Your browser is old and dusty. Try Google Chrome!

Details for slr1803

ORF slr1803
Accession NP_441048.1
Symbol
Category adenine-specific DNA methylase
Definition DNA replication, restriction, modification, recombination, and repair
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -18 -37 -0.688862 0.27
NP_440795.1_7 Forward -134 -127 14.6904 0.0123
NP_440795.1_7 Reverse -127 -134 14.6904 0.0123
NP_441418.1_6 Reverse -126 -145 -21.6334 0.156
NP_441418.1_6 Forward -135 -116 -30.1882 0.262
NP_442291.1_5 Reverse -125 -141 6.54838 0.0694
NP_442291.1_5 Forward -123 -107 -4.36636 0.272
NP_441453.1_4 Reverse -126 -134 16.539 0.00633
NP_441453.1_4 Forward -135 -127 16.539 0.00633
NP_441453.1_7 Reverse -108 -115 12.1338 0.295
NP_441453.1_8 Reverse -106 -123 6.72535 0.288
NP_441623.1_1 Forward -116 -98 -0.964162 0.239
NP_442151.1_6 Reverse -239 -253 15.3392 0.0238
NP_442151.1_6 Forward -248 -234 10.816 0.114
NP_441818.1_1 Reverse -127 -138 16.7744 0.0118
NP_441818.1_1 Forward -134 -123 9.30127 0.246
NP_441818.1_9 Forward -248 -229 -3.83545 0.232
NP_440226.1_1 Forward -135 -116 5.89931 0.142
NP_441630.1_3 Forward -143 -124 5.80098 0.136
NP_441630.1_3 Forward -346 -327 -0.4922 0.288
NP_440150.1_2 Reverse -41 -60 5.2102 0.276
NP_442655.1_1 Reverse -121 -140 -0.000545616 0.242
NP_442173.1_1 Forward -134 -126 15.4574 0.00633
NP_442173.1_1 Reverse -127 -135 15.4574 0.00633
NP_442752.1_4 Forward -135 -128 13.8055 0.0199
NP_442752.1_4 Reverse -126 -133 13.8055 0.0199
NP_442752.1_4 Reverse -345 -352 7.90559 0.144
NP_442752.1_4 Reverse -113 -120 5.54565 0.194
NP_443027.1_4 Reverse -124 -134 11.8781 0.0872
NP_443027.1_4 Forward -28 -18 7.74818 0.235
NP_441812.1_3 Forward -249 -235 11.701 0.21
NP_442975.1_10 Forward -126 -112 3.44058 0.259
NP_440784.1_7 Forward -134 -127 15.9687 0.0123
NP_440784.1_7 Reverse -127 -134 15.9687 0.0123
NP_440784.1_7 Reverse -240 -247 5.84064 0.248
NP_440061.1_9 Reverse -124 -138 13.4703 0.0811
NP_441476.1_5 Forward -309 -290 -6.09707 0.273
NP_442062.1_8 Forward -135 -125 19.4496 0.000558
NP_442062.1_8 Reverse -126 -136 17.6796 0.00193
NP_441900.1_1 Reverse -294 -313 9.20147 0.3
NP_441859.1_3 Reverse -125 -144 14.2566 0.0715
NP_440304.1_4 Forward -137 -127 9.91146 0.051
NP_440304.1_4 Reverse -124 -134 1.84832 0.299
NP_442242.1_4 Forward -134 -127 14.3954 0.0124
NP_442242.1_4 Reverse -127 -134 14.3954 0.0124
NP_440044.1_8 Reverse -127 -146 0.196116 0.203
NP_441581.1_6 Reverse -117 -136 9.87422 0.29
NP_441161.1_3 Reverse -120 -138 11.1305 0.211
NP_441208.1_9 Forward -251 -237 6.78443 0.229
NP_441208.1_9 Forward -63 -49 5.89945 0.259
NP_441083.1_5 Reverse -126 -136 19.3512 0.000718
NP_441083.1_5 Forward -135 -125 11.3864 0.0159
NP_441434.1_7 Forward -133 -119 14.6509 0.0961
NP_441738.1_2 Forward -133 -126 15.28 0.0102
NP_441738.1_2 Reverse -128 -135 15.28 0.0102
NP_441558.1_5 Forward -137 -118 6.68596 0.206
NP_440209.1_1 Reverse -126 -134 18.1123 0.00295
NP_440209.1_1 Forward -135 -127 18.1123 0.00295
NP_441444.1_1 Forward -58 -39 2.65439 0.295
NP_442765.1_6 Forward -136 -117 13.6675 0.287
NP_442889.1_8 Reverse -123 -137 5.30886 0.231
NP_442889.1_8 Forward -138 -124 3.14559 0.287
NP_440447.1_5 Forward -46 -36 16.598 0.277
NP_440447.1_5 Reverse -35 -45 16.598 0.277
NP_441716.1_1 Reverse -126 -140 5.99778 0.208
NP_441716.1_2 Forward -372 -353 0.388829 0.264
NP_441163.1_1 Forward -346 -329 8.88789 0.226
NP_440906.1_5 Forward -134 -127 15.8704 0.0124
NP_440906.1_5 Reverse -127 -134 15.8704 0.0124
NP_440747.1_10 Forward -138 -126 7.4138 0.00422
NP_440747.1_10 Reverse -123 -135 7.31547 0.00577
NP_440747.1_10 Forward -237 -225 -11.7607 0.142
NP_441130.1_10 Reverse -124 -138 18.5841 0.0133
NP_441130.1_10 Forward -137 -123 15.8309 0.0282
NP_441486.1_1 Reverse -123 -137 5.21113 0.0384
NP_441486.1_1 Forward -138 -124 -4.32697 0.194
NP_442634.1_4 Forward -137 -123 -3.24533 0.161
NP_440403.1_4 Reverse -117 -136 2.94938 0.126
NP_440842.1_6 Reverse -61 -80 12.88 0.241
NP_441014.1_10 Reverse -16 -35 0.195343 0.245
NP_442848.1_5 Forward -311 -293 -2.0458 0.278
