Your browser is old and dusty. Try Google Chrome!

Details for slr1813

ORF slr1813
Accession NP_441065.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -89 -82 14.6904 0.0123
NP_440795.1_7 Reverse -82 -89 14.6904 0.0123
NP_442100.1_1 Reverse -342 -361 5.58586 0.296
NP_441453.1_1 Forward -377 -359 2.28001 0.299
NP_441453.1_4 Reverse -81 -89 16.539 0.00633
NP_441453.1_4 Forward -90 -82 7.8859 0.0536
NP_441453.1_7 Forward -306 -299 12.1338 0.295
NP_442151.1_6 Reverse -81 -95 14.6509 0.0321
NP_442151.1_6 Forward -90 -76 10.226 0.127
NP_441818.1_1 Forward -89 -78 15.4961 0.0264
NP_440226.1_1 Forward -90 -71 7.17762 0.111
NP_442623.1_3 Reverse -82 -101 -11.3086 0.24
NP_442655.1_1 Reverse -76 -95 -0.000545616 0.242
NP_441066.1_1 Forward -113 -94 31.8587 0.0000414
NP_441066.1_9 Forward -319 -300 19.5277 0.138
NP_441066.1_10 Forward -50 -34 25.7229 0.00152
NP_442173.1_1 Forward -89 -81 15.4574 0.00633
NP_442173.1_1 Reverse -82 -90 14.1791 0.0165
NP_442752.1_4 Reverse -81 -88 13.8055 0.0199
NP_443027.1_4 Reverse -79 -89 11.0914 0.107
NP_443027.1_4 Forward -92 -82 8.23984 0.215
NP_442975.1_10 Forward -94 -80 2.35894 0.276
NP_441225.1_3 Forward -80 -61 10.5209 0.257
NP_441675.1_4 Forward -223 -204 3.73603 0.263
NP_440784.1_7 Forward -89 -82 15.9687 0.0123
NP_440784.1_7 Reverse -82 -89 15.9687 0.0123
NP_441250.1_3 Reverse -212 -231 15.5357 0.111
NP_440061.1_9 Forward -92 -78 14.6503 0.0617
NP_441054.1_4 Reverse -71 -89 -0.669169 0.187
NP_440878.1_4 Forward -257 -239 9.85225 0.29
NP_442062.1_3 Reverse -345 -364 5.99764 0.182
NP_442062.1_3 Forward -362 -343 -0.688862 0.249
NP_442062.1_8 Reverse -81 -91 9.61647 0.0587
NP_442062.1_8 Forward -90 -80 7.84651 0.0871
NP_440304.1_4 Reverse -79 -89 1.84832 0.299
NP_442242.1_4 Forward -89 -82 14.3954 0.0124
NP_442242.1_4 Reverse -82 -89 14.3954 0.0124
NP_440044.1_8 Reverse -82 -101 -3.24547 0.281
NP_441660.1_1 Forward -293 -274 17.7965 0.198
NP_442110.1_7 Reverse -81 -95 12.8809 0.0586
NP_442110.1_7 Forward -175 -161 4.52282 0.2
NP_441925.1_2 Forward -273 -254 0.982764 0.282
NP_441083.1_5 Forward -90 -80 10.9931 0.017
NP_441083.1_5 Reverse -81 -91 1.55333 0.204
NP_441149.1_7 Reverse -119 -138 2.0644 0.271
NP_441434.1_1 Forward -357 -343 8.98786 0.251
NP_441571.1_8 Reverse -277 -296 -3.44213 0.294
NP_441738.1_2 Forward -88 -81 15.28 0.0102
NP_441738.1_2 Reverse -83 -90 11.5435 0.084
NP_440209.1_1 Reverse -81 -89 18.1123 0.00295
NP_440209.1_1 Forward -90 -82 8.47588 0.0457
NP_440209.1_1 Reverse -180 -188 2.08437 0.286
NP_442889.1_8 Reverse -78 -92 3.93223 0.27
NP_442398.1_4 Reverse -210 -229 14.0599 0.139
NP_440538.1_10 Reverse -85 -104 11.4058 0.253
NP_442111.1_4 Reverse -80 -94 18.2892 0.00757
NP_440906.1_5 Forward -89 -82 15.8704 0.0124
NP_440906.1_5 Reverse -82 -89 15.8704 0.0124
NP_440747.1_10 Reverse -78 -90 7.02048 0.0108
NP_440747.1_10 Forward -93 -81 5.44718 0.0137
