Your browser is old and dusty. Try Google Chrome!

Details for slr1800

ORF slr1800
Accession NP_440149.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -84 -91 11.7405 0.0778
NP_441418.1_6 Reverse -97 -116 -23.305 0.194
NP_441623.1_1 Forward -218 -200 1.19912 0.215
NP_441623.1_1 Reverse -144 -162 -2.14413 0.241
NP_441818.1_9 Reverse -216 -235 -9.53865 0.291
NP_440226.1_1 Forward -92 -73 5.211 0.163
NP_442169.1_1 Reverse -224 -243 -1.37718 0.265
NP_441630.1_3 Forward -355 -336 4.42435 0.164
NP_442752.1_4 Reverse -223 -230 12.4288 0.0388
NP_442752.1_4 Reverse -172 -179 6.52896 0.154
NP_442975.1_10 Reverse -57 -71 5.70218 0.212
NP_442861.1_1 Reverse -245 -264 15.5357 0.227
NP_440061.1_9 Forward -234 -220 6.48882 0.244
NP_441054.1_2 Forward -87 -68 13.1758 0.21
NP_442062.1_8 Reverse -223 -233 4.20827 0.228
NP_441900.1_1 Reverse -40 -59 13.4728 0.197
NP_440304.1_4 Reverse -306 -316 2.83163 0.299
NP_440304.1_4 Reverse -39 -49 2.14332 0.299
NP_440916.1_1 Forward -159 -145 8.45605 0.267
NP_439918.1_2 Reverse -367 -386 -3.54046 0.257
NP_442110.1_7 Reverse -308 -322 6.09611 0.153
NP_441082.1_10 Reverse -374 -387 10.2457 0.236
NP_441925.1_4 Forward -235 -216 2.35861 0.155
NP_441925.1_4 Forward -252 -233 -7.3761 0.194
NP_440209.1_1 Reverse -110 -118 2.1827 0.254
NP_440178.1_7 Reverse -94 -113 -22.42 0.265
NP_442570.1_3 Reverse -365 -384 -7.08038 0.265
NP_441716.1_1 Forward -232 -218 3.93283 0.259
NP_443013.1_9 Reverse -217 -236 12.2908 0.285
NP_441327.1_3 Forward -164 -145 12.9783 0.22
NP_441624.1_7 Forward -244 -230 11.5043 0.201
NP_440906.1_5 Forward -91 -84 9.47889 0.116
NP_440747.1_10 Forward -235 -223 -12.1541 0.227
NP_441130.1_10 Reverse -306 -320 6.58777 0.183
NP_442760.1_7 Reverse -92 -111 9.14423 0.206
NP_442848.1_4 Reverse -371 -385 18.2892 0.121
NP_442848.1_5 Forward -163 -145 2.37909 0.276
NP_440376.1_1 Reverse -30 -39 3.04799 0.21
NP_441846.1_10 Reverse -226 -245 -12.2919 0.19
NP_441846.1_10 Reverse -216 -235 -12.3902 0.19
NP_441846.1_10 Reverse -222 -241 -13.5702 0.206
NP_441846.1_10 Reverse -241 -260 -14.5535 0.232
NP_441846.1_10 Reverse -224 -243 -17.8968 0.256
NP_441846.1_10 Reverse -218 -237 -19.0768 0.256
NP_441846.1_10 Reverse -217 -236 -19.6667 0.256
NP_441846.1_10 Reverse -225 -244 -21.4367 0.256
NP_441846.1_10 Reverse -223 -242 -22.8133 0.266
NP_441846.1_10 Reverse -242 -261 -22.9117 0.271
NP_441846.1_10 Reverse -207 -226 -23.4033 0.285
NP_442958.1_9 Reverse -284 -294 17.8763 0.182
NP_442530.1_2 Forward -71 -61 10.9931 0.284
NP_440642.1_10 Forward -246 -232 2.75226 0.277