NP_443018.1_3 Forward -134 -127 14.8871 0.0123
NP_443018.1_3 Reverse -127 -134 14.8871 0.0123
NP_441634.1_6 Forward -307 -288 22.9106 0.0341
NP_441634.1_8 Forward -137 -123 5.40779 0.114
NP_441634.1_8 Forward -236 -222 4.91614 0.114
NP_441634.1_8 Reverse -124 -138 -4.52363 0.295
NP_440376.1_1 Forward -135 -126 19.4693 0.000692
NP_440376.1_1 Reverse -126 -135 19.4693 0.000692
NP_440376.1_1 Forward -61 -52 0.688044 0.262
NP_441857.1_5 Reverse -119 -137 8.57394 0.185
NP_441588.1_4 Forward -133 -123 7.05986 0.178
NP_442687.1_7 Forward -136 -126 18.5646 0.0028
NP_442687.1_7 Reverse -125 -135 15.8113 0.0125
NP_442687.1_7 Reverse -51 -61 5.28991 0.211
NP_440066.1_5 Forward -346 -327 20.5498 0.132
NP_442485.1_3 Forward -146 -127 -5.80207 0.296
NP_441422.1_7 Forward -114 -97 -6.05768 0.248
NP_441950.1_7 Forward -155 -136 -7.4737 0.278
NP_441950.1_8 Forward -235 -221 16.0275 0.0987
NP_442658.1_1 Reverse -124 -134 17.0891 0.00615
NP_442658.1_1 Forward -137 -127 16.0075 0.00966
NP_440141.1_8 Forward -184 -165 5.40766 0.275
NP_442782.1_2 Reverse -52 -66 7.66941 0.202
NP_442782.1_2 Forward -65 -51 1.27789 0.281
NP_442205.1_9 Reverse -233 -249 -3.8747 0.297
NP_440656.1_8 Forward -292 -273 -6.49039 0.245
NP_441414.1_7 Reverse -290 -309 9.43923 0.297
NP_441414.1_9 Forward -135 -116 -4.6221 0.158
NP_441487.1_9 Forward -62 -43 0.0977854 0.239
NP_441256.1_2 Forward -64 -45 6.88262 0.245
NP_441958.1_5 Forward -136 -126 20.5312 0.000966
NP_441958.1_5 Reverse -125 -135 12.2714 0.00183
NP_441127.1_1 Reverse -342 -356 13.8643 0.164
NP_442836.1_5 Forward -141 -122 7.27595 0.168
NP_442836.1_5 Reverse -120 -139 2.94938 0.248
NP_439905.1_1 Forward -134 -121 10.934 0.204
NP_439905.1_1 Forward -239 -226 9.85238 0.216
NP_440984.1_7 Forward -236 -222 11.8976 0.122
NP_440984.1_7 Reverse -121 -135 9.2427 0.129
NP_440984.1_7 Forward -140 -126 5.30946 0.259
NP_439990.1_5 Reverse -121 -134 9.2624 0.147
NP_442911.1_2 Reverse -116 -135 -2.16383 0.0946
NP_442911.1_2 Forward -145 -126 -9.63698 0.26
NP_440153.1_5 Forward -247 -233 3.04785 0.219
NP_443055.1_6 Forward -248 -230 2.57501 0.206
NP_443055.1_6 Forward -143 -125 2.18168 0.218
NP_440602.1_2 Forward -70 -51 9.14423 0.195
NP_442002.1_9 Forward -136 -129 14.1004 0.074
NP_442002.1_9 Reverse -125 -132 10.7572 0.185
NP_442598.1_2 Reverse -206 -215 14.2577 0.252
NP_441294.1_7 Forward -139 -125 9.05865 0.263
NP_441294.1_7 Reverse -235 -249 8.96266 0.269
NP_440106.1_2 Forward -254 -236 9.26226 0.298
NP_441646.1_1 Reverse -133 -152 1.0811 0.237
NP_442438.1_10 Reverse -231 -245 -0.295402 0.256
NP_442231.1_5 Reverse -24 -43 16.2241 0.263
NP_441000.1_6 Forward -136 -122 15.6342 0.0396
NP_441000.1_6 Reverse -125 -139 13.2743 0.0396
NP_441674.1_6 Forward -309 -290 3.34271 0.27
NP_440147.1_4 Reverse -124 -137 17.9155 0.00539
NP_440147.1_4 Forward -137 -124 16.9322 0.00906
NP_441175.1_7 Reverse -225 -244 4.916 0.294
NP_441550.1_8 Forward -137 -127 18.1707 0.00754
NP_441550.1_8 Reverse -124 -134 8.82935 0.112
NP_441550.1_8 Reverse -237 -247 6.66608 0.198
NP_441916.1_7 Forward -135 -125 18.4663 0.00144
NP_441916.1_7 Reverse -126 -136 16.893 0.00407
NP_441041.1_4 Reverse -239 -258 -13.0786 0.28
NP_441041.1_7 Forward -138 -126 20.245 0.00277
NP_441041.1_7 Reverse -123 -135 17.9128 0.00663
NP_440569.1_7 Forward -357 -338 8.75091 0.286
NP_441725.1_5 Reverse -127 -137 11.7798 0.0247
NP_441725.1_5 Forward -134 -124 2.04498 0.115
NP_439966.1_7 Reverse -124 -134 17.9741 0.00631
NP_439966.1_7 Forward -137 -127 8.63269 0.132
NP_439966.1_9 Reverse -124 -133 0.884706 0.253
NP_442941.1_3 Forward -134 -124 10.7964 0.0116
NP_442941.1_3 Reverse -127 -137 10.6981 0.0116
NP_440289.1_2 Reverse -123 -136 23.5204 0.00258
NP_440289.1_2 Forward -138 -125 15.2606 0.0107
NP_440983.1_5 Forward -357 -338 -9.047 0.3
NP_441514.1_1 Reverse -306 -316 16.4459 0.274
NP_442281.1_1 Forward -140 -126 20.9434 0.00192
NP_442281.1_1 Reverse -121 -135 10.6187 0.0562
NP_442281.1_1 Reverse -47 -61 2.35894 0.269
NP_442256.1_2 Reverse -124 -142 -0.472507 0.14
NP_001035871.2_7 Forward -63 -53 14.9263 0.171