NP_441130.1_10 Reverse -178 -192 8.84938 0.131
NP_441486.1_1 Forward -93 -79 -5.31028 0.231
NP_442145.1_4 Forward -363 -344 16.281 0.0898
NP_442634.1_4 Reverse -79 -93 7.86607 0.0479
NP_440470.1_5 Reverse -339 -358 6.34979 0.279
NP_441012.1_4 Forward -315 -302 6.80412 0.276
NP_443018.1_3 Forward -89 -82 14.8871 0.0123
NP_443018.1_3 Reverse -82 -89 14.8871 0.0123
NP_443018.1_3 Forward -137 -130 7.6106 0.156
NP_441316.1_7 Reverse -79 -94 -3.26502 0.273
NP_441634.1_8 Reverse -79 -93 -2.95034 0.295
NP_440376.1_1 Reverse -81 -90 9.73449 0.0365
NP_440376.1_1 Forward -90 -81 9.63616 0.0385
NP_441588.1_4 Forward -88 -78 6.46988 0.193
NP_441077.1_6 Forward -394 -378 5.98329 0.244
NP_441422.1_7 Reverse -79 -96 -2.41943 0.213
NP_440360.1_9 Forward -290 -271 6.78429 0.259
NP_442658.1_1 Forward -92 -82 11.1893 0.0915
NP_442658.1_1 Reverse -79 -89 7.94438 0.199
NP_442782.1_2 Reverse -57 -71 4.12949 0.257
NP_441414.1_9 Forward -90 -71 -10.3253 0.28
NP_442937.1_5 Forward -219 -200 7.57094 0.248
NP_442937.1_5 Reverse -76 -95 6.19431 0.286
NP_441958.1_1 Reverse -374 -393 12.9369 0.27
NP_441958.1_5 Forward -91 -81 11.3864 0.0074
NP_441958.1_5 Reverse -80 -90 3.12662 0.0364
NP_442816.1_7 Reverse -345 -364 6.15881 0.242
NP_439905.1_1 Forward -89 -76 7.00078 0.269
NP_439990.1_5 Reverse -76 -89 13.4906 0.0942
NP_439990.1_5 Forward -95 -82 6.21414 0.249
NP_442690.1_1 Forward -361 -342 -7.67036 0.177
NP_442690.1_1 Forward -223 -204 -16.8151 0.291
NP_442911.1_2 Forward -100 -81 0.491109 0.0665
NP_440153.1_5 Reverse -82 -96 2.06454 0.239
NP_442064.1_4 Reverse -322 -341 4.91521 0.283
NP_440993.1_2 Forward -95 -79 3.40179 0.259
NP_440138.1_7 Reverse -193 -211 15.2807 0.278
NP_441913.1_3 Forward -219 -206 15.3405 0.218
NP_441099.1_5 Reverse -71 -90 5.60432 0.0469
NP_442438.1_10 Forward -95 -81 1.86788 0.188
NP_441000.1_6 Forward -91 -77 -2.95034 0.221
NP_440484.1_3 Reverse -79 -93 18.4858 0.135
NP_440147.1_4 Forward -92 -79 11.1307 0.0341
NP_441550.1_8 Reverse -79 -89 15.1225 0.0132
NP_441550.1_8 Forward -92 -82 12.0743 0.0379
NP_441916.1_7 Reverse -81 -91 9.61647 0.0333
NP_441916.1_7 Forward -90 -80 2.04498 0.265
NP_441041.1_7 Forward -93 -81 12.568 0.0611
NP_440569.1_10 Reverse -204 -223 13.8937 0.142
NP_440569.1_10 Reverse -203 -222 3.19856 0.28
NP_440703.1_9 Reverse -88 -101 10.0485 0.208
NP_441725.1_5 Forward -89 -79 2.04498 0.115
NP_441725.1_5 Reverse -82 -92 0.668351 0.156
NP_439966.1_7 Reverse -79 -89 15.3192 0.0152
NP_439966.1_9 Reverse -178 -187 9.83282 0.215
NP_442941.1_3 Forward -89 -79 19.2529 0.00262
NP_442941.1_3 Reverse -82 -92 1.65166 0.147
NP_440289.1_2 Reverse -177 -190 1.19926 0.135
NP_441514.1_4 Forward -22 -3 13.4738 0.269
NP_441514.1_6 Reverse -157 -164 14.2971 0.248
NP_442281.1_1 Forward -95 -81 9.24208 0.0726
NP_441334.1_7 Reverse -164 -183 -12.9802 0.181
NP_441079.1_3 Forward -305 -286 18.7807 0.166
NP_441079.1_7 Forward -393 -374 1.27698 0.179
