Your browser is old and dusty. Try Google Chrome!

Details for slr1793

ORF slr1793
Accession NP_440132.1
Symbol
Category Pentose phosphate pathway
Definition transaldolase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -240 -254 -1.37704 0.258
NP_441061.1_2 Reverse -351 -365 -1.47537 0.262
NP_441061.1_2 Forward -343 -329 -1.8687 0.274
NP_441061.1_2 Reverse -95 -109 -2.65535 0.3
NP_440795.1_7 Forward -358 -351 14.6904 0.0123
NP_440795.1_7 Reverse -351 -358 14.6904 0.0123
NP_441418.1_6 Reverse -350 -369 -3.04881 0.0218
NP_441418.1_6 Forward -359 -340 -20.1584 0.106
NP_441418.1_6 Reverse -326 -345 -21.4367 0.149
NP_443032.1_8 Reverse -221 -240 -0.983855 0.259
NP_442291.1_5 Forward -104 -88 5.56507 0.0762
NP_442291.1_7 Forward -201 -187 11.0127 0.23
NP_440897.1_6 Forward -48 -29 -4.81951 0.29
NP_441453.1_1 Reverse -343 -361 9.35981 0.165
NP_441453.1_4 Reverse -350 -358 16.539 0.00633
NP_441453.1_4 Forward -359 -351 16.539 0.00633
NP_441453.1_4 Forward -197 -189 4.24765 0.259
NP_442151.1_6 Reverse -188 -202 12.6843 0.0691
NP_442328.1_2 Reverse -327 -346 7.17762 0.289
NP_441818.1_1 Forward -53 -42 12.4478 0.125
NP_440226.1_1 Reverse -350 -369 14.4541 0.0305
NP_440226.1_1 Forward -359 -340 10.5209 0.0617
NP_441465.1_8 Reverse -28 -46 16.5388 0.0962
NP_440150.1_6 Reverse -332 -351 3.44104 0.248
NP_442173.1_1 Forward -358 -350 15.4574 0.00633
NP_442173.1_1 Reverse -351 -359 15.4574 0.00633
NP_442752.1_4 Forward -359 -352 13.8055 0.0199
NP_442752.1_4 Reverse -350 -357 13.8055 0.0199
NP_443027.1_4 Reverse -348 -358 16.2046 0.0437
NP_443027.1_4 Forward -361 -351 5.87989 0.294
NP_440613.1_6 Reverse -237 -256 17.109 0.273
NP_441812.1_3 Forward -360 -346 7.9644 0.254
NP_442975.1_10 Forward -363 -349 10.8154 0.0516
NP_440784.1_7 Forward -358 -351 15.9687 0.0123
NP_440784.1_7 Reverse -351 -358 15.9687 0.0123
NP_442909.1_7 Reverse -351 -365 10.422 0.136
NP_440061.1_9 Reverse -110 -124 7.96378 0.185
NP_441054.1_4 Forward -369 -351 -3.91409 0.288
NP_442062.1_3 Forward -175 -156 -0.787193 0.25
NP_442062.1_8 Reverse -350 -360 19.4496 0.000558
NP_442062.1_8 Forward -359 -349 10.3048 0.0493
NP_442062.1_8 Reverse -94 -104 4.20827 0.228
NP_442062.1_8 Forward -197 -187 4.10993 0.232
NP_442062.1_8 Forward -103 -93 3.91327 0.243
NP_442062.1_8 Reverse -4 -14 3.12662 0.285
NP_441859.1_3 Reverse -32 -51 5.80018 0.191
NP_440304.1_4 Reverse -348 -358 19.9412 0.00364
NP_440304.1_4 Forward -361 -351 1.84832 0.299
NP_442242.1_4 Forward -358 -351 14.3954 0.0124
NP_442242.1_4 Reverse -351 -358 14.3954 0.0124
NP_440044.1_8 Forward -358 -339 12.3892 0.0427
NP_439918.1_3 Forward -362 -343 9.53756 0.249
NP_441619.1_9 Forward -121 -102 3.6377 0.269
NP_441208.1_9 Forward -362 -348 7.9644 0.219
NP_441594.1_6 Reverse -36 -55 6.29264 0.193
NP_441594.1_6 Reverse -341 -360 -0.197208 0.298
NP_440370.1_10 Reverse -341 -360 17.6007 0.0615
NP_440370.1_10 Forward -368 -349 6.78429 0.283
NP_440132.1_1 Forward -361 -343 19.0954 0.0289
NP_440132.1_2 Forward -286 -267 22.7139 0.0117
NP_440132.1_9 Forward -155 -136 19.174 0.0572
NP_441365.1_5 Forward -26 -7 -8.94866 0.275
NP_442110.1_7 Forward -359 -345 11.3077 0.061
NP_441082.1_10 Forward -126 -113 7.6891 0.297
NP_442726.1_1 Forward -108 -89 12.6841 0.164
NP_440856.1_4 Reverse -343 -362 -2.36049 0.209
NP_441083.1_5 Reverse -350 -360 11.3864 0.0159
NP_441083.1_5 Forward -359 -349 11.2881 0.0159
NP_441083.1_5 Forward -248 -238 4.20827 0.153
NP_442827.1_8 Forward -367 -348 2.85027 0.155
NP_441738.1_2 Forward -357 -350 15.28 0.0102
NP_441738.1_2 Reverse -352 -359 15.28 0.0102
NP_441558.1_5 Reverse -348 -367 16.2241 0.0318
NP_441558.1_5 Reverse -92 -111 7.86593 0.167
NP_441558.1_5 Reverse -186 -205 5.11266 0.26
NP_441942.1_6 Reverse -38 -57 15.7394 0.235
NP_440209.1_1 Reverse -350 -358 18.1123 0.00295
NP_440209.1_1 Forward -359 -351 18.1123 0.00295
NP_440447.1_1 Reverse -345 -363 9.95058 0.194
NP_441713.1_1 Reverse -344 -363 0.786102 0.0798
NP_441713.1_1 Forward -365 -346 -12.7836 0.248
NP_441770.1_1 Forward -303 -284 11.2084 0.277
NP_440178.1_7 Forward -360 -341 -21.9284 0.246
NP_440053.1_2 Reverse -362 -381 12.5858 0.283
NP_441716.1_1 Forward -359 -345 3.93283 0.259
NP_442111.1_4 Forward -360 -346 9.43936 0.0609
NP_442111.1_4 Reverse -349 -363 5.30946 0.169
NP_442111.1_4 Reverse -3 -17 3.24451 0.253
NP_440906.1_5 Forward -358 -351 15.8704 0.0124
NP_440906.1_5 Reverse -351 -358 15.8704 0.0124
NP_440747.1_10 Reverse -347 -359 7.80712 0.00223
NP_440747.1_10 Forward -362 -350 5.44718 0.0137
NP_440747.1_10 Reverse -91 -103 -12.0557 0.199
NP_440747.1_10 Forward -124 -112 -12.1541 0.227
NP_442973.1_5 Forward -243 -224 17.109 0.0809
