Reverse -145 -157 6.1355 0.0878
NP_442402.1_4 Forward -166 -147 1.37531 0.173
NP_441848.1_10 Forward -140 -127 18.0129 0.122
NP_441084.1_6 Reverse -186 -200 11.1863 0.214
NP_442039.1_4 Forward -157 -150 15.1821 0.0124
NP_442039.1_4 Reverse -150 -157 15.1821 0.0124
NP_440825.1_7 Forward -157 -147 12.9096 0.152
NP_442837.1_3 Forward -157 -150 15.7721 0.0124
NP_442837.1_3 Reverse -150 -157 15.7721 0.0124
NP_439994.1_4 Forward -189 -170 15.6341 0.185
NP_442053.1_1 Forward -158 -149 18.3876 0.0007
NP_442053.1_1 Reverse -149 -158 18.3876 0.0007
NP_440505.1_3 Forward -160 -150 17.188 0.00332
NP_440505.1_3 Reverse -147 -157 9.22315 0.122
NP_441102.1_2 Reverse -330 -349 13.8641 0.159
NP_441203.1_1 Reverse -150 -169 -2.75381 0.0655
NP_441408.2_7 Forward -160 -141 3.14605 0.199
NP_440914.1_1 Forward -158 -148 17.5935 0.000537
NP_440914.1_1 Reverse -149 -159 16.3248 0.00196
NP_440914.1_1 Forward -315 -305 6.07773 0.297
NP_441011.1_8 Reverse -150 -159 16.6177 0.00602
NP_441011.1_8 Forward -157 -148 8.25953 0.144
NP_442533.1_6 Forward -158 -149 17.2076 0.00137
NP_442533.1_6 Reverse -149 -158 17.2076 0.00137
NP_442533.1_6 Reverse -178 -187 4.62128 0.179
NP_441482.1_7 Forward -164 -150 6.88276 0.0257
NP_441482.1_7 Reverse -143 -157 -8.5552 0.193
NP_441482.1_9 Reverse -56 -69 12.9984 0.278
NP_439944.1_9 Forward -157 -147 10.5014 0.0887
NP_439944.1_9 Reverse -150 -160 9.12481 0.1
NP_439944.1_9 Forward -192 -182 4.89658 0.292
NP_441697.1_5 Forward -38 -19 -7.68752 0.248
NP_441028.1_6 Forward -168 -158 7.64939 0.218
NP_440116.1_5 Reverse -146 -163 15.6735 0.0544
NP_440116.1_8 Reverse -150 -169 -4.13045 0.163
NP_441527.1_4 Reverse -3 -22 -6.25514 0.215
NP_440115.1_6 Forward -161 -151 14.0414 0.0615
NP_440115.1_6 Reverse -146 -156 9.32148 0.115
NP_440007.1_9 Forward -162 -148 10.226 0.163
NP_440007.1_9 Reverse -145 -159 1.37622 0.285
NP_442492.1_2 Reverse -149 -168 1.67108 0.224
NP_441170.1_4 Forward -179 -161 3.26407 0.283
NP_441972.1_5 Reverse -150 -169 -3.63879 0.201
NP_441972.1_5 Forward -157 -138 -7.96535 0.256
NP_441106.1_1 Forward -159 -150 18.486 0.0028
NP_441106.1_1 Reverse -148 -157 9.63616 0.0311
NP_440646.1_1 Reverse -117 -136 11.9958 0.0574
NP_442249.1_10 Forward -117 -98 10.4225 0.286
NP_439903.1_6 Forward -161 -142 1.6703 0.241
NP_441286.1_1 Reverse -148 -160 5.93884 0.0258
NP_441286.1_1 Forward -159 -147 3.48056 0.0467
NP_442674.1_3 Reverse -170 -189 5.01354 0.278
NP_441385.1_1 Reverse -331 -346 16.5978 0.252
NP_440670.1_8 Forward -158 -149 18.3876 0.000699
NP_440670.1_8 Reverse -149 -158 18.3876 0.000699
NP_441479.1_1 Reverse -146 -165 13.3725 0.127
NP_441930.1_3 Reverse -17 -36 10.6537 0.217