NP_442256.1_2 Reverse -79 -97 -9.12563 0.249
NP_440437.1_1 Forward -96 -77 -1.67217 0.205
NP_442500.1_8 Forward -394 -380 23.9645 0.00577
NP_441644.1_6 Reverse -81 -91 16.5975 0.00319
NP_441644.1_6 Forward -90 -80 8.04271 0.11
NP_443049.1_6 Reverse -80 -90 11.2506 0.269
NP_442215.1_2 Reverse -79 -95 -0.924775 0.175
NP_442029.1_6 Reverse -76 -95 12.2908 0.155
NP_440253.1_2 Forward -90 -72 1.49411 0.159
NP_440929.1_8 Forward -90 -81 17.4043 0.00289
NP_440929.1_8 Reverse -81 -90 17.4043 0.00289
NP_442933.1_1 Forward -362 -343 11.0289 0.249
NP_442933.1_10 Reverse -81 -90 9.04618 0.063
NP_442933.1_10 Forward -90 -81 8.94785 0.0643
NP_441751.2_8 Forward -89 -75 -4.52363 0.174
NP_442554.1_8 Forward -89 -79 16.2046 0.0065
NP_442554.1_8 Reverse -82 -92 13.0581 0.0204
NP_442970.1_3 Forward -232 -214 12.1132 0.251
NP_441762.1_7 Forward -190 -178 -3.89426 0.14
NP_441762.1_7 Reverse -80 -92 -7.04085 0.285
NP_442142.1_4 Forward -93 -80 4.64028 0.214
NP_442292.1_1 Forward -89 -80 18.486 0.00229
NP_442292.1_1 Reverse -82 -91 16.9127 0.00594
NP_442476.1_6 Forward -89 -75 2.85119 0.171
NP_440895.1_6 Reverse -75 -88 10.049 0.202
NP_443009.1_5 Reverse -80 -91 13.4312 0.0327
NP_441715.1_4 Forward -89 -79 17.3846 0.0106
NP_440158.1_1 Reverse -347 -366 9.59652 0.276
NP_441198.1_8 Forward -92 -82 11.3181 0.211
NP_440464.1_10 Reverse -258 -268 14.0586 0.169
NP_441468.1_1 Forward -89 -82 15.8704 0.0124
NP_441468.1_1 Reverse -82 -89 15.8704 0.0124
NP_441673.1_1 Reverse -81 -90 11.1111 0.0121
NP_441673.1_1 Forward -90 -81 11.0128 0.018
NP_441826.1_2 Forward -96 -82 -1.77037 0.254
NP_441330.1_1 Reverse -76 -95 -4.91709 0.101
NP_442868.1_6 Reverse -79 -89 19.2529 0.00563
NP_441056.1_1 Forward -90 -71 -6.88371 0.271
NP_441911.1_10 Forward -399 -380 10.3907 0.226
NP_440145.1_3 Reverse -71 -90 3.24438 0.107
NP_440145.1_3 Forward -185 -166 -6.29373 0.295
NP_442050.1_5 Reverse -79 -89 14.3359 0.0206
NP_442050.1_5 Forward -92 -82 8.63269 0.223
NP_442050.1_5 Reverse -164 -174 8.43603 0.234
NP_440558.1_2 Forward -99 -80 -4.52377 0.246
NP_442576.1_2 Forward -393 -374 7.47261 0.263
NP_441878.1_6 Forward -91 -81 0.668351 0.139
NP_441878.1_6 Reverse -80 -90 0.668351 0.139
NP_441036.1_8 Forward -91 -81 14.7297 0.0187
NP_442650.1_2 Reverse -81 -95 8.25939 0.13
NP_441557.1_5 Forward -90 -81 17.4043 0.0023
NP_441557.1_5 Reverse -81 -90 10.8161 0.00464
NP_442066.2_4 Reverse -81 -100 -8.94866 0.296
NP_440084.1_8 Forward -355 -341 9.27434 0.29
NP_441063.1_8 Forward -275 -261 15.7488 0.29
NP_442347.1_2 Forward -89 -80 12.4878 0.056
NP_442645.1_2 Reverse -73 -92 -21.83 0.29
NP_441037.1_4 Forward -92 -82 13.9448 0.0515
NP_441633.1_3 Forward -92 -79 -4.20895 0.185
NP_441633.1_3 Reverse -79 -92 -6.37223 0.248
NP_440136.1_2 Forward -89 -82 15.9687 0.0123
NP_440136.1_2 Reverse -82 -89 15.9687 0.0123
NP_442998.1_5 Forward -73 -63 7.45319 0.292