NP_441486.1_1 Forward -362 -348 11.8976 0.0137
NP_441486.1_1 Reverse -347 -361 4.52282 0.0432
NP_441486.1_1 Reverse -185 -199 0.88457 0.124
NP_441486.1_1 Forward -106 -92 -4.7203 0.205
NP_440944.1_2 Forward -371 -352 -3.04881 0.282
NP_442634.1_4 Forward -361 -347 7.76774 0.0479
NP_442634.1_4 Forward -236 -222 5.21113 0.0635
NP_440403.1_10 Reverse -341 -360 1.37609 0.291
NP_440403.1_10 Forward -129 -110 0.786102 0.296
NP_442848.1_1 Forward -365 -351 -1.18038 0.263
NP_442848.1_1 Reverse -344 -358 -3.93365 0.275
NP_441012.1_4 Forward -201 -188 6.21414 0.284
NP_441012.1_4 Reverse -268 -281 6.21414 0.284
NP_443018.1_3 Forward -358 -351 14.8871 0.0123
NP_443018.1_3 Reverse -351 -358 14.8871 0.0123
NP_443018.1_3 Forward -196 -189 12.5271 0.0523
NP_443018.1_3 Reverse -189 -196 12.5271 0.0523
NP_441316.1_7 Reverse -348 -363 2.04485 0.156
NP_441316.1_7 Forward -361 -346 -3.06836 0.273
NP_441634.1_8 Reverse -348 -362 3.24451 0.154
NP_441634.1_8 Forward -355 -341 0.88457 0.215
NP_440376.1_1 Forward -359 -350 19.4693 0.000692
NP_440376.1_1 Reverse -350 -359 19.4693 0.000692
NP_440376.1_1 Reverse -225 -234 5.99792 0.111
NP_440376.1_1 Forward -121 -112 1.57302 0.246
NP_441588.1_4 Reverse -352 -362 7.25653 0.178
NP_442687.1_7 Forward -360 -350 15.8113 0.0125
NP_442687.1_7 Reverse -349 -359 9.02648 0.0994
NP_442485.1_3 Reverse -339 -358 9.14423 0.123
NP_442485.1_3 Forward -292 -273 -2.75381 0.266
NP_442958.1_3 Forward -370 -351 5.89931 0.197
NP_442958.1_3 Forward -297 -278 1.37609 0.267
NP_442530.1_2 Forward -192 -182 12.0747 0.281
NP_441422.1_7 Forward -361 -344 -3.00942 0.226
NP_440533.1_6 Reverse -283 -302 7.27595 0.297
NP_442296.1_9 Reverse -351 -370 -3.04881 0.249
NP_441763.1_10 Forward -370 -351 8.06178 0.224
NP_442658.1_1 Forward -361 -351 15.9091 0.00966
NP_442658.1_1 Reverse -348 -358 13.0576 0.04
NP_442198.1_7 Forward -362 -343 11.5033 0.209
NP_440141.1_3 Forward -295 -276 2.85105 0.274
NP_442782.1_2 Forward -359 -345 13.7659 0.173
NP_442782.1_2 Reverse -300 -314 5.21113 0.246
NP_442782.1_2 Reverse -357 -371 4.81781 0.25
NP_442205.1_9 Reverse -344 -360 -1.90808 0.264
NP_442205.1_9 Forward -365 -349 -3.38305 0.282
NP_441414.1_9 Reverse -350 -369 -3.24547 0.132
NP_441958.1_5 Reverse -349 -359 21.2195 0.000805
NP_441958.1_5 Forward -360 -350 12.2714 0.00183
NP_440203.1_5 Forward -356 -346 11.2876 0.2
NP_440269.1_8 Reverse -357 -376 7.7676 0.176
NP_440995.1_8 Reverse -160 -179 0.687771 0.267
NP_440984.1_7 Forward -364 -350 11.6026 0.122
NP_442911.1_2 Forward -369 -350 3.53937 0.0428
NP_441580.1_6 Reverse -339 -358 2.16274 0.117
NP_440153.1_5 Reverse -351 -365 2.45787 0.223
NP_440858.1_1 Forward -381 -362 -5.21209 0.281
NP_442064.1_1 Forward -364 -345 -13.2752 0.285
NP_442051.1_5 Reverse -252 -271 11.2092 0.29
NP_440993.1_2 Reverse -345 -361 2.22182 0.269
NP_440496.1_1 Reverse -119 -138 0.294447 0.289
NP_440138.1_6 Reverse -34 -53 8.55343 0.19
NP_441099.1_5 Forward -345 -326 -11.7019 0.288
NP_442002.1_9 Reverse -125 -132 11.1505 0.185
NP_442002.1_9 Forward -360 -353 10.7572 0.185
NP_440809.1_2 Forward -137 -118 -2.65548 0.275
NP_440809.1_9 Reverse -341 -359 -7.55234 0.225
NP_441294.1_7 Forward -363 -349 8.86667 0.274
NP_441646.1_1 Forward -110 -91 3.6377 0.206
NP_441646.1_1 Forward -20 -1 -0.000545616 0.257
NP_441646.1_1 Forward -366 -347 -0.885524 0.273
NP_442438.1_10 Reverse -345 -359 13.6676 0.0338
NP_442431.1_10 Reverse -320 -338 0.904127 0.264
NP_441292.1_2 Reverse -116 -135 -5.01543 0.241
NP_441000.1_6 Reverse -349 -363 -3.93365 0.225
NP_441000.1_6 Forward -360 -346 -5.11362 0.261
NP_440147.1_4 Forward -361 -348 12.0157 0.0326
NP_440147.1_4 Reverse -348 -361 2.47756 0.208
NP_440147.1_4 Forward -105 -92 -0.767364 0.299
NP_441550.1_8 Reverse -348 -358 13.0576 0.0273
NP_441550.1_8 Forward -361 -351 8.3377 0.124
NP_441550.1_8 Reverse -237 -247 6.56775 0.201
NP_441550.1_8 Forward -250 -240 4.99446 0.274
NP_441550.1_8 Forward -199 -189 4.7978 0.283
NP_441916.1_7 Forward -359 -349 18.9579 0.00144
NP_441916.1_7 Reverse -350 -360 18.4663 0.00144
NP_441916.1_10 Forward -199 -180 5.70265 0.208
NP_441041.1_4 Forward -359 -340 7.57094 0.0387
NP_441041.1_4 Reverse -94 -113 5.01433 0.0533
NP_441041.1_4 Forward -121 -102 -7.57203 0.19
NP_441041.1_4 Reverse -350 -369 -10.9153 0.238
NP_441041.1_4 Reverse -122 -141 -11.5053 0.248
NP_441041.1_7 Forward -362 -350 9.65268 0.108
NP_441041.1_7 Reverse -347 -359 6.34865 0.211
NP_441041.1_7 Forward -106 -94 5.18252 0.272
NP_442396.1_5 Forward -363 -350 9.45906 0.129
NP_442004.1_6 Forward -359 -345 15.9292 0.0577
NP_442004.1_6 Forward -121 -107 2.65453 0.26