NP_441930.1_3 Forward -229 -210 2.67657 0.295
NP_440886.1_7 Forward -126 -116 10.9926 0.0805
NP_440886.1_7 Forward -159 -149 8.04271 0.0805
NP_440886.1_7 Reverse -148 -158 7.94438 0.0805
NP_442614.1_2 Forward -158 -144 8.25939 0.255
NP_442072.1_9 Reverse -148 -166 -22.007 0.216
NP_442022.1_4 Forward -116 -97 5.211 0.293
NP_440907.2_8 Reverse -150 -160 9.616 0.103
NP_440907.2_8 Forward -157 -147 7.64939 0.117
NP_440841.1_4 Forward -160 -141 -9.73531 0.262
NP_441463.1_3 Forward -168 -149 -9.93197 0.287
NP_441626.1_2 Forward -157 -150 15.7721 0.0124
NP_441626.1_2 Reverse -150 -157 15.7721 0.0124
NP_442238.1_7 Forward -74 -55 10.6184 0.201
NP_442794.1_1 Reverse -145 -157 21.9668 0.00123
NP_442794.1_1 Forward -162 -150 10.5604 0.0721
NP_442615.1_1 Reverse -140 -158 14.2771 0.0102
NP_442615.1_1 Forward -167 -149 1.78911 0.0793
NP_441962.1_4 Forward -192 -173 -13.7669 0.277
NP_441962.1_4 Reverse -108 -127 -14.6519 0.291
NP_440387.1_1 Reverse -149 -165 -1.3181 0.142
NP_440387.1_1 Forward -158 -142 -3.57971 0.162
NP_441431.1_2 Forward -161 -147 16.0269 0.04
NP_441488.1_8 Reverse -144 -158 12.782 0.146
NP_441488.1_8 Forward -163 -149 9.73373 0.146
NP_441836.1_2 Forward -116 -97 -5.31042 0.277
NP_441993.1_1 Reverse -143 -162 9.84073 0.135
NP_441993.1_1 Reverse -324 -343 4.09075 0.225
NP_442323.1_7 Forward -163 -144 8.06178 0.163
NP_440422.1_10 Reverse -341 -360 4.20826 0.296
NP_441237.1_9 Forward -157 -147 14.828 0.0242
NP_442743.1_4 Reverse -150 -169 9.63589 0.0547
NP_441311.1_2 Forward -164 -150 14.7486 0.229
NP_440457.1_1 Forward -162 -150 7.70879 0.101
NP_440457.1_1 Reverse -145 -157 -0.452677 0.263
NP_440798.1_6 Reverse -150 -163 2.08423 0.186
NP_441801.1_4 Forward -93 -83 2.53664 0.292
NP_441436.1_8 Reverse -148 -167 7.37428 0.293
NP_440473.1_9 Reverse -266 -285 -12.0953 0.296
NP_442509.1_9 Reverse -184 -194 11.2876 0.138
NP_442509.1_9 Forward -158 -148 8.14104 0.192
NP_442509.1_9 Reverse -149 -159 8.04271 0.192
NP_442936.1_10 Forward -145 -131 11.1779 0.23
NP_442936.1_10 Forward -146 -132 8.88105 0.269
NP_440554.1_4 Reverse -150 -160 17.9746 0.0131
NP_442862.1_3 Forward -214 -197 10.8552 0.202
NP_441885.1_5 Forward -158 -148 20.9245 0.000538
NP_441885.1_5 Reverse -149 -159 11.3864 0.00668
NP_440478.1_4 Reverse -145 -164 15.7324 0.141
NP_440649.2_5 Reverse -148 -167 12.8808 0.232
NP_442703.1_9 Forward -361 -343 4.6407 0.248
NP_442341.1_7 Forward -159 -145 7.66941 0.0994
NP_442341.1_7 Reverse -148 -162 1.67122 0.282
NP_442341.1_9 Forward -160 -146 21.9267 0.00232
NP_441756.1_5 Reverse -145 -164 6.29264 0.175
NP_442395.2_4 Reverse -148 -167 6.48849 0.146
NP_443000.1_7 Forward -160 -150 20.3345 0.00223