NP_440437.1_1 Reverse -120 -139 -0.000545616 0.173
NP_440437.1_1 Reverse -230 -249 -5.9004 0.296
NP_442012.1_1 Forward -345 -326 -1.67217 0.294
NP_441644.1_6 Reverse -126 -136 15.7125 0.0048
NP_441644.1_6 Forward -135 -125 10.1076 0.0628
NP_441644.1_6 Forward -248 -238 4.30615 0.242
NP_442215.1_2 Reverse -237 -253 10.6783 0.0467
NP_442215.1_2 Reverse -223 -239 0.55019 0.15
NP_442029.1_6 Forward -309 -290 4.916 0.259
NP_440253.1_2 Reverse -126 -144 9.16393 0.0507
NP_440253.1_2 Forward -135 -117 3.46073 0.116
NP_440253.1_2 Reverse -52 -70 -0.374176 0.209
NP_440929.1_8 Forward -135 -126 19.2726 0.000701
NP_440929.1_8 Reverse -126 -135 19.2726 0.000701
NP_442933.1_10 Forward -135 -126 17.601 0.00325
NP_442933.1_10 Reverse -126 -135 17.601 0.00325
NP_441751.2_8 Reverse -127 -141 3.44117 0.0661
NP_441751.2_8 Forward -134 -120 1.67122 0.101
NP_442554.1_8 Reverse -127 -137 15.123 0.00944
NP_442554.1_8 Forward -134 -124 14.1397 0.0144
NP_441762.1_7 Forward -136 -124 11.5437 0.0142
NP_441762.1_7 Reverse -125 -137 2.30059 0.0676
NP_442142.1_4 Forward -138 -125 14.4733 0.0311
NP_442142.1_4 Reverse -123 -136 7.19687 0.144
NP_442142.1_4 Forward -348 -335 3.65697 0.248
NP_442142.1_4 Forward -357 -344 3.26365 0.262
NP_442292.1_1 Forward -134 -125 9.63616 0.0183
NP_442292.1_1 Reverse -127 -136 9.53783 0.0183
NP_442476.1_6 Forward -134 -120 3.44117 0.156
NP_442381.1_8 Reverse -123 -142 13.7658 0.0192
NP_443009.1_5 Forward -136 -125 20.6093 0.001
NP_443009.1_5 Reverse -125 -136 9.10461 0.0965
NP_441715.1_4 Forward -134 -124 18.8596 0.00741
NP_441715.1_4 Reverse -127 -137 9.81313 0.097
NP_440183.1_9 Forward -352 -333 -14.3569 0.264
NP_440379.1_5 Forward -249 -230 -9.24366 0.262
NP_441468.1_1 Forward -134 -127 15.8704 0.0124
NP_441468.1_1 Reverse -127 -134 15.8704 0.0124
NP_441020.2_6 Reverse -124 -141 10.1669 0.151
NP_441015.1_10 Reverse -234 -253 -5.9004 0.235
NP_441673.1_1 Forward -135 -126 20.8459 0.000698
NP_441673.1_1 Reverse -126 -135 20.8459 0.000698
NP_441731.1_3 Reverse -114 -133 -3.44213 0.284
NP_441876.1_9 Reverse -334 -344 10.5993 0.287
NP_441826.1_5 Forward -43 -24 1.0811 0.297
NP_441330.1_1 Forward -260 -241 -15.3402 0.275
NP_442868.1_6 Forward -137 -127 18.5646 0.0104
NP_442868.1_6 Reverse -124 -134 10.3048 0.038
NP_442719.1_2 Forward -60 -42 5.52492 0.137
NP_442427.1_8 Reverse -117 -136 8.16093 0.203
NP_442808.1_1 Reverse -125 -135 18.4657 0.00201
NP_442808.1_1 Forward -136 -126 8.73102 0.0481
NP_441101.1_7 Forward -130 -111 11.9958 0.29
NP_440145.1_3 Forward -71 -52 -5.40875 0.267
NP_442542.1_2 Reverse -124 -137 15.4572 0.0832
NP_442542.1_2 Forward -137 -124 8.57408 0.154
NP_442050.1_5 Forward -137 -127 13.6475 0.0295
NP_442050.1_5 Reverse -124 -134 6.96107 0.27
NP_441048.1_4 Forward -345 -326 22.4189 0.0926
NP_441048.1_6 Forward -361 -347 17.9641 0.296
NP_441048.1_7 Forward -221 -207 17.3052 0.272
NP_441878.1_6 Forward -136 -126 20.2362 0.0046
NP_441878.1_6 Reverse -125 -135 10.4031 0.0176
NP_441036.1_8 Reverse -125 -135 17.7779 0.000554
NP_441036.1_8 Forward -136 -126 8.4365 0.174
NP_441036.1_8 Forward -140 -130 5.68323 0.265
NP_441557.1_5 Forward -135 -126 19.9609 0.000699
NP_441557.1_5 Reverse -126 -135 19.9609 0.000699
NP_441557.1_8 Forward -351 -341 10.4026 0.289
NP_441445.1_1 Reverse -117 -136 1.27776 0.259
NP_441445.1_1 Forward -144 -125 -0.000545616 0.283
NP_442066.2_9 Reverse -122 -135 18.2105 0.0209
NP_440101.1_3 Reverse -234 -253 2.75272 0.246
NP_441458.1_10 Reverse -117 -136 1.17943 0.297
NP_442183.1_1 Reverse -126 -140 9.5377 0.0966
NP_442183.1_1 Forward -135 -121 4.62115 0.254
NP_440440.1_1 Forward -308 -289 11.405 0.168
NP_440058.1_6 Reverse -293 -312 3.83436 0.291
NP_442347.1_2 Forward -134 -125 11.1111 0.056
NP_442347.1_2 Forward -121 -112 9.4395 0.0691
NP_442347.1_2 Reverse -127 -136 3.34298 0.284
NP_441037.1_4 Forward -137 -127 9.55921 0.21
NP_441037.1_4 Reverse -124 -134 6.92787 0.237
NP_442317.1_6 Reverse -121 -140 13.4708 0.158
NP_441633.1_3 Reverse -124 -137 15.1623 0.0109
NP_441633.1_3 Forward -137 -124 3.65753 0.0699