NP_441725.1_4 Reverse -345 -359 2.5556 0.284
NP_441725.1_5 Forward -358 -348 11.1898 0.0247
NP_441725.1_5 Reverse -351 -361 2.04498 0.115
NP_441725.1_5 Reverse -189 -199 -0.0199663 0.223
NP_439966.1_7 Reverse -348 -358 14.8275 0.0177
NP_439966.1_7 Forward -361 -351 9.91099 0.0968
NP_439966.1_9 Forward -361 -352 0.884706 0.253
NP_440736.1_3 Reverse -348 -367 -0.983855 0.282
NP_440202.1_8 Reverse -97 -116 9.41727 0.297
NP_442941.1_3 Forward -358 -348 19.9412 0.00262
NP_442941.1_3 Forward -53 -43 5.38824 0.115
NP_442941.1_3 Reverse -351 -361 2.63497 0.14
NP_440289.1_2 Reverse -347 -360 -2.83231 0.262
NP_440289.1_2 Forward -362 -349 -3.61896 0.267
NP_440289.1_8 Reverse -282 -296 18.2885 0.135
NP_440260.1_7 Reverse -120 -139 -2.16383 0.241
NP_440260.1_7 Reverse -119 -138 -2.26216 0.241
NP_440260.1_8 Reverse -341 -359 -0.865831 0.224
NP_440260.1_8 Reverse -179 -197 -5.97904 0.282
NP_442281.1_1 Forward -364 -350 11.897 0.0428
NP_442281.1_1 Reverse -345 -359 7.66879 0.0949
NP_442281.1_1 Forward -202 -188 5.60385 0.152
NP_442281.1_1 Forward -108 -94 2.26061 0.272
NP_441334.1_7 Forward -361 -342 -12.4886 0.157
NP_440437.1_1 Reverse -344 -363 -1.7705 0.205
NP_442012.1_1 Reverse -344 -363 3.6377 0.179
NP_442012.1_9 Reverse -200 -218 14.2991 0.287
NP_440723.1_4 Reverse -245 -264 -0.983855 0.191
NP_440498.1_1 Reverse -341 -359 6.41066 0.0875
NP_440498.1_1 Forward -368 -350 5.32902 0.106
NP_441644.1_6 Forward -359 -349 19.0557 0.000803
NP_441644.1_6 Forward -197 -187 11.4843 0.0481
NP_441644.1_6 Reverse -350 -360 10.1076 0.0628
NP_442215.1_2 Reverse -186 -202 5.46674 0.0795
NP_442215.1_2 Forward -361 -345 3.69678 0.093
NP_442215.1_2 Forward -266 -250 -1.21977 0.181
NP_442029.1_1 Reverse -243 -262 -14.5535 0.272
NP_442029.1_6 Reverse -329 -348 3.04771 0.286
NP_440929.1_8 Forward -359 -350 19.2726 0.000701
NP_440929.1_8 Reverse -350 -359 19.2726 0.000701
NP_442933.1_10 Forward -359 -350 17.601 0.00325
NP_442933.1_10 Reverse -350 -359 17.601 0.00325
NP_441751.2_8 Forward -358 -344 16.0275 0.0103
NP_442554.1_8 Forward -358 -348 16.9913 0.0065
NP_442554.1_8 Reverse -351 -361 13.2547 0.0187
NP_442554.1_8 Reverse -189 -199 12.0747 0.0295
NP_442554.1_8 Forward -196 -186 9.81313 0.0545
NP_441762.1_7 Reverse -349 -361 10.2654 0.0142
NP_441762.1_7 Forward -360 -348 2.20226 0.0676
NP_441762.1_7 Reverse -93 -105 -7.23751 0.286
NP_442142.1_4 Reverse -347 -360 17.4232 0.0264
NP_442142.1_4 Forward -51 -38 9.36014 0.0973
NP_442142.1_4 Forward -362 -349 5.32859 0.194
NP_442292.1_1 Forward -358 -349 17.5026 0.00435
NP_442292.1_1 Reverse -351 -360 9.63616 0.0183
NP_442292.1_1 Forward -196 -187 5.21127 0.152
NP_440122.1_2 Reverse -180 -199 8.84924 0.198
NP_442476.1_6 Reverse -351 -365 11.3077 0.056
NP_442476.1_6 Forward -358 -344 1.37622 0.219
NP_443009.1_5 Reverse -349 -360 19.626 0.00102
NP_443009.1_5 Reverse -44 -55 9.30127 0.0965
NP_443009.1_5 Forward -360 -349 7.82632 0.118
NP_442408.2_1 Forward -263 -244 -5.80207 0.277
NP_441715.1_4 Forward -358 -348 14.238 0.0295
NP_441715.1_4 Reverse -351 -361 9.41981 0.097
NP_440357.1_3 Forward -56 -37 2.0644 0.269
NP_440357.1_3 Forward -289 -270 -0.197208 0.29
NP_441448.1_1 Reverse -117 -136 13.9625 0.165
NP_440183.1_1 Forward -358 -339 6.68596 0.278
NP_440183.1_9 Forward -262 -243 -20.5517 0.287
NP_441198.1_8 Reverse -348 -358 13.2713 0.108
NP_440379.1_5 Reverse -341 -360 4.03102 0.138
NP_440379.1_5 Forward -363 -344 -10.227 0.276
NP_440379.1_5 Forward -290 -271 -10.227 0.276
NP_440379.1_5 Reverse -97 -116 -11.1119 0.288
NP_441468.1_1 Forward -358 -351 15.8704 0.0124
NP_441468.1_1 Reverse -351 -358 15.8704 0.0124
NP_441468.1_1 Reverse -189 -196 3.97235 0.277
NP_441468.1_1 Forward -196 -189 3.97235 0.277
NP_441618.1_3 Reverse -239 -258 1.76941 0.228
NP_441020.2_6 Reverse -348 -365 8.98696 0.182
NP_441020.2_6 Forward -361 -344 8.00365 0.212
NP_441015.1_8 Forward -204 -185 -0.590531 0.293
NP_441673.1_1 Forward -359 -350 20.8459 0.000698
NP_441673.1_1 Reverse -350 -359 20.8459 0.000698
NP_441673.1_1 Reverse -94 -103 -8.06341 0.254
NP_441876.1_9 Forward -130 -120 10.8943 0.284
NP_441826.1_2 Forward -365 -351 -1.47537 0.248
NP_441826.1_2 Reverse -344 -358 -4.32697 0.295
NP_442868.1_6 Reverse -348 -358 1.06167 0.205
NP_442868.1_6 Forward -361 -351 0.865012 0.205
NP_440789.1_10 Reverse -48 -66 19.1929 0.0543
NP_442808.1_1 Forward -360 -350 18.4657 0.00201
NP_442808.1_1 Reverse -349 -359 8.73102 0.0481
NP_440145.1_3 Reverse -340 -359 11.3075 0.037
NP_440145.1_3 Forward -244 -225 -6.09707 0.288
NP_442820.1_9 Forward -264 -246 5.42735 0.262
NP_442050.1_5 Reverse -348 -358 18.0724 0.00365
