Your browser is old and dusty. Try Google Chrome!

Details for slr1819

ORF slr1819
Accession NP_441076.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_1 Forward -251 -232 5.0129 0.3
NP_441418.1_6 Forward -333 -314 -15.6352 0.0822
NP_441818.1_1 Reverse -325 -336 10.7762 0.224
NP_441519.1_4 Forward -332 -315 17.0501 0.129
NP_442752.1_4 Reverse -216 -223 5.34899 0.221
NP_443027.1_4 Reverse -158 -168 8.23984 0.215
NP_441812.1_3 Reverse -159 -173 6.78443 0.291
NP_441035.1_3 Forward -336 -317 -0.295539 0.287
NP_440916.1_1 Forward -172 -158 13.2743 0.206
NP_441200.1_4 Reverse -196 -215 6.58763 0.272
NP_441208.1_9 Forward -275 -261 9.2427 0.217
NP_441594.1_6 Reverse -241 -260 0.392778 0.287
NP_440769.1_8 Reverse -164 -183 9.14423 0.216
NP_440856.1_1 Reverse -240 -259 -4.22878 0.244
NP_441083.1_5 Reverse -263 -273 5.78156 0.104
NP_442827.1_8 Reverse -316 -335 0.981987 0.191
NP_441716.1_1 Forward -333 -319 10.816 0.0936
NP_440747.1_10 Forward -275 -263 -2.61596 0.0556
NP_440403.1_4 Reverse -264 -283 -7.86702 0.248
NP_440403.1_4 Reverse -315 -334 -10.1286 0.295
NP_442730.1_8 Forward -391 -372 2.16195 0.292
NP_442687.1_7 Reverse -215 -225 3.61828 0.299
NP_441846.1_10 Reverse -205 -224 -22.0267 0.257
NP_441846.1_10 Reverse -310 -329 -23.1083 0.277
NP_441013.1_3 Reverse -214 -233 6.09597 0.281
NP_440141.1_8 Reverse -306 -325 3.93269 0.296
NP_440184.1_5 Reverse -263 -282 6.39097 0.224
NP_440800.1_1 Reverse -57 -76 15.2399 0.218
NP_439968.1_2 Forward -272 -253 11.8967 0.297
NP_441487.1_9 Reverse -215 -234 -2.55715 0.293
NP_441958.1_5 Reverse -262 -272 -0.216628 0.186
NP_440318.1_1 Forward -330 -311 5.11266 0.226
NP_442605.1_4 Reverse -314 -333 8.25926 0.299
NP_440203.1_5 Forward -330 -320 8.63269 0.29
NP_439905.1_1 Reverse -80 -93 11.4257 0.204
NP_442911.1_2 Reverse -301 -320 -7.86702 0.221
NP_443055.1_3 Forward -281 -262 10.3587 0.291
NP_443055.1_6 Forward -233 -215 -1.06322 0.271
NP_441429.1_4 Reverse -255 -274 11.0117 0.215
NP_440138.1_1 Forward -226 -208 7.09821 0.227
NP_441099.1_5 Forward -282 -263 -2.0655 0.117
NP_441294.1_7 Reverse -259 -273 10.4985 0.185
NP_441646.1_1 Forward -272 -253 1.86774 0.227
NP_441550.1_8 Forward -274 -264 6.86274 0.188
NP_439966.1_9 Reverse -158 -167 6.68623 0.253
NP_442941.1_3 Reverse -161 -171 2.83163 0.14
NP_440289.1_2 Forward -336 -323 -3.61896 0.267
NP_440983.1_9 Forward -281 -262 0.786102 0.292