NP_441633.1_3 Forward -127 -114 -0.0790467 0.138
NP_441633.1_3 Forward -250 -237 -3.4223 0.177
NP_440136.1_2 Forward -134 -127 15.9687 0.0123
NP_440136.1_2 Reverse -127 -134 15.9687 0.0123
NP_442998.1_10 Forward -133 -126 15.5754 0.0102
NP_442998.1_10 Reverse -128 -135 15.5754 0.0102
NP_440731.1_2 Forward -260 -241 4.71934 0.293
NP_440899.1_8 Reverse -1 -20 -6.1954 0.231
NP_440899.1_8 Reverse -321 -340 -6.29373 0.231
NP_441799.1_1 Forward -139 -125 14.8469 0.0221
NP_441799.1_1 Reverse -122 -136 5.70218 0.197
NP_442802.1_2 Reverse -326 -345 13.9616 0.223
NP_441007.1_10 Forward -140 -127 0.707601 0.219
NP_440256.1_1 Reverse -123 -142 4.42435 0.0442
NP_440256.1_1 Forward -138 -119 4.22769 0.0459
NP_441559.1_8 Reverse -121 -135 3.44117 0.143
NP_441559.1_8 Forward -130 -116 1.96621 0.151
NP_441559.1_8 Forward -55 -41 1.17956 0.156
NP_441559.1_8 Forward -66 -52 -7.08024 0.283
NP_440915.1_6 Reverse -122 -136 11.3077 0.0263
NP_440915.1_6 Forward -139 -125 3.63784 0.101
NP_441464.1_1 Reverse -99 -118 8.45592 0.259
NP_441464.1_8 Reverse -126 -140 8.16106 0.2
NP_442993.1_1 Forward -135 -119 -0.236458 0.071
NP_442386.1_9 Reverse -125 -134 15.7322 0.0144
NP_442386.1_9 Forward -136 -127 6.39082 0.219
NP_441750.1_1 Forward -303 -284 -8.752 0.3
NP_441750.1_1 Forward -309 -290 -10.817 0.3
NP_441340.1_5 Forward -134 -127 15.6737 0.0124
NP_441340.1_5 Reverse -127 -134 15.6737 0.0124
NP_442186.1_9 Reverse -42 -61 4.81767 0.258
NP_440161.1_3 Reverse -124 -143 20.4523 0.0516
NP_440161.1_3 Forward -137 -118 14.3558 0.121
NP_441160.1_1 Forward -347 -328 -11.6036 0.295
NP_440586.1_8 Forward -134 -127 13.2151 0.026
NP_440586.1_8 Reverse -127 -134 13.2151 0.026
NP_440586.1_8 Forward -25 -18 8.88855 0.205
NP_442251.1_6 Forward -134 -127 15.2804 0.0124
NP_442251.1_6 Reverse -127 -134 15.2804 0.0124
NP_441262.1_3 Reverse -126 -133 14.7888 0.0223
NP_441262.1_3 Forward -135 -128 14.7888 0.0223
NP_440027.1_3 Reverse -116 -134 8.27817 0.195
NP_440027.1_3 Forward -354 -336 2.37835 0.29
NP_443051.1_1 Forward -136 -127 18.0926 0.00402
NP_443051.1_1 Reverse -125 -134 10.4228 0.00754
NP_440451.1_2 Reverse -333 -352 17.994 0.243
NP_441232.1_2 Reverse -342 -361 7.37428 0.273
NP_439937.1_9 Forward -136 -119 -16.4814 0.287
NP_439937.1_9 Reverse -125 -142 -16.5797 0.287
NP_443039.1_7 Reverse -160 -174 5.1122 0.241
NP_443039.1_7 Reverse -361 -375 3.93223 0.278
NP_440439.1_1 Reverse -123 -136 12.2123 0.0269
NP_440439.1_1 Forward -138 -125 2.08423 0.138
NP_440372.1_2 Forward -134 -127 16.3621 0.0124
NP_440372.1_2 Reverse -127 -134 16.3621 0.0124
NP_441789.1_7 Reverse -290 -309 -1.37794 0.251
NP_442722.1_3 Forward -208 -189 10.9142 0.215
NP_440819.1_5 Forward -364 -356 7.68924 0.266
NP_439977.1_5 Reverse -120 -139 0.884433 0.199
NP_439977.1_5 Forward -345 -326 -2.55715 0.284
NP_440139.1_1 Forward -141 -122 9.43841 0.0992
NP_440267.1_2 Forward -140 -126 19.3701 0.0198
NP_442384.1_10 Forward -135 -122 9.95071 0.047
NP_442384.1_10 Forward -122 -109 6.50913 0.0995
NP_442384.1_10 Reverse -126 -139 5.13249 0.137
NP_442114.1_4 Forward -135 -124 9.20345 0.17
NP_442790.1_4 Reverse -117 -136 -6.68705 0.144
NP_442790.1_4 Forward -144 -125 -8.35868 0.168
NP_442262.1_10 Forward -134 -127 14.1988 0.0123
NP_442262.1_10 Reverse -127 -134 14.1988 0.0123
NP_440163.1_10 Forward -29 -19 9.51814 0.232
NP_440344.1_10 Forward -142 -125 6.03703 0.0191
NP_440344.1_10 Reverse -119 -136 -7.63097 0.118
NP_440531.1_6 Reverse -118 -137 8.84924 0.0844
NP_442123.1_3 Reverse -126 -145 13.0775 0.181
NP_441060.1_1 Reverse -342 -361 18.3173 0.123
NP_442832.1_3 Forward -61 -42 13.9625 0.248
NP_441965.1_10 Forward -138 -122 5.17175 0.216
NP_442556.1_7 Reverse -236 -255 8.75091 0.272
NP_440297.1_9 Reverse -127 -137 9.61647 0.0917
NP_440297.1_9 Forward -134 -124 -0.118297 0.282
NP_440350.1_1 Reverse -220 -239 -5.11376 0.272
NP_441896.1_3 Reverse -117 -136 12.4875 0.0789
NP_440999.1_9 Reverse -122 -136 15.6342 0.0243
NP_440999.1_9 Reverse -221 -235 4.91614 0.114
NP_440888.1_2 Forward -135 -121 13.8636 0.0231
NP_440888.1_2 Reverse -126 -140 5.99717 0.254