NP_441493.2_10 Forward -370 -351 4.42435 0.287
NP_441114.1_3 Forward -262 -253 8.55452 0.231
NP_441114.1_3 Reverse -190 -199 7.66954 0.231
NP_440558.1_2 Reverse -341 -360 18.3873 0.0626
NP_440558.1_2 Forward -357 -338 1.0811 0.185
NP_440558.1_2 Forward -140 -121 -0.983855 0.206
NP_440558.1_2 Forward -363 -344 -7.17871 0.289
NP_440558.1_2 Reverse -185 -204 -7.57203 0.296
NP_442789.1_4 Reverse -339 -358 5.70265 0.144
NP_442789.1_4 Forward -120 -101 -2.16383 0.233
NP_442789.1_4 Forward -361 -342 -6.78538 0.288
NP_441878.1_6 Reverse -349 -359 10.5014 0.0176
NP_441878.1_6 Forward -198 -188 10.5014 0.0176
NP_441878.1_6 Forward -360 -350 10.4031 0.0176
NP_441878.1_6 Reverse -187 -197 0.57002 0.14
NP_441878.1_10 Forward -192 -178 10.816 0.289
NP_441036.1_8 Forward -360 -350 17.7779 0.000554
NP_441036.1_8 Reverse -349 -359 15.713 0.00724
NP_441557.1_5 Forward -359 -350 19.9609 0.000699
NP_441557.1_5 Reverse -350 -359 19.9609 0.000699
NP_441557.1_5 Forward -103 -94 -0.68859 0.229
NP_441445.1_1 Reverse -341 -360 11.5042 0.0835
NP_441445.1_1 Reverse -329 -348 3.93269 0.204
NP_441445.1_1 Reverse -36 -55 1.67108 0.248
NP_441445.1_8 Reverse -120 -139 -12.6852 0.287
NP_441590.1_4 Forward -347 -328 7.96345 0.249
NP_441590.1_4 Forward -343 -324 6.58682 0.254
NP_441433.1_8 Reverse -189 -208 -4.03212 0.286
NP_441308.1_8 Reverse -348 -358 13.353 0.218
NP_440101.1_3 Forward -364 -345 4.62101 0.212
NP_440101.1_3 Forward -59 -40 0.786102 0.292
NP_442183.1_1 Reverse -350 -364 11.7993 0.0675
NP_442183.1_1 Forward -359 -345 8.45605 0.115
NP_442397.1_9 Reverse -182 -201 1.47442 0.283
NP_441574.1_1 Reverse -314 -333 -0.885524 0.211
NP_442444.1_6 Reverse -342 -360 17.757 0.143
NP_441549.1_9 Forward -363 -345 15.8504 0.0304
NP_442347.1_2 Reverse -351 -360 11.1111 0.056
NP_442347.1_2 Reverse -46 -55 6.78456 0.15
NP_442347.1_2 Forward -12 -3 4.81794 0.257
NP_442347.1_2 Forward -358 -349 3.34298 0.284
NP_442347.1_2 Reverse -240 -249 2.85133 0.299
NP_442645.1_2 Reverse -342 -361 5.11266 0.0216
NP_442645.1_2 Reverse -37 -56 -19.7651 0.288
NP_442645.1_2 Forward -367 -348 -22.2233 0.29
NP_441037.1_4 Forward -361 -351 14.7245 0.028
NP_441037.1_4 Reverse -348 -358 7.31769 0.237
NP_441037.1_4 Forward -199 -189 6.34312 0.267
NP_442594.1_8 Reverse -323 -342 5.50599 0.247
NP_442594.1_8 Reverse -318 -337 2.26107 0.295
NP_441633.1_3 Forward -361 -348 3.26421 0.0709
NP_441633.1_3 Reverse -348 -361 -5.78224 0.236
NP_441633.1_3 Reverse -186 -199 -6.47056 0.253
NP_440136.1_2 Forward -358 -351 15.9687 0.0123
NP_440136.1_2 Reverse -351 -358 15.9687 0.0123
NP_440136.1_2 Reverse -95 -102 4.26735 0.218
NP_441728.2_4 Forward -179 -160 14.7531 0.228
NP_442998.1_5 Reverse -124 -134 16.2046 0.149
NP_442998.1_10 Forward -357 -350 15.5754 0.0102
NP_442998.1_10 Reverse -352 -359 15.5754 0.0102
NP_440299.1_1 Reverse -184 -197 10.4418 0.0573
NP_440299.1_1 Reverse -346 -359 9.45847 0.0709
NP_440299.1_1 Forward -363 -350 8.08184 0.098
NP_441799.1_1 Forward -363 -349 19.2718 0.00667
NP_441799.1_1 Reverse -346 -360 16.9119 0.0128
NP_441007.1_10 Reverse -345 -358 3.46087 0.182
NP_441007.1_10 Forward -364 -351 1.59258 0.203
NP_440256.1_1 Reverse -347 -366 0.982764 0.0791
NP_440256.1_1 Forward -362 -343 -2.0655 0.112
NP_441559.1_8 Reverse -345 -359 -0.983719 0.18
NP_441559.1_8 Forward -364 -350 -7.08024 0.283
NP_440915.1_6 Reverse -346 -360 1.08123 0.147
NP_440915.1_6 Forward -363 -349 -2.75368 0.28
NP_440915.1_6 Forward -125 -111 -3.54032 0.298
NP_441179.1_9 Forward -256 -246 14.2375 0.246
NP_440717.1_2 Reverse -335 -354 -3.3438 0.238
NP_442785.1_7 Reverse -348 -362 19.4691 0.0488
NP_442452.1_3 Reverse -339 -358 -0.000545616 0.298
NP_442866.1_1 Forward -364 -345 -5.31042 0.24
NP_440748.1_5 Reverse -97 -116 0.196116 0.252
NP_441464.1_8 Reverse -350 -364 5.21113 0.26
NP_440787.1_5 Forward -367 -353 10.226 0.256
NP_440695.1_5 Forward -359 -340 2.3594 0.261
NP_440695.1_6 Reverse -80 -94 9.63569 0.279
NP_442993.1_1 Forward -359 -343 -10.8562 0.229
NP_442386.1_9 Forward -360 -351 15.7322 0.0144
NP_442386.1_9 Reverse -93 -102 11.209 0.0993
NP_442386.1_9 Forward -116 -107 10.7174 0.119
NP_442386.1_9 Reverse -187 -196 9.04574 0.175
NP_442386.1_9 Reverse -343 -352 7.2758 0.219
NP_442386.1_9 Reverse -349 -358 6.39082 0.219
NP_442386.1_9 Reverse -111 -120 5.21086 0.262
NP_441340.1_5 Forward -358 -351 15.6737 0.0124
NP_441340.1_5 Reverse -351 -358 15.6737 0.0124
NP_441340.1_5 Reverse -189 -196 4.07068 0.239
NP_441340.1_5 Forward -196 -189 4.07068 0.239
NP_441947.1_10 Forward -361 -343 1.19912 0.276
NP_440161.1_3 Forward -44 -25 8.25926 0.273
NP_440586.1_8 Forward -358 -351 13.2151 0.026