NP_442998.1_10 Forward -88 -81 15.5754 0.0102
NP_442998.1_10 Reverse -83 -90 5.84064 0.235
NP_440299.1_1 Forward -94 -81 11.7201 0.0455
NP_440299.1_1 Reverse -77 -90 2.47701 0.288
NP_441799.1_1 Reverse -77 -91 10.2254 0.0778
NP_441007.1_10 Forward -95 -82 0.412608 0.23
NP_442201.1_10 Forward -101 -82 -12.8819 0.27
NP_440256.1_1 Forward -110 -91 -3.93378 0.143
NP_440915.1_6 Reverse -77 -91 0.491246 0.162
NP_442386.1_9 Reverse -80 -89 13.8639 0.0289
NP_442386.1_9 Forward -91 -82 5.11253 0.266
NP_441340.1_5 Forward -89 -82 15.6737 0.0124
NP_441340.1_5 Reverse -82 -89 15.6737 0.0124
NP_442327.1_3 Forward -360 -341 5.29938 0.28
NP_441248.1_10 Forward -223 -213 14.9073 0.277
NP_440586.1_8 Forward -89 -82 13.2151 0.026
NP_440586.1_8 Reverse -82 -89 13.2151 0.026
NP_442251.1_6 Forward -89 -82 15.2804 0.0124
NP_442251.1_6 Reverse -82 -89 15.2804 0.0124
NP_442251.1_6 Forward -188 -181 9.77388 0.162
NP_442959.1_5 Reverse -201 -220 5.70265 0.274
NP_441262.1_3 Forward -90 -83 14.8871 0.0223
NP_441262.1_3 Reverse -81 -88 14.7888 0.0223
NP_443051.1_1 Forward -91 -82 17.5026 0.0066
NP_443051.1_1 Reverse -80 -89 10.4228 0.00754
NP_441595.1_2 Reverse -271 -284 13.2397 0.277
NP_440408.1_7 Reverse -81 -100 12.4875 0.21
NP_439943.1_7 Reverse -76 -95 7.37428 0.208
NP_440372.1_2 Forward -89 -82 16.3621 0.0124
NP_440372.1_2 Reverse -82 -89 16.3621 0.0124
NP_440139.1_1 Forward -195 -176 6.29183 0.143
NP_442416.1_1 Reverse -102 -121 9.69201 0.193
NP_442384.1_10 Reverse -81 -94 5.72248 0.121
NP_442384.1_10 Forward -90 -77 3.26421 0.197
NP_442114.1_2 Forward -293 -274 2.16274 0.262
NP_442262.1_10 Forward -89 -82 14.1988 0.0123
NP_442262.1_10 Reverse -82 -89 14.1988 0.0123
NP_442262.1_10 Forward -137 -130 8.8889 0.219
NP_441689.1_5 Reverse -79 -89 5.78111 0.197
NP_440531.1_6 Forward -136 -117 -4.03212 0.273
NP_441965.1_10 Reverse -290 -306 3.89344 0.253
NP_440297.1_9 Reverse -82 -92 0.0783647 0.282
NP_440297.1_9 Forward -89 -79 -0.118297 0.282
NP_442280.1_10 Reverse -71 -89 5.55182 0.283
NP_440999.1_9 Forward -94 -80 2.06454 0.154
NP_440888.1_2 Forward -138 -124 7.07881 0.208
NP_440888.1_2 Forward -90 -76 6.98048 0.212
NP_440600.1_4 Forward -98 -80 8.27895 0.0716
NP_442277.1_7 Forward -396 -380 -1.04361 0.264
NP_441543.1_2 Forward -89 -80 16.9127 0.00359
NP_441543.1_2 Reverse -82 -91 6.39124 0.153
NP_442845.1_2 Forward -96 -82 5.80112 0.224
NP_442710.1_7 Forward -117 -98 -8.47217 0.299
NP_441469.1_8 Forward -91 -82 6.98123 0.227
NP_441469.1_8 Reverse -80 -89 6.48957 0.227
NP_442578.1_7 Forward -89 -82 14.5921 0.026
NP_442578.1_7 Reverse -82 -89 14.5921 0.026
NP_440148.1_1 Forward -20 -1 -7.4737 0.288
NP_441462.1_2 Reverse -81 -91 11.3864 0.00425
NP_441462.1_2 Forward -90 -80 1.74999 0.0811
NP_441929.1_7 Forward -379 -360 12.7825 0.265
NP_443062.1_1 Reverse -81 -99 14.5914 0.0454
NP_443062.1_1 Forward -90 -72 6.40076 0.202
NP_442204.1_1 Forward -94 -83 8.4168 0.0945