NP_441013.1_2 Forward -237 -219 -0.570838 0.271
NP_441013.1_2 Forward -225 -207 -1.35749 0.282
NP_442658.1_1 Forward -281 -271 5.68278 0.258
NP_440141.1_8 Reverse -227 -246 10.8159 0.208
NP_442782.1_2 Forward -82 -68 4.22782 0.256
NP_442782.1_2 Reverse -280 -294 3.24451 0.267
NP_440720.1_5 Reverse -218 -237 7.66927 0.286
NP_441487.1_6 Reverse -89 -108 2.16274 0.254
NP_442937.1_5 Forward -75 -56 7.66927 0.244
NP_441165.1_9 Forward -115 -96 15.8299 0.275
NP_441958.1_5 Forward -348 -338 -1.98659 0.265
NP_442836.1_10 Reverse -285 -295 8.73149 0.299
NP_442376.1_2 Reverse -305 -324 -2.95047 0.202
NP_442911.1_2 Forward -327 -308 0.884433 0.0635
NP_442002.1_1 Reverse -208 -226 -7.55234 0.251
NP_442032.1_5 Forward -394 -384 16.4008 0.246
NP_441654.1_7 Forward -31 -12 16.6961 0.155
NP_441938.1_10 Reverse -326 -344 10.6389 0.236
NP_442438.1_10 Forward -322 -308 -0.000409212 0.244
NP_442771.1_1 Reverse -95 -113 -8.83064 0.208
NP_440147.1_4 Forward -349 -336 3.5592 0.186
NP_440147.1_4 Forward -72 -59 2.37923 0.208
NP_440147.1_4 Reverse -81 -94 1.88757 0.216
NP_441041.1_1 Reverse -218 -237 8.16093 0.267
NP_442004.1_6 Forward -232 -218 5.1128 0.197
NP_439966.1_7 Forward -234 -224 9.71433 0.104
NP_439966.1_7 Forward -238 -228 5.19112 0.24
NP_440260.1_8 Reverse -364 -382 -5.38906 0.273
NP_441087.1_6 Forward -252 -234 -1.9482 0.275
NP_442215.1_2 Forward -229 -213 -6.62797 0.277
NP_441751.2_8 Forward -231 -217 3.34284 0.0678
NP_441586.1_5 Forward -389 -370 7.96426 0.221
NP_442142.1_4 Reverse -220 -233 2.772 0.278
NP_442142.1_7 Reverse -234 -251 18.2301 0.298
NP_442142.1_7 Reverse -227 -244 14.4935 0.298
NP_442143.1_3 Forward -81 -62 2.45773 0.247
NP_442301.1_8 Reverse -217 -236 12.9791 0.205
NP_440379.1_8 Reverse -310 -329 13.2741 0.244
NP_441673.1_1 Reverse -223 -232 -8.06341 0.254
NP_441876.1_9 Forward -240 -230 13.8442 0.267
NP_442719.1_2 Forward -268 -250 3.95163 0.155
NP_442227.1_2 Forward -243 -224 5.99764 0.202
NP_442227.1_2 Forward -231 -212 0.294447 0.252
NP_442227.1_2 Forward -239 -220 -3.93378 0.3
NP_442808.1_1 Reverse -337 -347 6.37109 0.116
NP_442808.1_1 Forward -233 -223 5.09279 0.173
NP_442808.1_1 Forward -251 -241 4.7978 0.19
NP_441101.1_10 Forward -243 -224 -0.787193 0.19
NP_441101.1_10 Forward -236 -217 -6.78538 0.29
NP_440031.1_10 Reverse -211 -230 0.0977854 0.282
NP_440145.1_3 Reverse -73 -92 -5.80207 0.279
NP_442050.1_1 Reverse -216 -235 7.57094 0.265
NP_440558.1_2 Forward -70 -51 -0.4922 0.203
NP_440558.1_2 Forward -248 -229 -4.6221 0.247
NP_440558.1_2 Reverse -64 -83 -5.99873 0.269