NP_440888.1_2 Forward -351 -337 5.70218 0.267
NP_442147.1_6 Reverse -50 -64 15.7319 0.232
NP_440491.1_1 Reverse -222 -241 11.6924 0.165
NP_440491.1_1 Forward -125 -106 9.25599 0.218
NP_439969.1_3 Reverse -121 -140 4.12936 0.214
NP_442277.1_4 Forward -144 -125 7.37347 0.146
NP_442277.1_4 Reverse -117 -136 5.80018 0.172
NP_442033.1_10 Reverse -114 -133 -9.73531 0.221
NP_442807.1_9 Forward -373 -355 20.2896 0.132
NP_441543.1_2 Forward -134 -125 18.486 0.00236
NP_441543.1_2 Reverse -127 -136 9.34117 0.0818
NP_441469.1_8 Reverse -125 -134 16.126 0.00797
NP_441469.1_8 Forward -136 -127 13.3727 0.073
NP_443064.1_6 Reverse -126 -136 13.8273 0.0796
NP_442578.1_7 Forward -134 -127 14.5921 0.026
NP_442578.1_7 Reverse -127 -134 14.5921 0.026
NP_441462.1_2 Reverse -126 -136 20.1379 0.000967
NP_441462.1_2 Forward -135 -125 11.5831 0.00406
NP_441621.1_7 Forward -137 -123 -5.31028 0.25
NP_443062.1_6 Reverse -118 -137 19.6656 0.0432
NP_443062.1_6 Forward -143 -124 11.5042 0.103
NP_441410.1_3 Forward -144 -125 16.6174 0.121
NP_440519.1_8 Forward -81 -65 3.69678 0.244
NP_442204.1_5 Reverse -335 -354 2.85105 0.204
NP_442204.1_5 Reverse -116 -135 0.491109 0.261
NP_441351.1_8 Forward -347 -328 6.39097 0.202
NP_441351.1_8 Forward -28 -9 -0.0988766 0.293
NP_440516.1_2 Reverse -120 -138 6.01734 0.122
NP_440516.1_8 Forward -135 -126 16.9127 0.00442
NP_440516.1_8 Reverse -126 -135 16.9127 0.00442
NP_442428.1_5 Forward -134 -127 15.8704 0.0124
NP_442428.1_5 Reverse -127 -134 15.8704 0.0124
NP_440673.1_3 Forward -133 -126 12.4288 0.0426
NP_440673.1_3 Reverse -128 -135 12.4288 0.0426
NP_440673.1_3 Reverse -19 -26 10.9539 0.106
NP_441052.1_2 Reverse -239 -249 11.5831 0.0285
NP_441052.1_2 Forward -135 -125 10.5014 0.0285
NP_441052.1_2 Reverse -126 -136 10.4031 0.0285
NP_441052.1_2 Forward -248 -238 1.94665 0.221
NP_442219.1_8 Reverse -7 -26 7.39404 0.267
NP_442219.1_9 Forward -134 -125 8.35786 0.0681
NP_442219.1_9 Reverse -127 -136 8.25953 0.0681
NP_442219.1_9 Forward -121 -112 1.86802 0.295
NP_440436.1_4 Forward -134 -125 18.1905 0.00233
NP_440436.1_4 Reverse -127 -136 15.9289 0.00508
NP_441884.1_9 Forward -357 -338 -19.6667 0.155
NP_441884.1_9 Reverse -97 -116 -22.6167 0.281
NP_441884.1_9 Reverse -222 -241 -23.305 0.284
NP_441884.1_9 Reverse -123 -142 -23.9933 0.284
NP_441884.1_9 Forward -138 -119 -24.8783 0.29
NP_441893.1_10 Forward -305 -286 15.2408 0.156
NP_442414.1_9 Reverse -289 -308 10.6192 0.292
NP_439982.1_5 Forward -137 -118 14.4541 0.194
NP_441719.1_2 Reverse -2 -16 13.925 0.278
NP_441719.1_4 Forward -134 -127 16.3621 0.0124
NP_441719.1_4 Reverse -127 -134 16.3621 0.0124
NP_441733.1_10 Forward -138 -125 9.55739 0.113
NP_441733.1_10 Reverse -123 -136 8.37742 0.14
NP_440746.1_10 Forward -354 -335 16.0274 0.106
NP_442366.1_3 Reverse -125 -143 7.00065 0.0772
NP_440129.1_10 Forward -142 -128 11.3077 0.113
NP_440328.1_4 Forward -254 -235 8.65258 0.111
NP_443054.1_2 Forward -137 -123 12.4876 0.0722
NP_443054.1_2 Reverse -124 -138 8.65272 0.114
NP_441851.1_10 Forward -136 -126 17.4829 0.0027
NP_441851.1_10 Reverse -125 -135 16.008 0.00552
NP_441851.1_10 Reverse -177 -187 6.37155 0.172
NP_442622.1_8 Reverse -126 -144 -19.0571 0.296
NP_442856.1_7 Reverse -336 -355 -1.08219 0.216
NP_442515.1_1 Forward -136 -122 4.22782 0.108
NP_442515.1_1 Reverse -125 -139 3.8345 0.112
NP_440593.1_3 Reverse -290 -309 -4.13045 0.245
NP_441982.1_6 Forward -219 -210 14.9681 0.274
NP_440165.1_5 Reverse -125 -144 -7.57203 0.27
NP_441046.1_2 Forward -377 -358 0.0977854 0.271
NP_440940.1_7 Reverse -116 -134 3.55831 0.274
NP_441349.1_10 Forward -145 -126 -8.85033 0.279
NP_441409.1_6 Reverse -120 -139 -14.4552 0.257
NP_440432.1_9 Reverse -127 -142 16.8928 0.00961
NP_440432.1_9 Forward -134 -119 -3.65835 0.187
NP_441477.1_4 Forward -342 -323 17.2074 0.28
NP_442450.1_5 Forward -137 -127 10.0098 0.115
NP_442006.1_2 Reverse -336 -353 -14.7108 0.208
NP_442006.1_2 Forward -183 -166 -15.6941 0.228
NP_440483.1_1 Forward -352 -333 -0.0988766 0.199
NP_441570.1_1 Forward -248 -230 -12.0756 0.208
NP_441078.1_4 Forward -135 -126 19.6659 0.0007