NP_442204.1_2 Forward -100 -81 6.19431 0.291
NP_440516.1_2 Forward -96 -78 -2.63579 0.299
NP_440516.1_8 Reverse -81 -90 9.53783 0.0136
NP_440516.1_8 Forward -90 -81 7.07956 0.0867
NP_442428.1_5 Forward -89 -82 15.8704 0.0124
NP_442428.1_5 Reverse -82 -89 15.8704 0.0124
NP_441353.1_7 Forward -75 -57 19.1929 0.106
NP_440673.1_3 Forward -88 -81 12.4288 0.0426
NP_440673.1_3 Forward -136 -129 10.5605 0.123
NP_440673.1_3 Reverse -83 -90 5.34899 0.298
NP_441052.1_2 Forward -90 -80 11.3864 0.0285
NP_441052.1_2 Reverse -81 -91 0.668351 0.256
NP_442219.1_9 Forward -89 -80 17.7976 0.00718
NP_440436.1_4 Forward -89 -80 17.2072 0.00233
NP_440436.1_4 Reverse -309 -318 4.91586 0.23
NP_440314.1_9 Forward -89 -70 6.4893 0.0579
NP_441719.1_4 Forward -89 -82 16.3621 0.0124
NP_441719.1_4 Reverse -82 -89 16.3621 0.0124
NP_441733.1_10 Reverse -177 -190 8.08242 0.143
NP_442366.1_3 Reverse -80 -98 5.72234 0.0847
NP_441115.1_4 Reverse -80 -98 9.55647 0.21
NP_442206.1_10 Reverse -81 -96 3.51981 0.184
NP_441851.1_10 Reverse -80 -90 15.6147 0.00791
NP_441851.1_10 Forward -91 -81 6.96153 0.151
NP_442622.1_2 Reverse -287 -306 13.175 0.0615
NP_442011.1_1 Reverse -80 -99 0.294447 0.268
NP_442856.1_7 Forward -99 -80 -0.0988766 0.206
NP_441668.1_4 Forward -100 -81 2.85105 0.189
NP_442515.1_1 Forward -91 -77 0.589577 0.187
NP_440338.1_4 Reverse -366 -385 4.71854 0.298
NP_440338.1_4 Forward -390 -371 4.52188 0.298
NP_442689.1_8 Forward -357 -340 -3.79607 0.252
NP_441349.1_10 Forward -100 -81 6.78429 0.0342
NP_441349.1_10 Reverse -71 -90 -8.35868 0.274
NP_441409.1_6 Forward -96 -77 -15.4385 0.295
NP_440432.1_9 Forward -89 -74 4.50312 0.0691
NP_440588.1_2 Forward -99 -80 -1.08219 0.155
NP_441031.1_1 Forward -366 -347 7.20836 0.259
NP_441570.1_1 Reverse -81 -99 -10.6989 0.177
NP_441570.1_1 Forward -317 -299 -16.2055 0.24
NP_441078.1_4 Reverse -81 -90 9.93116 0.0203
NP_441078.1_4 Forward -90 -81 9.83282 0.0226
NP_440526.1_3 Forward -89 -78 1.04151 0.267
NP_441432.1_8 Reverse -80 -89 16.8143 0.00595
NP_441432.1_8 Forward -91 -82 6.98123 0.112
NP_441432.1_8 Reverse -128 -137 2.55633 0.298
NP_442320.1_8 Reverse -75 -89 6.19444 0.029
NP_442344.1_7 Reverse -82 -101 -8.35868 0.211
NP_441732.1_2 Forward -94 -78 1.73016 0.0299
NP_442003.1_4 Forward -89 -70 19.469 0.0905
NP_442010.1_1 Forward -286 -268 8.17984 0.274
NP_442400.1_10 Forward -220 -207 11.0433 0.248
NP_442489.1_7 Reverse -81 -90 10.4228 0.0151
NP_442489.1_7 Forward -90 -81 10.3245 0.0193
NP_442079.1_7 Forward -89 -70 1.47442 0.251
NP_440559.1_1 Forward -89 -80 17.4043 0.00658
NP_440559.1_1 Reverse -82 -91 7.76787 0.0918
NP_441659.2_8 Reverse -81 -91 17.5813 0.0024
NP_441659.2_8 Forward -90 -80 8.63316 0.0405
NP_441022.1_1 Forward -384 -375 11.834 0.273
NP_441022.1_1 Reverse -373 -382 10.587 0.294
NP_442913.1_10 Forward -99 -80 4.916 0.0808
NP_439956.1_7 Reverse -123 -142 2.65439 0.273