NP_441557.1_8 Forward -242 -232 15.8108 0.18
NP_441557.1_8 Forward -257 -247 14.2375 0.201
NP_441433.1_8 Forward -343 -324 0.0977854 0.242
NP_441433.1_8 Forward -174 -155 -0.688862 0.249
NP_441433.1_8 Reverse -375 -394 -2.45882 0.27
NP_441739.1_2 Forward -302 -286 2.81113 0.288
NP_441308.1_8 Reverse -239 -249 8.04317 0.288
NP_441116.1_9 Reverse -150 -164 16.3225 0.155
NP_440276.1_8 Forward -228 -209 7.27595 0.274
NP_441549.1_9 Reverse -63 -81 -0.374176 0.14
NP_442645.1_2 Reverse -22 -41 -22.0267 0.29
NP_442965.1_2 Reverse -218 -237 18.7807 0.0202
NP_442594.1_8 Reverse -234 -253 10.8159 0.175
NP_442594.1_8 Reverse -233 -252 10.0292 0.184
NP_442594.1_8 Reverse -216 -235 2.94938 0.291
NP_442508.1_8 Reverse -17 -34 10.2653 0.272
NP_440690.1_3 Forward -188 -169 22.4189 0.035
NP_441633.1_3 Forward -72 -59 -4.50394 0.199
NP_441633.1_3 Forward -319 -306 -4.60227 0.205
NP_442590.1_9 Forward -237 -218 7.27595 0.25
NP_442998.1_5 Reverse -385 -395 8.92815 0.26
NP_440731.1_2 Reverse -218 -237 9.63589 0.275
NP_440299.1_1 Forward -96 -83 6.21356 0.149
NP_440299.1_1 Forward -110 -97 3.65697 0.237
NP_442334.1_2 Reverse -226 -243 -14.1208 0.297
NP_442334.1_8 Reverse -315 -333 4.44404 0.252
NP_442333.2_5 Forward -312 -293 -8.55534 0.243
NP_440087.1_1 Reverse -225 -244 -8.45701 0.28
NP_441090.1_6 Reverse -373 -387 17.7975 0.111
NP_441559.1_8 Forward -237 -223 -3.34366 0.201
NP_442860.1_7 Reverse -58 -76 9.38308 0.283
NP_440915.1_1 Reverse -39 -57 19.6853 0.113
NP_440915.1_6 Forward -236 -222 -1.8687 0.251
NP_440915.1_6 Forward -283 -269 -3.54032 0.298
NP_441296.1_9 Forward -231 -218 8.77016 0.294
NP_440717.1_3 Forward -229 -215 7.3738 0.28
NP_440695.1_6 Forward -330 -316 10.7022 0.265
NP_441939.1_3 Reverse -339 -358 9.93088 0.133
NP_439985.1_2 Forward -223 -204 19.2723 0.105
NP_442957.1_3 Reverse -327 -346 3.73603 0.26
NP_442386.1_9 Forward -280 -271 9.34074 0.166
NP_442386.1_10 Reverse -216 -229 5.52582 0.262
NP_440570.1_5 Forward -387 -368 -2.55715 0.28
NP_442240.1_1 Forward -253 -234 9.34008 0.231
NP_442240.1_2 Reverse -84 -103 -17.8968 0.276
NP_442714.1_5 Reverse -228 -247 0.294447 0.258
NP_439996.1_1 Reverse -222 -241 8.84924 0.263
NP_439937.1_9 Reverse -307 -324 -4.19006 0.157
NP_439937.1_9 Reverse -269 -286 -11.9582 0.269
NP_440408.1_7 Reverse -211 -230 8.35759 0.281
NP_440408.1_7 Reverse -217 -236 6.78429 0.299
NP_440439.1_1 Forward -350 -337 -0.865694 0.241
NP_440439.1_1 Reverse -220 -233 -1.75067 0.281
NP_440439.1_1 Reverse -335 -348 -1.94734 0.288
NP_441789.1_7 Forward -235 -216 -0.591301 0.251