NP_440586.1_8 Reverse -351 -358 13.2151 0.026
NP_440586.1_8 Forward -196 -189 7.61025 0.227
NP_440586.1_8 Reverse -189 -196 7.61025 0.227
NP_440586.1_8 Forward -289 -282 7.1186 0.272
NP_442251.1_6 Forward -358 -351 15.2804 0.0124
NP_442251.1_6 Reverse -351 -358 15.2804 0.0124
NP_440684.1_9 Forward -365 -351 11.701 0.172
NP_441262.1_3 Reverse -350 -357 14.7888 0.0223
NP_441262.1_3 Forward -359 -352 14.7888 0.0223
NP_440027.1_3 Forward -369 -351 5.52492 0.24
NP_443051.1_1 Reverse -349 -358 19.5676 0.00335
NP_443051.1_1 Forward -360 -351 10.4228 0.00754
NP_441232.1_10 Reverse -339 -358 8.25926 0.142
NP_439937.1_9 Forward -360 -343 -16.5797 0.287
NP_440439.1_1 Reverse -347 -360 16.2439 0.0128
NP_440439.1_1 Forward -362 -349 10.5407 0.0365
NP_439943.1_4 Reverse -270 -289 6.58763 0.27
NP_440372.1_2 Forward -358 -351 16.3621 0.0124
NP_440372.1_2 Reverse -351 -358 16.3621 0.0124
NP_440271.1_2 Reverse -86 -105 2.55606 0.28
NP_440316.1_10 Forward -198 -188 7.84651 0.245
NP_441803.1_2 Reverse -345 -364 0.0977854 0.26
NP_440139.1_1 Forward -54 -35 0.686995 0.284
NP_441572.1_7 Reverse -344 -363 4.81767 0.0925
NP_440267.1_2 Reverse -345 -359 8.75042 0.162
NP_442384.1_10 Reverse -350 -363 15.4572 0.00986
NP_442384.1_10 Forward -359 -346 14.4739 0.0148
NP_442384.1_10 Reverse -112 -125 2.57589 0.22
NP_442384.1_10 Reverse -45 -58 1.9859 0.24
NP_440364.1_6 Forward -360 -347 13.6867 0.275
NP_441877.1_7 Reverse -89 -108 -0.00131823 0.277
NP_441018.1_7 Forward -363 -344 13.3725 0.136
NP_442790.1_4 Forward -368 -349 -14.4552 0.277
NP_442262.1_10 Forward -358 -351 14.1988 0.0123
NP_442262.1_10 Reverse -351 -358 14.1988 0.0123
NP_442262.1_10 Forward -196 -189 10.4622 0.145
NP_442262.1_10 Reverse -189 -196 10.4622 0.145
NP_441689.1_5 Reverse -348 -358 17.8758 0.0158
NP_440163.1_10 Reverse -1 -11 7.84651 0.299
NP_440344.1_10 Reverse -343 -360 -0.747806 0.0454
NP_440344.1_10 Forward -110 -93 -2.41943 0.0661
NP_440531.1_6 Reverse -342 -361 -3.3438 0.265
NP_442910.1_1 Reverse -343 -362 -3.3438 0.254
NP_440562.1_3 Reverse -189 -206 3.97208 0.21
NP_441965.1_10 Reverse -347 -363 9.69497 0.117
NP_442750.1_3 Reverse -377 -396 -10.9153 0.236
NP_440297.1_9 Reverse -189 -199 9.61647 0.0917
NP_440297.1_9 Forward -358 -348 9.22315 0.0917
NP_440297.1_9 Forward -196 -186 0.176696 0.282
NP_440297.1_9 Reverse -351 -361 -0.118297 0.282
NP_442280.1_10 Forward -358 -340 7.49983 0.268
NP_442280.1_10 Reverse -178 -196 5.94143 0.28
NP_441896.1_3 Forward -368 -349 -0.0988766 0.234
NP_440999.1_9 Forward -363 -349 6.48943 0.0969
NP_440888.1_2 Forward -359 -345 14.0603 0.0211
NP_440888.1_2 Forward -103 -89 7.17714 0.205
NP_440888.1_2 Reverse -350 -364 5.50552 0.276
NP_440491.1_1 Reverse -42 -61 7.20938 0.274
NP_439969.1_1 Reverse -110 -129 3.24438 0.173
NP_441123.1_7 Reverse -264 -283 18.289 0.214
NP_441759.1_2 Reverse -342 -361 11.7992 0.0856
NP_441759.1_8 Forward -129 -110 10.1267 0.211
NP_441543.1_2 Reverse -351 -360 18.486 0.00236
NP_441543.1_2 Forward -358 -349 15.9293 0.00518
NP_442845.1_2 Reverse -344 -358 15.8309 0.0694
NP_442845.1_2 Forward -359 -345 4.42448 0.259
NP_441551.1_5 Forward -363 -347 13.7258 0.119
NP_441178.1_4 Reverse -343 -362 18.3873 0.0722
NP_441469.1_8 Forward -360 -351 16.126 0.00797
NP_441469.1_8 Forward -198 -189 10.9145 0.191
NP_441469.1_8 Forward -104 -95 6.68623 0.227
NP_441469.1_8 Reverse -349 -358 6.5879 0.227
NP_443064.1_6 Forward -54 -44 12.6639 0.0796
NP_443064.1_6 Forward -359 -349 10.8217 0.13
NP_442578.1_7 Forward -358 -351 14.5921 0.026
NP_442578.1_7 Reverse -351 -358 14.5921 0.026
NP_441462.1_2 Forward -359 -349 20.2362 0.000805
NP_441462.1_2 Reverse -350 -360 11.5831 0.00406
NP_441621.1_7 Forward -361 -347 4.12949 0.0934
NP_443062.1_1 Forward -359 -341 9.71601 0.129
NP_443062.1_6 Forward -367 -348 9.53756 0.125
NP_442204.1_1 Reverse -346 -357 9.49844 0.0759
NP_442204.1_1 Forward -201 -190 -0.0396598 0.285
NP_442487.1_5 Forward -360 -341 6.48849 0.198
NP_440516.1_2 Forward -365 -347 5.13236 0.132
NP_440516.1_8 Forward -359 -350 16.9127 0.00442
NP_440516.1_8 Reverse -350 -359 16.9127 0.00442
NP_442428.1_5 Forward -358 -351 15.8704 0.0124
NP_442428.1_5 Reverse -351 -358 15.8704 0.0124
NP_442428.1_5 Forward -196 -189 4.36568 0.271
NP_442428.1_5 Reverse -189 -196 4.36568 0.271
NP_442120.1_10 Reverse -176 -195 -15.9302 0.296
NP_440673.1_2 Reverse -178 -197 13.2186 0.123
NP_440673.1_2 Reverse -340 -359 8.341 0.273
NP_440673.1_3 Forward -357 -350 12.4288 0.0426
NP_440673.1_3 Reverse -352 -359 12.4288 0.0426
NP_440865.1_9 Reverse -344 -363 -4.81876 0.207
NP_441052.1_2 Reverse -350 -360 10.5014 0.0285
NP_441052.1_2 Forward -359 -349 10.4031 0.0285