NP_442346.1_5 Reverse -80 -90 15.418 0.00627
NP_442346.1_5 Forward -91 -81 6.8632 0.188
NP_440545.1_3 Reverse -77 -94 -3.50107 0.206
NP_440545.1_3 Forward -94 -77 -6.25434 0.273
NP_440459.1_2 Reverse -48 -65 8.39697 0.264
NP_441943.1_9 Forward -135 -121 19.0751 0.125
NP_440847.1_3 Forward -168 -154 12.0937 0.254
NP_441833.1_4 Forward -89 -82 15.9687 0.0124
NP_441833.1_4 Reverse -82 -89 15.9687 0.0124
NP_441833.1_4 Forward -188 -181 11.0522 0.0559
NP_441329.1_1 Forward -365 -346 20.3871 0.0847
NP_442162.1_9 Forward -89 -82 16.2637 0.0124
NP_442162.1_9 Reverse -82 -89 16.2637 0.0124
NP_440671.1_1 Forward -364 -345 6.80099 0.229
NP_440671.1_4 Forward -96 -82 7.76774 0.208
NP_442943.1_1 Reverse -204 -219 3.29703 0.278
NP_442199.1_7 Forward -229 -210 3.83357 0.245
NP_442140.1_3 Forward -89 -79 10.3048 0.0902
NP_442140.1_3 Reverse -82 -92 7.64985 0.133
NP_441671.1_10 Forward -149 -130 1.27776 0.273
NP_440875.1_9 Reverse -83 -93 6.81464 0.297
NP_441813.1_5 Reverse -79 -89 18.1713 0.00743
NP_441813.1_5 Forward -92 -82 7.84651 0.0573
NP_440590.1_4 Forward -89 -76 11.6223 0.019
NP_440567.1_1 Reverse -82 -96 4.62115 0.116
NP_442497.1_10 Reverse -82 -91 15.7327 0.0087
NP_442497.1_10 Forward -89 -80 10.4228 0.0087
NP_440821.1_4 Reverse -79 -89 9.41981 0.0286
NP_440821.1_4 Forward -92 -82 1.65166 0.132
NP_441239.1_9 Forward -92 -80 11.1504 0.0648
NP_441727.1_3 Forward -145 -126 8.75091 0.202
NP_440624.1_5 Forward -391 -373 7.95661 0.285
NP_441892.1_1 Forward -99 -82 0.432165 0.168
NP_440219.1_1 Reverse -377 -396 12.364 0.286
NP_440219.1_1 Forward -366 -347 12.173 0.3
NP_442643.1_1 Reverse -75 -94 -11.6036 0.231
NP_442643.1_7 Reverse -117 -136 1.86774 0.288
NP_440612.1_1 Reverse -360 -379 10.0292 0.296
NP_441541.1_1 Forward -363 -345 13.5618 0.0795
NP_441541.1_1 Reverse -344 -362 11.1745 0.0858
NP_442284.1_5 Reverse -279 -293 16.7152 0.294
NP_440546.1_4 Reverse -129 -139 7.13728 0.257
NP_440546.1_4 Reverse -81 -91 6.65249 0.288
NP_440462.1_6 Reverse -79 -89 9.61647 0.0429
NP_440462.1_6 Forward -92 -82 1.84832 0.294
NP_442340.1_3 Forward -136 -117 -8.45701 0.249
NP_440868.1_4 Reverse -77 -89 7.70879 0.0648
NP_442479.1_9 Forward -223 -204 -11.1119 0.273
NP_442479.1_9 Forward -211 -192 -13.9635 0.294
NP_440653.1_10 Reverse -82 -101 7.7676 0.201
NP_442039.1_4 Forward -89 -82 15.1821 0.0124
NP_442039.1_4 Reverse -82 -89 15.1821 0.0124
NP_442891.1_5 Reverse -381 -391 15.8718 0.293
NP_442837.1_3 Forward -89 -82 15.7721 0.0124
NP_442837.1_3 Reverse -82 -89 15.7721 0.0124
NP_440160.1_1 Reverse -341 -360 10.1506 0.244
NP_442053.1_1 Reverse -81 -90 9.34117 0.0666
NP_442053.1_1 Forward -90 -81 8.84951 0.072
NP_440505.1_3 Reverse -79 -89 18.3679 0.00213
NP_440520.1_10 Forward -146 -127 12.0933 0.287
NP_441203.1_1 Reverse -82 -101 -4.81876 0.0834
NP_441408.2_7 Reverse -79 -98 -1.37718 0.251
NP_440914.1_1 Reverse -81 -91 14.0802 0.0188