NP_441789.1_7 Forward -241 -222 -4.1312 0.28
NP_442488.1_7 Reverse -59 -78 11.4058 0.238
NP_442384.1_10 Reverse -61 -74 3.5592 0.186
NP_441604.1_4 Forward -58 -39 -5.60541 0.283
NP_441877.1_5 Forward -80 -61 -2.16383 0.296
NP_440531.1_8 Reverse -293 -312 11.2092 0.175
NP_442641.1_1 Forward -335 -316 -7.37537 0.192
NP_442280.1_10 Forward -230 -212 6.23363 0.28
NP_442280.1_10 Forward -392 -374 5.25962 0.289
NP_440894.1_2 Forward -260 -241 -0.787193 0.281
NP_440894.1_10 Forward -237 -218 3.44104 0.272
NP_440999.1_9 Forward -344 -330 -0.000409212 0.195
NP_440888.1_2 Forward -250 -236 7.27547 0.202
NP_440888.1_2 Reverse -270 -284 5.21053 0.288
NP_440600.1_4 Forward -100 -82 -4.50408 0.262
NP_440491.1_1 Reverse -58 -77 9.25599 0.218
NP_442845.1_2 Reverse -235 -249 6.3911 0.21
NP_441469.1_8 Forward -40 -31 5.40793 0.272
NP_442315.1_2 Reverse -25 -37 16.8536 0.245
NP_443064.1_6 Forward -232 -222 13.1486 0.0796
NP_441306.1_10 Reverse -59 -73 11.9953 0.263
NP_440071.1_6 Reverse -230 -244 13.9018 0.252
NP_441462.1_2 Forward -119 -109 -0.41329 0.225
NP_443062.1_6 Reverse -102 -121 1.17943 0.278
NP_440349.1_2 Reverse -342 -361 18.7807 0.175
NP_440516.1_6 Forward -226 -212 7.47213 0.273
NP_442428.1_4 Forward -233 -214 7.7676 0.184
NP_442428.1_5 Forward -91 -84 3.77569 0.277
NP_440673.1_3 Forward -234 -227 10.4622 0.139
NP_440673.1_3 Forward -65 -58 8.29892 0.221
NP_440673.1_3 Reverse -63 -70 7.51227 0.252
NP_440865.1_9 Reverse -217 -236 -0.885524 0.167
NP_442219.1_1 Forward -324 -305 18.3873 0.219
NP_442219.1_9 Forward -60 -51 2.75299 0.233
NP_440436.1_4 Reverse -271 -280 7.76745 0.124
NP_441884.1_9 Reverse -305 -324 -19.1751 0.145
NP_441004.1_1 Reverse -218 -237 2.0644 0.111
NP_441004.1_1 Reverse -287 -306 -10.4236 0.219
NP_441004.1_1 Reverse -236 -255 -17.3068 0.29
NP_441004.1_3 Reverse -245 -264 2.3594 0.266
NP_440296.1_10 Reverse -232 -251 -3.93378 0.209
NP_440328.1_4 Forward -98 -79 -0.885524 0.292
NP_441851.1_2 Reverse -274 -293 7.07928 0.181
NP_442515.1_1 Reverse -109 -123 -3.73699 0.297
NP_442515.1_1 Forward -362 -348 -4.4253 0.298
NP_440593.1_3 Forward -250 -231 4.42435 0.136
NP_440593.1_3 Forward -306 -287 -1.27885 0.211
NP_440432.1_9 Forward -105 -90 -3.65835 0.187
NP_439960.1_10 Forward -99 -81 -3.91409 0.284
NP_442450.1_5 Reverse -221 -231 5.09324 0.263
NP_440588.1_2 Forward -241 -222 -4.22878 0.21
NP_442006.1_2 Reverse -210 -227 -15.5958 0.228
NP_442006.1_3 Forward -112 -94 -7.65067 0.298
NP_440078.1_4 Reverse -99 -118 13.0775 0.19
NP_442388.1_3 Reverse -55 -74 9.14423 0.228