NP_441076.1_2 Forward -379 -360 26.3513 0.00135
NP_441076.1_3 Forward -246 -227 18.4848 0.148
NP_440260.1_8 Forward -327 -309 -3.02911 0.246
NP_442281.1_1 Forward -230 -216 6.19383 0.133
NP_441860.1_1 Forward -352 -338 17.4885 0.276
NP_441556.1_10 Forward -278 -264 9.92981 0.281
NP_442029.1_6 Reverse -83 -102 6.39097 0.238
NP_440253.1_2 Reverse -216 -234 3.55906 0.116
NP_440929.1_8 Forward -102 -93 3.63797 0.214
NP_441762.1_7 Forward -226 -214 -6.15587 0.276
NP_443009.1_5 Forward -334 -323 9.00628 0.0965
NP_443009.1_5 Reverse -323 -334 5.95804 0.18
NP_441198.1_8 Reverse -322 -332 13.2713 0.108
NP_441015.1_10 Reverse -107 -126 10.7175 0.0698
NP_441015.1_10 Reverse -245 -264 -2.85214 0.183
NP_441673.1_1 Reverse -263 -272 -8.06341 0.254
NP_441731.1_1 Reverse -154 -172 14.8032 0.281
NP_441876.1_9 Forward -328 -318 13.2542 0.267
NP_441826.1_2 Forward -339 -325 -2.16369 0.267
NP_440785.1_1 Reverse -7 -26 -3.63879 0.294
NP_442227.1_2 Forward -327 -308 -3.63879 0.294
NP_442050.1_1 Reverse -263 -282 6.19431 0.293
NP_442050.1_8 Reverse -257 -276 12.8206 0.272
NP_442789.1_4 Reverse -307 -326 -4.32711 0.259
NP_442789.1_4 Reverse -292 -311 -4.32711 0.259
NP_442593.1_1 Reverse -324 -343 17.2074 0.193
NP_441878.1_6 Forward -334 -324 -7.68978 0.255
NP_442419.1_4 Forward -285 -267 13.7855 0.0477
NP_440356.1_4 Forward -27 -8 2.26107 0.241
NP_442347.1_2 Forward -168 -159 14.0611 0.056
NP_442965.1_2 Reverse -259 -278 -6.58872 0.257
NP_441633.1_3 Forward -322 -309 -6.2739 0.242
NP_442998.1_5 Reverse -12 -22 13.1564 0.158
NP_442334.1_2 Reverse -109 -126 -14.2191 0.297
NP_441090.1_6 Reverse -250 -264 10.0294 0.239
NP_441559.1_8 Forward -277 -263 1.76955 0.153
NP_441559.1_8 Forward -325 -311 -5.80194 0.27
NP_441559.1_8 Forward -338 -324 -6.39192 0.277
NP_440915.1_6 Reverse -246 -260 -0.787057 0.209
NP_440306.1_8 Forward -29 -10 1.76863 0.204
NP_441750.1_4 Forward -276 -257 9.73422 0.157
NP_439937.1_8 Forward -359 -340 -1.37718 0.249
NP_440408.1_7 Reverse -257 -276 9.14423 0.264
NP_440439.1_1 Reverse -213 -226 -0.767364 0.236
NP_440171.1_3 Reverse -308 -327 8.06259 0.259
NP_440819.1_5 Reverse -12 -20 7.68924 0.266
NP_440139.1_6 Reverse -273 -292 12.4875 0.26
NP_442384.1_10 Reverse -263 -276 4.54251 0.153
NP_442384.1_10 Forward -333 -320 1.29759 0.263
NP_441689.1_5 Forward -171 -161 5.68278 0.215
NP_440344.1_10 Reverse -302 -319 -12.3509 0.25