NP_440914.1_1 Forward -90 -80 8.51751 0.186
NP_441011.1_8 Reverse -82 -91 8.94785 0.141
NP_441011.1_8 Forward -89 -80 8.25953 0.144
NP_442533.1_6 Reverse -81 -90 7.86621 0.0862
NP_442533.1_6 Forward -90 -81 7.37455 0.0898
NP_440263.1_5 Forward -229 -215 6.98109 0.294
NP_442232.1_3 Forward -98 -79 -14.6519 0.288
NP_441482.1_7 Forward -96 -82 -10.7185 0.213
NP_441482.1_7 Reverse -75 -89 -12.2918 0.292
NP_439944.1_9 Forward -174 -164 10.5998 0.0887
NP_439944.1_9 Forward -89 -79 10.5014 0.0887
NP_439944.1_9 Reverse -82 -92 6.8632 0.165
NP_441697.1_5 Forward -393 -374 -0.907597 0.204
NP_441697.1_5 Forward -392 -373 -9.02441 0.268
NP_441697.1_5 Forward -245 -226 -9.88384 0.278
NP_441749.1_7 Reverse -175 -194 13.4708 0.205
NP_441028.1_6 Forward -164 -154 3.71617 0.281
NP_440116.1_8 Reverse -82 -101 -10.0303 0.297
NP_441527.1_4 Forward -332 -313 -3.10391 0.164
NP_440115.1_6 Reverse -78 -88 6.76487 0.167
NP_440115.1_6 Reverse -126 -136 4.89658 0.28
NP_441602.1_3 Reverse -76 -95 -5.9004 0.3
NP_441106.1_1 Reverse -80 -89 9.63616 0.0311
NP_441106.1_1 Forward -91 -82 9.34117 0.0333
NP_441286.1_1 Forward -91 -79 2.20226 0.0693
NP_441286.1_1 Reverse -80 -92 -3.20594 0.145
NP_440670.1_8 Reverse -81 -90 16.3227 0.00291
NP_440670.1_8 Forward -90 -81 15.1427 0.00768
NP_440670.1_8 Reverse -245 -254 3.14632 0.296
NP_440886.1_7 Reverse -179 -189 10.6976 0.0805
NP_442072.1_9 Reverse -80 -98 -22.597 0.246
NP_440907.2_8 Reverse -82 -92 14.0409 0.0342
NP_441021.1_8 Forward -194 -176 2.57575 0.246
NP_441626.1_2 Forward -89 -82 15.7721 0.0124
NP_441626.1_2 Reverse -82 -89 15.7721 0.0124
NP_442794.1_1 Forward -94 -82 11.2487 0.0721
NP_442794.1_1 Reverse -77 -89 7.4138 0.138
NP_442615.1_1 Forward -99 -81 9.45892 0.0254
NP_440387.1_1 Reverse -81 -97 -2.39974 0.147
NP_441431.1_2 Forward -141 -127 7.76712 0.234
NP_441065.1_2 Forward -295 -276 19.8609 0.0543
NP_441065.1_3 Forward -366 -347 28.0238 0.000252
NP_441488.1_2 Reverse -145 -164 15.5357 0.282
NP_441488.1_8 Forward -95 -81 9.93039 0.146
NP_441993.1_1 Forward -96 -77 1.16703 0.284
NP_440114.1_10 Reverse -129 -143 12.586 0.0783
NP_440311.1_3 Forward -227 -208 17.2074 0.194
NP_441720.1_2 Forward -142 -123 5.50519 0.217
NP_440766.1_2 Reverse -331 -347 16.4791 0.22
NP_440766.1_4 Forward -94 -80 0.196253 0.298
NP_439988.1_3 Reverse -82 -96 4.91614 0.292
NP_440422.1_10 Forward -297 -278 5.17639 0.279
NP_439910.1_2 Reverse -73 -90 -22.5773 0.267
NP_440457.1_1 Reverse -77 -89 -0.649339 0.271
NP_440798.1_6 Reverse -82 -95 10.934 0.0698
NP_441981.1_8 Forward -224 -210 15.7325 0.261
NP_442680.1_5 Forward -399 -380 2.4168 0.237
NP_440142.1_7 Reverse -82 -101 11.9958 0.2
NP_441332.1_4 Forward -395 -376 3.73603 0.293
NP_442509.1_9 Forward -189 -179 8.04271 0.192
NP_440554.1_4 Reverse -82 -92 10.1081 0.0593
NP_440554.1_4 Forward -89 -79 8.92815 0.0646
NP_442737.1_9 Reverse -309 -328 20.8267 0.0322
NP_441885.1_5 Forward -90 -80 11.0914 0.00874