NP_443000.1_7 Reverse -147 -157 10.3048 0.0345
NP_441842.1_7 Reverse -372 -391 11.0117 0.261
NP_440275.1_3 Forward -160 -150 16.1063 0.0155
NP_440275.1_3 Reverse -147 -157 8.04317 0.0602
NP_440679.1_10 Forward -120 -101 -20.7484 0.286
NP_442495.1_4 Reverse -153 -163 16.303 0.0771
NP_441105.1_3 Reverse -138 -157 8.45592 0.0484
NP_441105.1_3 Forward -169 -150 -1.47551 0.15
NP_440216.1_1 Reverse -149 -163 17.1092 0.00188
NP_440216.1_1 Forward -158 -144 -10.2268 0.145
NP_440216.1_9 Forward -150 -141 15.536 0.128
NP_440216.1_9 Forward -253 -244 6.78456 0.289
NP_440172.1_1 Reverse -149 -159 17.5813 0.00421
NP_440172.1_1 Forward -158 -148 15.0247 0.00945
NP_442015.1_10 Reverse -145 -158 19.8821 0.00366
NP_442015.1_10 Forward -162 -149 13.4906 0.0354
NP_442015.1_10 Reverse -157 -170 10.5407 0.0391
NP_441226.1_7 Forward -157 -150 14.4934 0.0123
NP_441226.1_7 Reverse -150 -157 14.4934 0.0123
NP_441111.1_7 Forward -157 -149 18.7023 0.00294
NP_441111.1_7 Reverse -150 -158 18.7023 0.00294
NP_441766.1_2 Forward -158 -149 17.5026 0.00297
NP_441766.1_2 Reverse -149 -158 17.5026 0.00297
NP_442417.1_5 Reverse -149 -163 14.3559 0.0633
NP_440416.1_1 Reverse -63 -82 -14.3569 0.287
NP_440416.1_9 Forward -165 -146 2.94938 0.0381
NP_440416.1_9 Reverse -142 -161 2.0644 0.0413
NP_443052.1_9 Forward -275 -256 -6.39206 0.282
NP_443052.1_10 Reverse -173 -192 20.4419 0.103
NP_442154.1_1 Forward -121 -103 -14.8288 0.218
NP_442564.1_10 Reverse -94 -108 8.25939 0.296
NP_442046.1_2 Reverse -132 -145 15.7211 0.22
NP_442046.1_2 Forward -143 -130 15.0527 0.25
NP_440261.1_5 Reverse -150 -163 6.70579 0.0318
NP_440261.1_5 Forward -157 -144 -2.83231 0.0932
NP_440261.1_5 Forward -186 -173 -12.4687 0.297
NP_440261.1_7 Forward -188 -169 -6.88371 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACAGGGGCATAATGGGCAAGTAAATTATCTGTAAAACAGGAAATTGTTGTAATAAAAATCCCCCAAACATGAATGCATCAATGAGGGGAATCACATAAATCAAAGCACTGAAAAAACGATCTTTCCCGTCTGCCGTACTGTTAGATGCCATAGAAAATTCCTTGTTGATTTAAAAAGAGTTACGCAGATTATGCCCTGATTTTAACCTGGGTTCGTCATGGCCCAGATTCGGTCTTCCCCCAGGCGATCGCCAAGGAAAAATTATTTTTCTGACCCGCTACCGTGGCGACAATGGTGGCCAGGTTGATACTCCTCAGGTTGGTTAACAGCCTATCCAAAACTTGCTAGAGTGTTCATTGGCCAAAAATCCCATTAATTCTTTTATTATTACCGCTTTGCC

CDS

ATGGTTAACACCTACACCGCCGAAATCCAACACCAGGGTCAGACCTATACCATCTCCGTTCCCGAGGATAAAACGGTGCTCCAAGCGGCGGATGATGAGGGGATACAACTACCTACTTCCTGTGGCGCTGGGGTTTGCACTACCTGTGCGGCGTTAATCACCGAAGGCACAGCGGAGCAGGCTGACGGCATGGGAGTTTCAGCGGAACTACAGGCTGAGGGATATGCTCTACTTTGTGTAGCCTATCCCCGCTCAGATTTGAAAATTATCACCGAAAAAGAAGACGAAGTTTATCAGCGGCAGTTCGGCGGCCAAGGTTAG

Protein

MVNTYTAEIQHQGQTYTISVPEDKTVLQAADDEGIQLPTSCGAGVCTTCAALITEGTAEQADGMGVSAELQAEGYALLCVAYPRSDLKIITEKEDEVYQRQFGGQG