NP_442348.1_2 Reverse -320 -329 9.14451 0.28
NP_442443.1_1 Forward -385 -366 -5.31042 0.282
NP_441432.1_8 Forward -77 -68 10.0295 0.0681
NP_441432.1_8 Forward -71 -62 5.11294 0.187
NP_441432.1_8 Forward -348 -339 3.14632 0.259
NP_441432.1_8 Reverse -82 -91 2.75299 0.287
NP_441732.1_2 Forward -110 -94 -7.80794 0.0935
NP_442003.1_9 Reverse -228 -247 3.34271 0.281
NP_440760.1_1 Reverse -110 -129 -23.4033 0.297
NP_442274.1_8 Forward -252 -234 14.6196 0.286
NP_442624.1_3 Reverse -57 -71 16.5192 0.279
NP_441057.1_3 Reverse -313 -332 -2.36049 0.159
NP_440713.1_4 Reverse -229 -248 4.12936 0.231
NP_440713.1_4 Forward -224 -205 2.94938 0.254
NP_442489.1_7 Reverse -110 -119 -1.96689 0.28
NP_442489.1_7 Forward -232 -223 -2.06522 0.288
NP_441452.1_1 Forward -247 -228 12.5858 0.292
NP_441022.1_1 Forward -292 -283 13.6565 0.202
NP_441022.1_1 Reverse -282 -291 11.1625 0.284
NP_442913.1_9 Forward -76 -57 6.88262 0.294
NP_441040.1_2 Forward -181 -162 -10.227 0.244
NP_442008.1_2 Reverse -208 -227 8.84924 0.194
NP_442008.1_2 Reverse -220 -239 8.25926 0.2
NP_441800.1_7 Forward -235 -217 -2.63579 0.264
NP_442346.1_5 Forward -71 -61 8.73149 0.128
NP_442346.1_5 Reverse -82 -92 5.78156 0.229
NP_442346.1_5 Reverse -57 -67 5.38824 0.248
NP_442346.1_10 Forward -247 -228 -1.47551 0.294
NP_440545.1_3 Reverse -93 -110 -4.68105 0.23
NP_440486.1_6 Reverse -222 -241 14.2574 0.207
NP_441050.1_5 Reverse -301 -319 8.67227 0.176
NP_441050.1_5 Reverse -214 -232 -2.43913 0.283
NP_440751.1_3 Forward -260 -241 6.88182 0.287
NP_440772.1_7 Reverse -316 -335 14.9458 0.168
NP_442723.1_1 Forward -236 -217 7.37347 0.276
NP_442723.1_1 Forward -269 -250 4.62021 0.276
NP_442254.1_1 Reverse -8 -27 -2.16383 0.282
NP_440590.1_4 Reverse -62 -75 -4.40561 0.261
NP_440821.1_1 Forward -223 -204 13.2733 0.219
NP_441239.1_9 Forward -319 -307 3.18557 0.292
NP_441874.1_1 Reverse -213 -227 10.3243 0.261
NP_442138.1_1 Forward -69 -50 2.9486 0.24
NP_440462.1_6 Reverse -336 -346 2.83163 0.272
NP_442479.1_9 Forward -291 -272 -11.3086 0.273
NP_441474.1_1 Forward -242 -223 0.392004 0.255
NP_440402.1_3 Forward -328 -309 5.50599 0.276
NP_442402.1_4 Reverse -104 -123 -8.35941 0.281
NP_441848.1_7 Forward -187 -168 -2.75457 0.27
NP_442923.1_4 Forward -76 -57 4.62101 0.131
NP_440825.1_9 Reverse -29 -48 16.9124 0.101
NP_442837.1_3 Forward -231 -224 5.74231 0.275
NP_442053.1_1 Reverse -223 -232 4.22796 0.261
NP_440505.1_3 Reverse -175 -185 6.07655 0.197
NP_441701.1_3 Reverse -218 -235 8.49531 0.247
NP_441011.1_8 Forward -346 -337 8.35786 0.144