NP_441052.1_2 Forward -197 -187 4.0116 0.168
NP_440992.1_2 Reverse -345 -364 16.7157 0.189
NP_442219.1_8 Reverse -340 -359 6.62097 0.292
NP_442219.1_9 Forward -102 -93 12.5861 0.032
NP_442219.1_9 Reverse -351 -360 8.35786 0.0681
NP_442219.1_9 Forward -358 -349 8.25953 0.0681
NP_442219.1_9 Reverse -107 -116 2.75299 0.233
NP_440436.1_4 Reverse -351 -360 18.1905 0.00233
NP_440436.1_4 Forward -358 -349 9.24241 0.0871
NP_442086.1_3 Forward -358 -339 19.6656 0.0584
NP_442412.1_1 Reverse -283 -302 17.1485 0.214
NP_442907.1_9 Reverse -345 -364 0.491109 0.207
NP_441719.1_4 Forward -358 -351 16.3621 0.0124
NP_441719.1_4 Reverse -351 -358 16.3621 0.0124
NP_441733.1_10 Reverse -347 -360 5.91914 0.203
NP_441004.1_1 Reverse -283 -302 -12.0953 0.244
NP_441004.1_1 Reverse -341 -360 -13.3736 0.257
NP_441004.1_1 Reverse -320 -339 -14.6519 0.269
NP_441004.1_2 Reverse -290 -309 -2.55715 0.264
NP_442366.1_5 Forward -362 -352 15.2208 0.0375
NP_442206.1_10 Reverse -350 -365 1.94652 0.212
NP_443054.1_2 Reverse -348 -362 10.9143 0.0761
NP_443054.1_2 Reverse -92 -106 4.52282 0.24
NP_441851.1_10 Forward -360 -350 16.008 0.00552
NP_441851.1_10 Reverse -349 -359 8.53483 0.114
NP_441851.1_10 Forward -198 -188 5.97822 0.19
NP_441851.1_10 Forward -104 -94 5.78156 0.2
NP_442622.1_5 Forward -361 -342 24.2872 0.00107
NP_442515.1_1 Forward -348 -334 -3.24533 0.289
NP_442515.1_1 Reverse -349 -363 -4.22864 0.298
NP_440593.1_3 Reverse -183 -202 5.70265 0.122
NP_441982.1_6 Forward -373 -364 12.1034 0.288
NP_440005.1_3 Forward -171 -152 13.2847 0.281
NP_442709.1_3 Forward -366 -347 1.96607 0.296
NP_441046.1_2 Reverse -345 -364 -0.197208 0.276
NP_441046.1_2 Reverse -276 -295 -0.885524 0.287
NP_440338.1_4 Forward -399 -380 4.62021 0.298
NP_441349.1_10 Reverse -340 -359 -0.590531 0.0947
NP_441409.1_6 Reverse -219 -238 -7.08038 0.142
NP_442843.1_1 Forward -196 -177 -2.95047 0.217
NP_442843.1_1 Reverse -351 -370 -8.94866 0.264
NP_440474.1_8 Forward -358 -344 5.40719 0.25
NP_440396.1_10 Reverse -351 -367 10.2842 0.236
NP_442450.1_5 Reverse -348 -358 9.41981 0.115
NP_442450.1_5 Forward -361 -351 7.55152 0.13
NP_442450.1_5 Forward -199 -189 4.69992 0.297
NP_442168.1_5 Forward -358 -339 1.37609 0.241
NP_440588.1_2 Reverse -341 -360 -1.86883 0.157
NP_442237.1_2 Reverse -154 -173 17.1385 0.193
NP_441003.1_9 Reverse -179 -198 8.25926 0.224
NP_441570.1_1 Forward -359 -341 9.75391 0.0103
NP_441570.1_1 Reverse -239 -257 -11.9772 0.206
NP_441078.1_4 Forward -359 -350 19.6659 0.0007
NP_441078.1_4 Reverse -350 -359 19.6659 0.0007
NP_441078.1_4 Forward -234 -225 -1.18024 0.237
NP_441078.1_4 Forward -197 -188 -1.6719 0.266
NP_441078.1_4 Reverse -188 -197 -1.77023 0.266
NP_441078.1_4 Reverse -225 -234 -1.96689 0.282
NP_441078.1_4 Reverse -45 -54 -2.06522 0.295
NP_441432.1_8 Reverse -349 -358 16.8143 0.00595
NP_441432.1_8 Forward -360 -351 8.25953 0.0755
NP_441432.1_9 Reverse -158 -171 8.59837 0.287
NP_442320.1_8 Reverse -344 -358 -1.47537 0.082
NP_441732.1_2 Reverse -346 -362 2.12349 0.0253
NP_441732.1_2 Forward -363 -347 -17.4444 0.258
NP_441732.1_5 Reverse -196 -210 10.7177 0.234
NP_440313.1_1 Forward -382 -363 16.2241 0.215
NP_440759.1_9 Reverse -201 -220 9.3409 0.224
NP_440760.1_1 Reverse -350 -369 -20.945 0.226
NP_442797.1_6 Reverse -178 -197 9.67939 0.243
NP_440713.1_4 Reverse -340 -359 14.3558 0.0896
NP_442489.1_7 Forward -359 -350 20.1576 0.000695
NP_442489.1_7 Reverse -350 -359 20.1576 0.000695
NP_442489.1_7 Forward -197 -188 -1.6719 0.235
NP_442489.1_7 Reverse -188 -197 -1.77023 0.247
NP_442489.1_7 Reverse -45 -54 -2.06522 0.288
NP_442079.1_7 Forward -358 -339 13.5691 0.079
NP_440559.1_1 Reverse -351 -360 8.75118 0.0586
NP_440559.1_1 Forward -358 -349 8.65285 0.0586
NP_441659.2_8 Forward -359 -349 20.9245 0.000805
NP_441659.2_8 Reverse -350 -360 11.9764 0.0147
NP_441659.2_8 Forward -197 -187 3.02829 0.177
NP_440708.1_6 Forward -357 -338 -5.80207 0.234
NP_442346.1_5 Reverse -349 -359 16.303 0.00248
NP_442346.1_5 Forward -198 -188 14.7297 0.0103
NP_442346.1_5 Forward -360 -350 9.02648 0.118
NP_442346.1_5 Reverse -187 -197 5.28991 0.253
NP_440545.1_3 Reverse -346 -363 7.61033 0.0489
NP_440545.1_3 Forward -363 -346 4.16874 0.0738
NP_440545.1_3 Reverse -184 -201 -2.12444 0.179
NP_440545.1_3 Forward -201 -184 -6.54933 0.283
NP_441856.1_3 Forward -237 -218 -1.18052 0.235
NP_440459.1_2 Reverse -246 -263 7.217 0.299
NP_440010.1_6 Reverse -357 -376 9.83255 0.213
NP_440010.1_10 Forward -260 -241 12.4875 0.19
NP_441585.1_5 Reverse -172 -191 -1.47628 0.298
NP_441888.1_7 Forward -364 -350 3.73617 0.225
NP_440449.1_6 Reverse -187 -205 5.04615 0.284