NP_441965.1_10 Forward -398 -382 4.18844 0.247
NP_440894.1_10 Forward -277 -258 4.71934 0.244
NP_440894.1_10 Forward -325 -306 4.32602 0.254
NP_440894.1_10 Forward -338 -319 3.04771 0.279
NP_442078.1_3 Reverse -42 -61 6.09517 0.186
NP_440999.1_9 Forward -324 -310 -3.44199 0.293
NP_440888.1_2 Forward -272 -258 10.8154 0.0842
NP_440888.1_2 Forward -225 -211 9.24208 0.134
NP_440105.1_7 Reverse -210 -229 11.5042 0.28
NP_442710.1_6 Forward -171 -152 10.0292 0.204
NP_443064.1_6 Reverse -324 -334 13.9243 0.0796
NP_443064.1_6 Reverse -263 -273 10.9186 0.13
NP_443064.1_6 Reverse -224 -234 8.88251 0.262
NP_443062.1_1 Forward -169 -151 4.64563 0.255
NP_443062.1_6 Forward -341 -322 4.71934 0.214
NP_441351.1_8 Forward -362 -343 2.16274 0.261
NP_441443.1_1 Reverse -256 -275 -3.14714 0.282
NP_440992.1_2 Reverse -244 -263 9.14423 0.273
NP_441884.1_9 Reverse -306 -325 -19.7651 0.158
NP_441884.1_9 Forward -336 -317 -24.0916 0.284
NP_442864.1_7 Reverse -257 -275 5.13236 0.294
NP_441733.1_10 Reverse -213 -226 6.21414 0.199
NP_441004.1_1 Reverse -306 -325 -17.7001 0.294
NP_441004.1_4 Reverse -371 -381 12.0747 0.247
NP_441851.1_10 Reverse -322 -332 6.17489 0.182
NP_441851.1_10 Forward -334 -324 4.60159 0.259
NP_442939.1_8 Reverse -34 -53 17.5024 0.247
NP_442450.1_5 Forward -335 -325 5.48657 0.242
NP_443047.1_7 Forward -272 -253 4.916 0.246
NP_440078.1_10 Reverse -263 -282 5.60432 0.224
NP_441078.1_4 Forward -333 -324 -2.06522 0.295
NP_442443.1_1 Reverse -200 -219 -6.78538 0.298
NP_441091.1_5 Reverse -246 -265 6.58763 0.208
NP_441333.1_2 Reverse -169 -182 17.6323 0.189
NP_442274.1_8 Forward -227 -209 12.8062 0.297
NP_442400.1_1 Forward -228 -209 -5.60541 0.299
NP_442489.1_7 Forward -333 -324 -2.06522 0.288
NP_441022.1_1 Forward -184 -175 13.2728 0.216
NP_442913.1_7 Forward -274 -258 19.429 0.144
NP_440025.1_3 Reverse -363 -377 13.9024 0.235
NP_440486.1_6 Reverse -298 -317 10.1275 0.219
NP_441126.1_6 Reverse -9 -23 13.9464 0.283
NP_440847.1_3 Forward -331 -317 11.1104 0.274
NP_442603.1_7 Reverse -263 -277 7.86545 0.193
NP_440671.1_4 Reverse -87 -101 7.57108 0.214
NP_440671.1_5 Forward -126 -112 15.4369 0.221
NP_441973.1_6 Reverse -167 -185 15.088 0.27
NP_440875.1_9 Forward -167 -157 8.17736 0.24
NP_440590.1_4 Reverse -264 -277 -4.79893 0.267
NP_440227.1_6 Forward -46 -32 13.7625 0.28
NP_441239.1_9 Forward -104 -92 7.02048 0.173
NP_442270.1_9 Forward -263 -244 -10.3253 0.253