NP_441011.1_8 Forward -91 -82 5.50626 0.256
NP_442533.1_1 Reverse -220 -239 -7.96535 0.201
NP_442541.1_10 Forward -253 -239 1.96562 0.27
NP_442232.1_3 Reverse -219 -238 -14.7502 0.288
NP_442322.1_4 Forward -245 -228 -1.04349 0.226
NP_442322.1_4 Forward -244 -227 -5.76335 0.272
NP_442322.1_4 Forward -234 -217 -7.23831 0.279
NP_441482.1_7 Forward -112 -98 -11.2101 0.245
NP_439944.1_9 Forward -75 -65 9.12481 0.1
NP_441028.1_6 Forward -241 -231 13.2542 0.159
NP_441028.1_6 Forward -392 -382 10.1076 0.21
NP_441527.1_4 Reverse -122 -141 -11.6027 0.284
NP_440115.1_6 Reverse -224 -234 4.60159 0.293
NP_441961.1_1 Forward -74 -55 11.0125 0.23
NP_443045.1_9 Forward -233 -215 7.49153 0.272
NP_441972.1_5 Reverse -189 -208 -6.49039 0.231
NP_441972.1_5 Reverse -160 -179 -8.752 0.272
NP_439903.1_6 Reverse -58 -77 6.09517 0.173
NP_441286.1_1 Reverse -109 -121 -7.04085 0.3
NP_440670.1_8 Forward -106 -97 3.53964 0.257
NP_442477.1_8 Reverse -148 -167 14.2574 0.165
NP_442717.1_2 Reverse -14 -33 -3.14714 0.233
NP_442401.1_2 Forward -237 -218 6.88182 0.282
NP_441808.1_8 Forward -319 -300 6.98095 0.283
NP_440907.2_9 Forward -163 -144 5.40686 0.215
NP_441021.1_1 Reverse -62 -81 -10.0303 0.227
NP_442211.1_3 Forward -197 -178 10.0008 0.257
NP_442794.1_1 Forward -96 -84 6.92215 0.154
NP_442467.1_4 Reverse -95 -114 9.53756 0.194
NP_441962.1_4 Reverse -222 -241 -11.2103 0.238
NP_441742.1_7 Forward -236 -217 15.7324 0.245
NP_440114.1_10 Forward -186 -172 5.99778 0.289
NP_442323.1_7 Reverse -35 -54 8.35677 0.163
NP_440791.1_10 Forward -181 -168 21.2581 0.13
NP_440293.1_10 Reverse -224 -243 -2.36049 0.273
NP_441237.1_2 Reverse -156 -175 13.2741 0.238
NP_440457.1_1 Reverse -219 -231 8.39711 0.101
NP_440457.1_1 Reverse -223 -235 0.23564 0.25
NP_441801.1_4 Reverse -163 -173 2.63497 0.29
NP_440942.1_6 Forward -346 -327 5.80018 0.259
NP_442509.1_9 Reverse -241 -251 9.321 0.192
NP_441885.1_5 Forward -347 -337 4.40493 0.0736
NP_441756.1_5 Forward -236 -217 -2.0655 0.267
NP_441173.1_9 Forward -265 -257 12.9004 0.206
NP_440423.1_6 Reverse -234 -253 -14.5535 0.229
NP_443000.1_7 Reverse -81 -91 6.96153 0.109
NP_440275.1_3 Forward -121 -111 6.17489 0.122
NP_440091.1_1 Reverse -57 -69 0.923956 0.225
NP_442354.1_7 Reverse -377 -396 9.3409 0.216
NP_443010.1_10 Reverse -174 -191 6.15298 0.192
NP_441359.1_5 Reverse -220 -239 2.75272 0.264
NP_439962.1_4 Forward -338 -319 2.75272 0.197
NP_440149.1_6 Forward -196 -177 20.8456 0.0215
NP_442373.1_2 Reverse -215 -234 -6.49039 0.227
NP_440216.1_1 Reverse -338 -352 -5.50694 0.131