NP_441833.1_4 Forward -358 -351 15.9687 0.0124
NP_441833.1_4 Reverse -351 -358 15.9687 0.0124
NP_441895.1_10 Reverse -365 -384 -27.6315 0.282
NP_442699.1_8 Forward -199 -180 -4.22878 0.238
NP_442699.1_10 Forward -161 -142 12.0942 0.246
NP_442162.1_9 Forward -358 -351 16.2637 0.0124
NP_442162.1_9 Reverse -351 -358 16.2637 0.0124
NP_440671.1_4 Reverse -344 -358 16.9125 0.0246
NP_440671.1_4 Reverse -95 -109 5.01447 0.297
NP_440224.1_1 Reverse -339 -358 8.35759 0.0765
NP_441973.1_5 Forward -366 -347 11.7008 0.198
NP_442199.1_5 Reverse -342 -361 -0.688862 0.177
NP_442140.1_3 Reverse -351 -361 16.2046 0.0255
NP_442140.1_3 Reverse -189 -199 8.73149 0.119
NP_442140.1_3 Forward -196 -186 8.4365 0.119
NP_442140.1_3 Forward -277 -267 3.91327 0.271
NP_440875.1_9 Forward -357 -347 8.27469 0.233
NP_441813.1_5 Reverse -348 -358 15.9097 0.01
NP_441813.1_5 Forward -361 -351 9.91146 0.021
NP_440590.1_4 Reverse -95 -108 9.16406 0.0381
NP_440590.1_4 Forward -120 -107 8.27909 0.0466
NP_440590.1_4 Reverse -351 -364 3.36254 0.0746
NP_440590.1_4 Reverse -249 -262 -1.25902 0.215
NP_440567.1_1 Forward -358 -344 18.6825 0.0136
NP_440567.1_1 Reverse -351 -365 6.19444 0.0871
NP_442497.1_10 Forward -358 -349 17.601 0.00813
NP_442497.1_10 Reverse -351 -360 10.4228 0.0087
NP_442497.1_10 Reverse -189 -198 0.29472 0.199
NP_440821.1_4 Reverse -348 -358 11.0914 0.0146
NP_440821.1_4 Forward -361 -351 10.2065 0.0163
NP_441239.1_9 Reverse -348 -360 14.6903 0.0258
NP_441239.1_9 Forward -361 -349 12.3303 0.0477
NP_441239.1_9 Reverse -186 -198 7.02048 0.173
NP_441239.1_9 Forward -199 -187 6.72548 0.178
NP_441951.1_9 Forward -142 -123 -0.000545616 0.261
NP_441892.1_1 Reverse -341 -358 -5.66436 0.285
NP_440665.1_1 Reverse -353 -372 -16.5201 0.291
NP_442044.1_1 Reverse -345 -364 -5.40875 0.187
NP_442105.1_9 Reverse -117 -131 15.7108 0.263
NP_440354.1_7 Reverse -271 -289 12.1139 0.224
NP_442138.1_9 Reverse -260 -279 9.24175 0.252
NP_440391.1_5 Forward -290 -271 6.98095 0.279
NP_440391.1_7 Forward -270 -251 12.3883 0.14
NP_442052.1_8 Forward -199 -189 14.7297 0.253
NP_440546.1_4 Forward -359 -349 13.5365 0.0459
NP_440546.1_4 Reverse -350 -360 11.8882 0.0679
NP_440546.1_6 Reverse -340 -359 15.9291 0.137
NP_440462.1_6 Reverse -348 -358 16.893 0.00853
NP_440462.1_6 Forward -361 -351 9.02648 0.0498
NP_442465.1_2 Reverse -171 -190 8.06178 0.15
NP_441184.1_3 Reverse -92 -111 0.982764 0.296
NP_442611.1_1 Forward -359 -340 11.3075 0.078
NP_442592.1_3 Forward -362 -343 9.14423 0.273
NP_442592.1_7 Forward -120 -101 16.3224 0.224
NP_440868.1_4 Forward -363 -351 20.2952 0.00865
NP_440868.1_4 Reverse -346 -358 13.2153 0.022
NP_442787.1_9 Reverse -282 -301 11.8975 0.296
NP_441868.1_4 Reverse -343 -357 14.4542 0.282
NP_441084.1_6 Reverse -348 -362 13.2224 0.14
NP_442460.1_7 Reverse -338 -357 6.09597 0.167
NP_440696.1_3 Forward -363 -345 2.37909 0.216
NP_442039.1_4 Forward -358 -351 15.1821 0.0124
NP_442039.1_4 Reverse -351 -358 15.1821 0.0124
NP_442039.1_7 Forward -195 -185 13.5497 0.211
NP_442039.1_7 Reverse -283 -293 6.76487 0.299
NP_441811.1_8 Reverse -39 -53 8.65272 0.233
NP_442891.1_3 Reverse -11 -25 20.7467 0.0418
NP_440825.1_7 Reverse -351 -361 12.4217 0.155
NP_442837.1_3 Forward -358 -351 15.7721 0.0124
NP_442837.1_3 Reverse -351 -358 15.7721 0.0124
NP_440160.1_9 Forward -359 -340 11.4058 0.216
NP_439994.1_4 Reverse -186 -205 19.2723 0.126
NP_442053.1_1 Forward -359 -350 18.3876 0.0007
NP_442053.1_1 Reverse -350 -359 18.3876 0.0007
NP_440505.1_3 Reverse -348 -358 15.123 0.014
NP_440505.1_3 Forward -361 -351 6.76487 0.169
NP_441701.1_3 Reverse -335 -352 8.10198 0.249
NP_441252.1_6 Forward -117 -110 11.6422 0.288
NP_441203.1_1 Forward -358 -339 -14.3569 0.185
NP_442532.1_7 Reverse -350 -364 4.52282 0.171
NP_440914.1_1 Forward -359 -349 16.3248 0.00196
NP_440914.1_1 Forward -54 -44 9.59102 0.183
NP_440914.1_1 Reverse -350 -360 8.6151 0.186
NP_440914.1_1 Forward -248 -238 7.34642 0.241
NP_441011.1_8 Reverse -351 -360 16.9127 0.00602
NP_441011.1_8 Forward -358 -349 16.6177 0.00602
NP_441011.1_8 Forward -233 -224 7.57121 0.17
NP_442533.1_6 Forward -359 -350 17.2076 0.00137
NP_442533.1_6 Reverse -350 -359 17.2076 0.00137
NP_442533.1_6 Forward -197 -188 7.17789 0.0948
NP_442533.1_6 Reverse -188 -197 6.68623 0.105
NP_442533.1_6 Forward -103 -94 5.11294 0.155
NP_442533.1_6 Reverse -112 -121 2.26134 0.266
NP_442541.1_10 Forward -354 -340 3.14559 0.254
NP_442229.1_1 Reverse -186 -200 12.9786 0.18
NP_443016.1_1 Reverse -182 -201 -8.55534 0.299
NP_441482.1_7 Reverse -344 -358 7.86607 0.0233
NP_441482.1_7 Forward -203 -189 -9.14519 0.194
NP_441482.1_7 Forward -365 -351 -10.6202 0.211