NP_441017.1_8 Reverse -321 -336 7.45305 0.27
NP_442772.1_6 Forward -46 -27 18.0069 0.196
NP_441541.1_1 Reverse -40 -58 0.670429 0.228
NP_440833.1_6 Forward -392 -378 6.78381 0.296
NP_442216.1_4 Forward -331 -323 8.37716 0.255
NP_442138.1_1 Forward -281 -262 4.62021 0.24
NP_440546.1_4 Forward -198 -188 7.62206 0.23
NP_441230.1_5 Reverse -53 -72 -0.787193 0.292
NP_442479.1_9 Reverse -235 -254 -13.9635 0.294
NP_442402.1_2 Forward -24 -10 12.0937 0.272
NP_441848.1_4 Reverse -7 -23 8.98304 0.288
NP_441811.1_8 Forward -339 -325 6.48943 0.272
NP_442679.1_1 Reverse -309 -328 -0.590531 0.221
NP_442837.1_3 Forward -168 -161 6.52896 0.2
NP_440505.1_3 Reverse -214 -224 10.1081 0.117
NP_440914.1_1 Reverse -263 -273 8.41992 0.191
NP_442101.1_10 Forward -383 -364 -10.3253 0.255
NP_442533.1_6 Reverse -112 -121 2.06468 0.275
NP_442232.1_3 Reverse -303 -322 -15.9302 0.299
NP_442322.1_4 Forward -217 -200 -2.61678 0.234
NP_442322.1_4 Forward -311 -294 -8.61494 0.286
NP_441028.1_6 Forward -19 -9 7.35439 0.229
NP_441028.1_6 Forward -329 -319 6.37109 0.23
NP_440007.1_9 Forward -276 -262 2.85119 0.277
NP_440007.1_9 Reverse -246 -260 1.08123 0.29
NP_440670.1_8 Reverse -93 -102 3.34298 0.275
NP_442614.1_2 Reverse -110 -124 6.09611 0.293
NP_440907.2_4 Forward -24 -5 15.5957 0.253
NP_440907.2_8 Forward -224 -214 4.89613 0.235
NP_441021.1_1 Forward -290 -271 -12.5869 0.291
NP_442365.1_7 Forward -276 -257 -4.6221 0.248
NP_442794.1_1 Forward -276 -264 6.23383 0.186
NP_440114.1_10 Reverse -216 -230 8.16106 0.213
NP_441500.1_8 Reverse -15 -29 18.3019 0.261
NP_442087.1_2 Reverse -223 -242 14.2768 0.22
NP_441272.1_4 Forward -268 -249 0.491109 0.258
NP_440293.1_10 Reverse -379 -398 -0.4922 0.251
NP_441979.1_9 Forward -339 -320 3.34271 0.297
NP_440457.1_1 Reverse -388 -400 -0.551008 0.268
NP_441981.1_3 Forward -356 -342 14.7959 0.268
NP_441436.1_2 Reverse -308 -327 -4.22878 0.28
NP_442509.1_9 Forward -333 -323 6.76441 0.254
NP_442862.1_3 Forward -60 -43 6.23369 0.267
NP_441885.1_5 Reverse -263 -273 -0.216628 0.189
NP_442341.1_7 Reverse -323 -337 10.521 0.0625
NP_442369.1_6 Forward -189 -179 16.5414 0.127
NP_441173.1_9 Reverse -228 -236 10.9338 0.242
NP_443000.1_7 Forward -274 -264 4.69992 0.176
NP_442513.1_4 Forward -281 -262 16.2232 0.28
NP_441561.1_7 Forward -220 -201 11.7983 0.158
NP_441842.1_8 Forward -281 -263 18.8979 0.162
NP_440127.1_5 Reverse -333 -351 10.8356 0.274