NP_441078.1_4 Reverse -126 -135 19.6659 0.0007
NP_441078.1_4 Forward -248 -239 -1.96689 0.282
NP_440526.1_3 Reverse -127 -138 10.9729 0.0646
NP_440526.1_3 Forward -134 -123 2.02482 0.267
NP_441432.1_8 Forward -136 -127 8.35786 0.0755
NP_441432.1_8 Reverse -125 -134 8.25953 0.0755
NP_443024.1_3 Forward -177 -167 14.238 0.255
NP_442320.1_8 Forward -141 -127 -4.22864 0.151
NP_441732.1_2 Reverse -232 -248 -16.5594 0.174
NP_442447.1_2 Reverse -114 -133 23.3039 0.0364
NP_440760.1_1 Forward -135 -116 -15.1435 0.142
NP_442797.1_6 Forward -246 -227 6.86764 0.299
NP_442274.1_8 Reverse -28 -46 14.715 0.286
NP_440578.1_7 Forward -64 -45 15.7316 0.198
NP_441057.1_4 Forward -55 -37 1.69077 0.253
NP_442353.1_4 Forward -350 -331 11.2084 0.0983
NP_442751.1_8 Forward -62 -44 20.2753 0.153
NP_440713.1_4 Reverse -338 -357 8.16093 0.172
NP_442489.1_7 Forward -135 -126 20.1576 0.000695
NP_442489.1_7 Reverse -126 -135 20.1576 0.000695
NP_442489.1_7 Forward -248 -239 -1.6719 0.235
NP_440559.1_1 Reverse -127 -136 17.306 0.00658
NP_440559.1_1 Forward -134 -125 8.75118 0.0586
NP_442763.1_8 Forward -274 -255 9.3409 0.142
NP_441659.2_8 Reverse -126 -136 19.3512 0.000966
NP_441659.2_8 Forward -135 -125 11.9764 0.0147
NP_440426.1_7 Reverse -226 -245 2.55606 0.207
NP_442749.1_5 Reverse -183 -200 9.95902 0.198
NP_442913.1_10 Forward -257 -238 5.01433 0.0796
NP_442913.1_10 Reverse -230 -249 -1.27885 0.168
NP_442913.1_10 Forward -144 -125 -4.81876 0.248
NP_441040.1_2 Forward -62 -43 -16.0285 0.292
NP_440779.1_5 Reverse -126 -143 13.1169 0.0254
NP_442346.1_5 Forward -136 -126 17.9746 0.00128
NP_442346.1_5 Reverse -125 -135 9.02648 0.118
NP_442346.1_5 Forward -249 -239 8.1415 0.146
NP_442346.1_5 Reverse -238 -248 7.35486 0.172
NP_442346.1_10 Reverse -284 -303 -3.54046 0.294
NP_440545.1_3 Forward -139 -122 -5.07437 0.24
NP_440459.1_2 Forward -336 -319 13.0185 0.131
NP_441888.1_7 Reverse -290 -304 8.25939 0.199
NP_441888.1_7 Reverse -121 -135 2.45787 0.225
NP_441888.1_7 Forward -140 -126 2.35953 0.225
NP_441948.1_4 Forward -142 -124 15.2604 0.0267
NP_441948.1_4 Reverse -119 -137 7.78729 0.0623
NP_441948.1_4 Reverse -325 -343 -4.8974 0.246
NP_440170.1_6 Forward -339 -320 12.0942 0.283
NP_441833.1_4 Forward -134 -127 15.9687 0.0124
NP_441833.1_4 Reverse -127 -134 15.9687 0.0124
NP_442162.1_9 Forward -134 -127 16.2637 0.0124
NP_442162.1_9 Reverse -127 -134 16.2637 0.0124
NP_440671.1_4 Forward -161 -147 5.60446 0.279
NP_442199.1_5 Forward -143 -124 -7.17871 0.288
NP_442140.1_3 Forward -134 -124 14.238 0.0486
NP_442140.1_3 Reverse -127 -137 11.5831 0.0743
NP_442723.1_1 Reverse -280 -299 5.11187 0.276
NP_440875.1_9 Forward -133 -123 16.6457 0.0145
NP_440875.1_9 Reverse -128 -138 7.59334 0.255
NP_441813.1_5 Reverse -124 -134 19.4496 0.00647
NP_441813.1_5 Forward -137 -127 18.3679 0.00743
NP_440590.1_4 Forward -134 -121 13.9823 0.0112
NP_440590.1_4 Forward -121 -108 -0.964025 0.206
NP_440590.1_4 Reverse -127 -140 -4.20895 0.258
NP_442497.1_10 Reverse -127 -136 19.8626 0.00532
NP_442497.1_10 Forward -134 -125 10.4228 0.0087
NP_440821.1_4 Forward -137 -127 10.9931 0.0146
NP_440821.1_4 Reverse -124 -134 10.2065 0.0163
NP_440227.1_2 Reverse -206 -222 8.22001 0.29
NP_441239.1_9 Reverse -124 -136 17.7386 0.0146
NP_441239.1_9 Forward -137 -125 15.1819 0.0229
NP_440706.1_1 Forward -139 -120 -2.75381 0.258
NP_441892.1_1 Forward -144 -127 0.628827 0.165
NP_441892.1_1 Forward -347 -330 -1.92778 0.215
NP_440665.1_1 Forward -357 -338 -14.5535 0.262
NP_442044.1_1 Reverse -231 -250 -14.4552 0.291
NP_442193.1_1 Reverse -330 -348 9.36059 0.245
NP_442643.1_3 Reverse -46 -65 2.75272 0.157
NP_440354.1_5 Forward -320 -301 4.71934 0.211
NP_441617.1_6 Forward -60 -41 -6.29373 0.28
NP_442052.1_8 Reverse -43 -53 13.0581 0.253
NP_440546.1_4 Reverse -126 -136 12.8578 0.0572
NP_440546.1_4 Forward -135 -125 11.8882 0.0679
NP_441230.1_3 Forward -137 -118 11.2092 0.145
NP_441230.1_7 Reverse -47 -66 19.469 0.197
NP_440462.1_6 Reverse -124 -134 17.2863 0.00752
NP_440462.1_6 Forward -137 -127 9.7148 0.0429