NP_441885.1_5 Reverse -81 -91 2.24165 0.0822
NP_440478.1_10 Forward -92 -78 8.84938 0.257
NP_442703.1_1 Forward -398 -379 5.58586 0.278
NP_441173.1_9 Reverse -5 -13 14.3753 0.161
NP_441173.1_9 Reverse -6 -14 10.2454 0.261
NP_443000.1_7 Reverse -79 -89 19.9412 0.00223
NP_443000.1_7 Forward -92 -82 1.65166 0.235
NP_440275.1_3 Reverse -79 -89 15.123 0.0182
NP_440275.1_3 Forward -92 -82 9.12481 0.055
NP_440091.1_1 Reverse -77 -89 -0.452677 0.273
NP_441635.1_1 Forward -392 -373 3.58052 0.281
NP_441122.1_1 Forward -30 -15 9.32134 0.28
NP_442495.1_4 Reverse -85 -95 11.3864 0.278
NP_441105.1_3 Forward -101 -82 3.6377 0.089
NP_440216.1_1 Reverse -81 -95 -2.36035 0.0494
NP_440216.1_1 Forward -90 -76 -2.75368 0.0574
NP_440678.1_9 Forward -143 -124 13.2741 0.14
NP_440172.1_1 Reverse -81 -91 10.9931 0.0445
NP_440172.1_1 Forward -90 -80 5.19158 0.149
NP_441064.1_4 Forward -247 -228 27.4338 0.00173
NP_441064.1_5 Forward -221 -202 25.2705 0.00405
NP_441064.1_6 Forward -343 -324 19.469 0.049
NP_441064.1_7 Forward -137 -118 28.2962 0.0000091
NP_442015.1_10 Forward -94 -81 14.4739 0.0296
NP_442329.1_7 Forward -135 -116 18.5831 0.162
NP_441226.1_7 Forward -89 -82 14.4934 0.0123
NP_441226.1_7 Reverse -82 -89 14.4934 0.0123
NP_441111.1_7 Forward -89 -81 18.7023 0.00294
NP_441111.1_7 Reverse -82 -90 8.96754 0.0463
NP_441766.1_2 Forward -90 -81 16.2243 0.0047
NP_441766.1_2 Reverse -81 -90 9.14451 0.0337
NP_442417.1_5 Reverse -81 -95 13.7659 0.0747
NP_440416.1_9 Forward -97 -78 -3.83545 0.0751
NP_442116.1_4 Forward -124 -110 19.8624 0.219
NP_442116.1_6 Forward -284 -267 10.7472 0.215
NP_442116.1_6 Forward -366 -349 8.93289 0.238
NP_442116.1_6 Reverse -267 -284 6.83207 0.271
NP_440261.1_5 Forward -89 -76 -4.50394 0.151
NP_440261.1_5 Reverse -82 -95 -10.7971 0.21
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGATAAAAAAAAGCTCAAAAGTCTTTTGAGGTTATTATTTGAACATTTATTAAAATTGTCCTATTGGAAAAGTGAGGAGCAGAACAATCGTAATCATTGGGAGGCCGAGATTATTAATTTTCGTCAATTGATTGAGGATGAATTAGCAGATAGTCCTAGTCTCAAAGTTTATTTGCAAGAAATTTGGCAAGAATGTTACCAGTATGGGCGCAAGATCGCGGCTAAGCGTTCTCAACTTCCCCTCAGTACATTTCCAGAGGAACCCATTGCTACCCTTGAACAAATATTGAATGAAGATTGGTTGCCCTATGCGATCGCCAGATAATGAGGCAAATCGTGTGCCCACTCATTGAGTGGAAGCTAAAATAAGATTGACGATTAATCATTTGGGAAAACAGC

CDS

ATGGTTGCCGAACTCCGCAAAACTAATACAAGTCTTTATGAGACGGATTACAATCTTTGGATTCTAGAAACCGTACAAAAGTTGCAATGCCGAGATTTAGAGAATCTAGACTGGGAATATTTGATTGAGGAGGTATTAAGCTTGAGTCGGCGAGATAGGCACAAACTAGCTAGTTTGCTAACCAGACTATTCGAGCATTTATTAAAGTTGGGCTATTGGCATTCAGAAAAAGAAAGAAACCGAAACCATTGGAGGCGAGAAATTCGCAATTTTCGTCTTCAAATTGACCGATTGCTAAGTGACAGCCCAAGCCTAAAACCTTATTTGTCAGAGATTTTTGATAAATGTTACAAAAATGGCATAAGTTTAGCTTCTGATAGTTCGGGCTTATCGATTGAAAATTTTCCCGAACAACCCATTGCTACCTTTGAACAAGTACTGGATGAAGATTGGTTGCCCTAG

Protein

MVAELRKTNTSLYETDYNLWILETVQKLQCRDLENLDWEYLIEEVLSLSRRDRHKLASLLTRLFEHLLKLGYWHSEKERNRNHWRREIRNFRLQIDRLLSDSPSLKPYLSEIFDKCYKNGISLASDSSGLSIENFPEQPIATFEQVLDEDWLP