NP_441389.1_5 Reverse -298 -317 13.9625 0.219
NP_441207.1_7 Reverse -15 -29 11.3853 0.241
NP_441207.1_7 Reverse -14 -28 8.4809 0.285
NP_440880.1_5 Reverse -288 -306 18.407 0.0959
NP_442234.1_6 Reverse -309 -328 13.1758 0.228
NP_440172.1_6 Reverse -238 -257 6.58763 0.278
NP_442015.1_10 Forward -276 -263 6.50913 0.114
NP_442015.1_10 Forward -312 -299 1.59258 0.204
NP_440413.1_9 Reverse -10 -29 21.288 0.0893
NP_440416.1_1 Reverse -216 -235 3.83436 0.0702
NP_440416.1_9 Forward -327 -308 -17.1101 0.231
NP_443052.1_9 Forward -257 -238 -5.21209 0.265
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCGAACCCGCTCCACTAGACCATTAGGCAATACTCCAAACCGCCGGGTTAAAATCCGCAAGATCAAGGGTGATTCCCCCCGTTGTTCTCCCCGCTGAAGTCCTAACTTCAGACCTCGTTCCAGTCCCTGCTGTTCGCCTTTCCGCATCGACTCTGCCACAATACTTTGGTAAACCACCGATTCCCGCATAACTCCCTCCCTAAGGTATAGGTTAATCAAAGACTTTTCAAAATTGATCCCAGCTAATAACTGAAGACAGGCAGCTACATTATTTCGTTCAGCCCTGTCCTCGATTATATCCACTCGCCTTGCCACATTGGCTAGTAAACTGACTCCGACGGATTCTTCCATAACTTAAGATGATTAGAGAGTTGATTTGATTTTTCCCCTCTCAAAATTT

CDS

ATGGAAGCCAAGGAATTGGTCCAACGCTATCGCAACGGCGAAACTTTATTTACAGGGCTAAAATTACCGGGGATTAATCTAGAAGCCGCCGATTTGATCGGTATTGTGCTCAATGAAGCGGATTTACGGGGGGCTAACCTGCTTTTTTGTTACCTCAACCGGGCTAATCTAGGTCAGGCTAATTTGGTGGCGGCGAACCTAAGTGGGGCTAGTTTAAACCAGGCAGACCTGGCCGGAGCCGATCTACGCAGTGCCAATTTTCACGGGGCCATGCTCCAGGGGGCTATCCTGCGGGATAGCGACATGACCCTGGCCACTCTCCAGGATACGAATTTAATTGGGGCGGATCTACGGGGAGCGGATTTAAGTGGTGCTACCCTCACCGGGGCCTGTTTGCGGGGAGCTAATATGCGTCAGGAAAAAAAGGGCTACTACACCAATCTCCAGGCCGCTATCCTCGGTCGGGCAGACCTCCAGGGGGCCAACATGAAGGGGGTAGATTTAAGCCGGGCAGATTTAAGCTACGCTAACTTGAAGGAGGCTAATCTGCGAGATGTGGATTTGCGTAAGGCAGACCTGAGCTACGCCAACTTAAAAGGGGCCCTGCTAACTGACGCTAACTTGTCGGGGGCAAAGTTAAATGGTGCCGATTTACAAAATGCCAATTTGATGCGAGCGAAGATTTCTGAGGCAGAAATGACGGCAGTGAATTGCCAGGGGGCCATTATGACCCATGTCAACCTGAATCGGACCAATCTCACGGGGTCCAATTTGAGCTTCACCCGCATGAACAGTGCCGACCTGAGTCGGGCCAACTTGACTAAAGCTAACCTACAGGAAGCAGAGCTGATTGAAGCATTTTTTGCCAGGGCCAATTTGACGGAGGCCAACTTCATCAATGCCAACTTGGTGCGGGCGGATCTAATGAGTGCCAATATGGTGGGGGCAGATTTTCAAGGGGCGACTATGCCGGATGGGCAAGTGCGTCACCACTAG

Protein

MEAKELVQRYRNGETLFTGLKLPGINLEAADLIGIVLNEADLRGANLLFCYLNRANLGQANLVAANLSGASLNQADLAGADLRSANFHGAMLQGAILRDSDMTLATLQDTNLIGADLRGADLSGATLTGACLRGANMRQEKKGYYTNLQAAILGRADLQGANMKGVDLSRADLSYANLKEANLRDVDLRKADLSYANLKGALLTDANLSGAKLNGADLQNANLMRAKISEAEMTAVNCQGAIMTHVNLNRTNLTGSNLSFTRMNSADLSRANLTKANLQEAELIEAFFARANLTEANFINANLVRADLMSANMVGADFQGATMPDGQVRHH