NP_442340.1_3 Forward -52 -33 -6.78538 0.225
NP_440868.1_4 Reverse -122 -134 12.6253 0.0235
NP_440868.1_4 Forward -139 -127 1.12062 0.192
NP_441084.1_6 Reverse -54 -68 11.865 0.185
NP_440696.1_3 Reverse -285 -303 -1.45582 0.259
NP_442039.1_4 Forward -134 -127 15.1821 0.0124
NP_442039.1_4 Reverse -127 -134 15.1821 0.0124
NP_441811.1_8 Forward -128 -114 9.2427 0.227
NP_442679.1_1 Forward -376 -357 -5.01543 0.288
NP_442837.1_3 Forward -134 -127 15.7721 0.0124
NP_442837.1_3 Reverse -127 -134 15.7721 0.0124
NP_440160.1_9 Reverse -51 -70 14.5524 0.204
NP_439994.1_3 Forward -136 -117 13.6088 0.118
NP_442053.1_1 Forward -135 -126 18.3876 0.0007
NP_442053.1_1 Reverse -126 -135 18.3876 0.0007
NP_440505.1_3 Reverse -124 -134 15.9097 0.00857
NP_440505.1_3 Forward -137 -127 9.61647 0.122
NP_440505.1_3 Reverse -111 -121 6.66654 0.172
NP_441252.1_6 Forward -400 -393 14.1004 0.25
NP_441203.1_1 Forward -134 -115 -20.2567 0.297
NP_440914.1_1 Forward -135 -125 8.6151 0.186
NP_440914.1_1 Reverse -126 -136 8.51751 0.186
NP_441011.1_8 Forward -134 -125 16.9127 0.00602
NP_441011.1_8 Reverse -127 -136 14.356 0.0249
NP_442931.1_4 Forward -355 -336 10.0292 0.262
NP_442533.1_6 Forward -135 -126 17.2076 0.00137
NP_442533.1_6 Reverse -126 -135 17.2076 0.00137
NP_442533.1_6 Reverse -239 -248 5.11294 0.155
NP_442533.1_6 Forward -248 -239 3.83464 0.202
NP_442232.1_3 Forward -143 -124 -12.2919 0.282
NP_441482.1_7 Forward -141 -127 -2.75368 0.0997
NP_441482.1_7 Reverse -120 -134 -10.3252 0.209
NP_439944.1_9 Reverse -127 -137 8.82982 0.101
NP_441028.1_6 Forward -49 -39 10.1076 0.21
NP_441527.1_4 Forward -212 -193 -4.72727 0.188
NP_440115.1_6 Forward -138 -128 7.15819 0.158
NP_440115.1_6 Forward -341 -331 4.89658 0.28
NP_442492.1_2 Reverse -126 -145 4.52268 0.212
NP_441106.1_1 Reverse -125 -134 18.191 0.0028
NP_441106.1_1 Forward -136 -127 9.73449 0.0311
NP_440429.1_4 Reverse -232 -251 13.9625 0.25
NP_440646.1_1 Forward -34 -15 -1.37718 0.296
NP_442588.1_6 Forward -119 -100 0.294447 0.252
NP_442306.1_10 Reverse -121 -140 -11.5053 0.133
NP_441286.1_1 Reverse -125 -137 5.93884 0.0258
NP_441286.1_1 Forward -136 -124 -3.40261 0.145
NP_440670.1_8 Forward -135 -126 18.3876 0.000699
NP_440670.1_8 Reverse -126 -135 18.3876 0.000699
NP_440886.1_7 Reverse -125 -135 17.7774 0.0011
NP_440886.1_7 Forward -136 -126 8.04271 0.0805
NP_440886.1_7 Forward -352 -342 5.38779 0.185
NP_440828.1_1 Forward -352 -333 6.39016 0.199
NP_442614.1_2 Forward -135 -121 7.07942 0.275
NP_442717.1_4 Forward -281 -262 8.84924 0.186
NP_442072.1_9 Forward -136 -118 -13.4522 0.112
NP_442213.1_6 Reverse -321 -340 7.47261 0.246
NP_441753.1_10 Reverse -230 -249 4.916 0.193
NP_440907.2_8 Reverse -127 -137 9.91099 0.103
NP_440907.2_8 Forward -134 -124 7.94438 0.117
NP_441021.1_1 Reverse -127 -146 -8.45701 0.195
NP_441021.1_8 Forward -140 -122 15.1621 0.0857
NP_440841.1_4 Reverse -262 -281 -8.752 0.25
NP_442459.1_2 Reverse -259 -278 9.83255 0.229
NP_441463.1_3 Reverse -7 -26 -5.9004 0.235
NP_441463.1_3 Forward -145 -126 -7.4737 0.258
NP_441463.1_3 Reverse -229 -248 -7.86702 0.262
NP_441626.1_2 Forward -134 -127 15.7721 0.0124
NP_441626.1_2 Reverse -127 -134 15.7721 0.0124
NP_441589.1_5 Reverse -294 -313 21.5081 0.0311
NP_442615.1_1 Forward -144 -126 -1.45582 0.128
NP_442615.1_1 Reverse -117 -135 -5.68405 0.22
NP_441431.1_2 Reverse -123 -137 9.24208 0.19
NP_441431.1_2 Forward -138 -124 6.98048 0.255
NP_441836.1_2 Forward -56 -37 -6.49039 0.298
NP_440114.1_10 Reverse -126 -140 17.6992 0.00953
NP_440114.1_10 Forward -135 -121 13.5693 0.0531
NP_441510.2_7 Reverse -45 -59 15.5352 0.28
NP_440287.1_6 Reverse -237 -256 2.26107 0.247
NP_442743.1_4 Forward -134 -115 2.0644 0.171
NP_439910.1_2 Reverse -118 -135 -13.5308 0.162
NP_440457.1_1 Forward -139 -127 9.18376 0.0949
NP_440457.1_1 Reverse -122 -134 -0.74767 0.273
NP_440801.1_10 Reverse -109 -128 5.50599 0.289
NP_442509.1_9 Reverse -126 -136 17.3841 0.00128
NP_442509.1_9 Forward -135 -125 16.2041 0.00739
NP_440524.1_3 Forward -308 -289 9.0459 0.28
NP_440554.1_4 Forward -134 -124 16.4996 0.0189