NP_440216.1_1 Reverse -223 -237 -11.5051 0.192
NP_440167.1_3 Reverse -226 -245 13.0775 0.195
NP_442015.1_10 Forward -96 -83 1.49425 0.204
NP_442015.1_10 Reverse -106 -119 -1.16069 0.297
NP_441226.1_7 Forward -235 -228 8.59356 0.197
NP_441766.1_2 Forward -236 -227 2.06468 0.265
NP_442417.1_5 Reverse -223 -237 5.30946 0.267
NP_440416.1_9 Forward -99 -80 -0.0988766 0.0573
NP_440416.1_9 Reverse -291 -310 -6.98204 0.0951
NP_440416.1_9 Forward -239 -220 -9.14533 0.127
NP_440416.1_9 Forward -187 -168 -21.0434 0.29
NP_443052.1_9 Forward -237 -218 -2.45882 0.238
NP_443052.1_9 Forward -256 -237 -5.60541 0.271
NP_441940.1_2 Reverse -363 -382 11.1109 0.248
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TATCAAATTTTATCCCTAGCCCAGGAACAAGCCCAGTCTGGTAACTACCAGCAGGCTATCCGTGCCCTCCAGCAAATTCCGGCTGAAAGCGCCGCCTATAACAGTGCCCAAAGCTTTTTGCAGGAATGGCGCAGTTTTAACCAACCTTCCCCGGTTCCCCTTACCCCCGTCGCTCCCCCTGCCCCTAGGGTTGAGTCTCCTTTGTCGACGGAATCAGAATTGCCTCCCCTGGAGAGTCCGCAAAATTAACCCCTGATAGGACTGTCTTAGCCCTATTTTGGGACGACCGACCAGGAAGATCTCCCCCTTGTGATAGCTTGGTAAGGCTTTGGCAATCATTGCTTTCCCTAAGCAGTTGCTCTGCTGTCCCCAAACATTAACCAGATTAAAGATTAGCCCT

CDS

ATGGTTGAGCTTGCGCCTTCCCCTGAAGCCATTACCGCCGCGCTGGAAATTCCCGCTGACATTAACTTTGCACTGCCCGATCCTGCGGACGAAGAGATCCAAGAGCACGAGTTTCAGCAACAGTTGGAGGATTTTTGGCAACTGTGTGAGCGCTTTGATCTGCAAACGGAAATCTGGCGGGGTCGCATTCTCCGGGCGGTGCGGGACCGAGAAAAAATTGGTGGTGAAGGTCGGGGCACTGGCTTTTTAAATTGGCTCAAGCAACGGGAAATTTCCAAAGCCCAGGCCTATGCCCTCATTCAGCTGGCCAATAGTGCCGATACTTTAATCACTGAAGGACAATTAGACCCCAATTCCATCAACAATTTCAGCAAACGGGCCTTTGTGGAAACCGCTAAGGCTGATCCGGAGGTGCAAAAGTTAGTCAGTGATGCGGCCCATAACGGCGATCGCATTACCCGACGGGAAGTGAAGCAGTTGGCCGATGAGTGGACTGCCATGAGCTCGGAACTCTTGCCCGATGTGCTCAAGGAAAAAGCCACCGATGGCACCGTCTCCCCCCGACACTTAGCCCCCCTGGTGAAGGAACTAGAAAAAGTACCAGAAACCCATTTGCAAGCCCTCCAGGAAGAGGCGATCGCCTCCCCCGATGTGGACACGGTTAAATATCTCACCACTTCCGCCCGTAATTTGTCTAAATATTTGGATGCGGCGGCCAAGGTGCAAACCCTGAAAGCTTTTCCGCTGGATATGGAACTGGCTTTACAGGAAGCCCTACGGTTGGATTGCCTCAACACTGCGGCGGATTTGCTCAAACAGGCCACCCAACTAGAACAATCCGTAGGTAAACTGTTCACCACCTGGAAGCGTTTAGCGACTTTGTCCGATCGCCTCTATGTGGACACCGGAGCTAGTACCCCCAACCTGCGTTCCCTGTTGACGGCTATTGAAAGTCTCACCCAGGAAGTGATTGAAGTGCCCCTGGATGAGGATGGCAACAACACAGTGCGTTTAAAAATTACTTGTTCAGACGGTCTAGCAACCACAGGGACGACAACAAACCAGTGA

Protein

MVELAPSPEAITAALEIPADINFALPDPADEEIQEHEFQQQLEDFWQLCERFDLQTEIWRGRILRAVRDREKIGGEGRGTGFLNWLKQREISKAQAYALIQLANSADTLITEGQLDPNSINNFSKRAFVETAKADPEVQKLVSDAAHNGDRITRREVKQLADEWTAMSSELLPDVLKEKATDGTVSPRHLAPLVKELEKVPETHLQALQEEAIASPDVDTVKYLTTSARNLSKYLDAAAKVQTLKAFPLDMELALQEALRLDCLNTAADLLKQATQLEQSVGKLFTTWKRLATLSDRLYVDTGASTPNLRSLLTAIESLTQEVIEVPLDEDGNNTVRLKITCSDGLATTGTTTNQ