NP_440554.1_4 Reverse -127 -137 8.82982 0.0646
NP_441885.1_5 Forward -135 -125 11.4848 0.00668
NP_441885.1_5 Reverse -126 -136 11.3864 0.00668
NP_440478.1_10 Reverse -124 -138 6.58777 0.288
NP_442341.1_7 Forward -136 -122 6.88276 0.116
NP_442341.1_7 Forward -355 -341 3.73617 0.214
NP_442341.1_9 Reverse -124 -138 10.1271 0.137
NP_441173.1_9 Reverse -391 -399 9.85212 0.275
NP_440409.1_1 Reverse -118 -137 -3.04881 0.254
NP_440423.1_6 Forward -143 -124 -4.32711 0.131
NP_443000.1_7 Forward -137 -127 11.6814 0.0344
NP_443000.1_7 Reverse -124 -134 11.5831 0.0344
NP_441842.1_10 Forward -142 -128 7.9644 0.238
NP_440275.1_3 Forward -137 -127 16.9913 0.0133
NP_440275.1_3 Reverse -124 -134 15.418 0.0178
NP_440091.1_1 Reverse -122 -134 3.18557 0.166
NP_440091.1_1 Forward -139 -127 1.41561 0.197
NP_442275.1_1 Forward -135 -116 6.19431 0.264
NP_443010.1_10 Reverse -123 -140 6.82941 0.179
NP_442451.1_2 Reverse -118 -137 8.94757 0.0767
NP_441122.1_1 Forward -58 -43 4.01147 0.28
NP_439962.1_4 Reverse -287 -306 -3.63879 0.256
NP_442495.1_3 Reverse -331 -349 9.26226 0.289
NP_440149.1_8 Forward -135 -116 -1.67217 0.162
NP_441105.1_3 Forward -146 -127 -2.16383 0.158
NP_440216.1_1 Reverse -126 -140 16.1259 0.00307
NP_440216.1_1 Forward -135 -121 8.35772 0.0061
NP_440216.1_1 Forward -245 -231 -12.3901 0.264
NP_440172.1_1 Reverse -126 -136 16.303 0.00854
NP_440172.1_1 Forward -135 -125 8.73149 0.0586
NP_440172.1_1 Forward -248 -238 2.14332 0.283
NP_442015.1_10 Forward -139 -126 3.75586 0.178
NP_442015.1_10 Forward -252 -239 3.36254 0.183
NP_442015.1_10 Reverse -122 -135 3.06754 0.185
NP_442015.1_10 Forward -129 -116 1.29759 0.206
NP_441226.1_7 Forward -134 -127 14.4934 0.0123
NP_441226.1_7 Reverse -127 -134 14.4934 0.0123
NP_441111.1_7 Forward -134 -126 18.7023 0.00294
NP_441111.1_7 Reverse -127 -135 18.7023 0.00294
NP_441766.1_2 Forward -135 -126 17.5026 0.00297
NP_441766.1_2 Reverse -126 -135 17.5026 0.00297
NP_442252.1_3 Forward -142 -124 18.997 0.0602
NP_440416.1_1 Reverse -126 -145 -12.7836 0.272
NP_440416.1_9 Forward -142 -123 -14.2585 0.174
NP_443052.1_8 Forward -145 -126 -1.08219 0.0772
NP_443052.1_9 Reverse -290 -309 9.43923 0.113
NP_440591.1_9 Forward -142 -124 8.37728 0.18
NP_442226.1_6 Forward -223 -204 19.8623 0.193
NP_440261.1_5 Forward -134 -121 4.93583 0.0478
NP_440261.1_5 Reverse -127 -140 -2.43899 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGTGCAAAATAAATTGGTACGCCAGGAAGTGTTAACGGAAAAAATGACCCTCACCGCCGGGGACAATCCACCGGAAGTGGACGTTAATTTGCCTCAGCAAGTGCAGGCGGGCCAAGAATTTGATTTCGATGTTGTCCTGCGTCAACCCATTGGTGATGACCTCCTGGCGGGCACAGCTTTTAGTCAAAAAATAGATCCTAATAACTACGTTGATCCTTCCCAGGTGAAATTGGAATTGTTACAGGCTGGTGGGCTATTCAAACGGGCGATCGCCGGTAATGATCCCCAGTGGTTGTCTGCCCTACTAGTTACTCCTGAAGGCATGGTATTGGTTACCCAGCGTTTGGCCGTTGTTCCCTAGGGAAACTGTAACAGCGATGAAAAAATCAGTCGGAGAAT

CDS

GTGAAAATTAAACAAGCTATTGCCAAACCCTTTCTGAAATGGGCTGGAGGTAAGGGAAAGTTAATTGAACAATTGGTTAATTGCTTCCCCTTAGAAATCACCACTGGTCAGTTAACTAAGTATGCTGAGCCTTTTATTGGTGGCGGGGCTTTGTACTTTCATGTTGCCCAAAATTATCCCCAGATAGAAAAATTCTTTATCTCCGACTGCAATCAGCAGTTAGTTTTGGCTTATCAGACTATTCAACAAAATGTTGATGATTTAATTGATTTTTTAAGACGGCTACAGCAGAAGTATTATTGTTTCAACCAAGATGAAAGAAAAGATTTTTTTTATCAGCAAAGACTAAAATTCAACCAGAATGTTACCGGAATAAATTTAGAAAAATTTAGTAAATTGTGGATAGAGCAAACTGGTCTGCTTATATTTTTAAATCGTACCTGTTTTAACGGCTTATTTCGAGTTAACTCTAAAGGAGAATTTAATGTACCCTTTGGGGATTATAAAAATCCTAAGATTTGCGATGCTGAGAATCTTAAGTTAGTAGCCAACTTACTTGCCAGAACAGAAATAAGATTTGGTGATTTTACTTCGAGTAATAACTTCATTGATGCATCCACCTTTGTTTATTTTGACCCGCCCTATCGTCCCTTAAATAAAACCTCCAGCTTTAACTCCTATGGTAAAGCGAACTTCAATGATAATGAGCAATTGAGGTTAGCTGAATATTACCAATCACTCAATAACAAAAACGCTAAGTTGATGTTGAGCAATTCCGATCCGAAAAATATTAATAGCGACGATAACTTTTTTGATGATTTATATCGGGGTTTTCAAATTGCTCGGATCGATGCCCTCCGTATGATTAACAGTCAGGCTGACAAAAGAGGTGCAATTAAAGAAATATTGGTTGTGAATTACCATCGCTGA

Protein

MKIKQAIAKPFLKWAGGKGKLIEQLVNCFPLEITTGQLTKYAEPFIGGGALYFHVAQNYPQIEKFFISDCNQQLVLAYQTIQQNVDDLIDFLRRLQQKYYCFNQDERKDFFYQQRLKFNQNVTGINLEKFSKLWIEQTGLLIFLNRTCFNGLFRVNSKGEFNVPFGDYKNPKICDAENLKLVANLLARTEIRFGDFTSSNNFIDASTFVYFDPPYRPLNKTSSFNSYGKANFNDNEQLRLAEYYQSLNNKNAKLMLSNSDPKNINSDDNFFDDLYRGFQIARIDALRMINSQADKRGAIKEILVVNYHR