NP_439944.1_9 Forward -358 -348 17.6796 0.00347
NP_441028.1_6 Forward -130 -120 10.9926 0.193
NP_441028.1_6 Reverse -27 -37 5.78111 0.243
NP_442664.1_8 Forward -351 -332 17.3048 0.226
NP_440116.1_5 Forward -362 -345 10.9536 0.129
NP_441527.1_5 Reverse -348 -367 13.8621 0.287
NP_440115.1_6 Reverse -347 -357 7.45319 0.147
NP_440007.1_9 Forward -252 -238 4.22782 0.267
NP_440007.1_9 Forward -201 -187 4.03116 0.267
NP_440007.1_9 Reverse -346 -360 0.786239 0.29
NP_439965.1_1 Reverse -341 -360 17.5024 0.00987
NP_441347.1_5 Reverse -344 -358 12.782 0.238
NP_441059.1_2 Reverse -288 -307 -6.88371 0.268
NP_441170.1_4 Forward -63 -45 3.26407 0.283
NP_441972.1_5 Forward -80 -61 -9.047 0.278
NP_441106.1_1 Reverse -349 -358 18.486 0.0028
NP_441106.1_1 Forward -360 -351 18.191 0.0028
NP_440429.1_2 Forward -358 -339 10.5209 0.267
NP_439903.1_6 Reverse -347 -366 9.24175 0.124
NP_442306.1_10 Forward -348 -329 -14.5535 0.197
NP_441286.1_1 Forward -360 -348 4.8572 0.0272
NP_441286.1_1 Reverse -349 -361 -3.40261 0.145
NP_441286.1_1 Reverse -187 -199 -5.36923 0.197
NP_440670.1_8 Forward -359 -350 18.3876 0.000699
NP_440670.1_8 Reverse -350 -359 18.3876 0.000699
NP_440670.1_8 Forward -248 -239 3.93297 0.212
NP_440886.1_7 Forward -360 -350 17.7774 0.0011
NP_440886.1_7 Reverse -349 -359 8.04271 0.0805
NP_440886.1_7 Forward -55 -45 4.89613 0.213
NP_440828.1_1 Forward -46 -27 -1.67294 0.287
NP_442614.1_2 Forward -248 -234 10.0294 0.235
NP_442614.1_2 Forward -359 -345 7.37441 0.275
NP_442382.1_8 Reverse -33 -52 15.396 0.292
NP_442072.1_9 Reverse -349 -367 -13.9439 0.126
NP_442213.1_5 Reverse -328 -347 -1.96717 0.293
NP_442125.1_2 Forward -176 -157 9.93088 0.0678
NP_440907.2_8 Reverse -351 -361 14.2375 0.0312
NP_440907.2_8 Forward -358 -348 9.51767 0.103
NP_442264.1_2 Forward -207 -190 7.80699 0.228
NP_442264.1_5 Forward -121 -107 14.7492 0.222
NP_441021.1_1 Reverse -351 -370 -6.78538 0.18
NP_441463.1_3 Reverse -340 -359 3.73603 0.0982
NP_441463.1_5 Forward -104 -90 16.2242 0.188
NP_440501.1_2 Reverse -320 -339 13.7658 0.215
NP_441626.1_2 Forward -358 -351 15.7721 0.0124
NP_441626.1_2 Reverse -351 -358 15.7721 0.0124
NP_442211.1_3 Reverse -339 -358 8.5419 0.275
NP_442221.1_6 Reverse -242 -259 14.7885 0.177
NP_440107.1_5 Forward -360 -341 -2.65548 0.178
NP_442794.1_1 Reverse -184 -196 5.93884 0.198
NP_442615.1_1 Reverse -341 -359 3.06741 0.0585
NP_442467.1_5 Forward -81 -62 17.8069 0.233
NP_441962.1_4 Forward -202 -183 -6.68705 0.18
NP_441962.1_4 Reverse -345 -364 -8.35868 0.199
NP_440387.1_1 Reverse -350 -366 20.708 0.00295
NP_440387.1_1 Forward -359 -343 6.35172 0.0282
NP_440855.1_1 Reverse -243 -262 3.44104 0.188
NP_440855.1_5 Forward -355 -336 8.65176 0.285
NP_441431.1_2 Forward -200 -186 9.43874 0.186
NP_441431.1_2 Reverse -347 -361 8.3571 0.218
NP_441431.1_2 Forward -362 -348 7.57046 0.238
NP_441488.1_8 Forward -202 -188 10.1271 0.146
NP_441836.1_2 Forward -350 -331 -3.3438 0.237
NP_441993.1_1 Reverse -328 -347 4.77295 0.214
NP_441174.1_2 Reverse -347 -361 17.0108 0.0602
NP_440114.1_10 Reverse -350 -364 12.6843 0.0754
NP_440114.1_10 Forward -359 -345 10.9143 0.13
NP_440114.1_10 Forward -110 -96 5.80112 0.292
NP_440287.1_6 Reverse -348 -367 12.1925 0.127
NP_440287.1_6 Forward -368 -349 4.22769 0.206
NP_441720.1_2 Reverse -346 -365 6.78348 0.217
NP_440766.1_4 Reverse -346 -360 6.78443 0.0973
NP_439988.1_7 Forward -284 -270 12.0937 0.292
NP_442743.1_5 Forward -358 -339 18.1907 0.0604
NP_442743.1_5 Reverse -345 -364 7.47261 0.163
NP_441531.1_6 Forward -281 -268 13.3923 0.254
NP_441133.1_3 Reverse -284 -303 11.9958 0.295
NP_439910.1_2 Forward -367 -350 -13.3342 0.162
NP_439910.1_2 Reverse -217 -234 -22.6756 0.285
NP_440457.1_1 Reverse -346 -358 10.9537 0.092
NP_440798.1_6 Reverse -351 -364 5.52582 0.14
NP_440798.1_6 Forward -358 -345 0.904263 0.242
NP_440942.1_3 Forward -214 -195 2.26107 0.298
NP_440473.1_1 Reverse -347 -366 12.9927 0.211
NP_442509.1_9 Reverse -350 -360 16.2041 0.00739
NP_442509.1_9 Forward -359 -349 8.04271 0.192
NP_440554.1_4 Forward -358 -348 16.1063 0.0189
NP_440554.1_4 Reverse -351 -361 7.35486 0.103
NP_442737.1_5 Forward -49 -30 17.436 0.109
NP_441885.1_5 Reverse -350 -360 11.4848 0.00668
NP_441885.1_5 Forward -359 -349 11.3864 0.00668
NP_441885.1_5 Forward -103 -93 7.84651 0.0419
NP_440478.1_9 Reverse -342 -361 14.5524 0.195
NP_442341.1_7 Forward -55 -41 10.3243 0.0665
NP_442341.1_7 Reverse -349 -363 7.17775 0.11
NP_442341.1_9 Forward -361 -347 15.4369 0.0473
NP_442341.1_9 Reverse -348 -362 7.27547 0.202
NP_441173.1_9 Forward -293 -285 12.1137 0.21
NP_443000.1_7 Reverse -348 -358 17.4829 0.00719
NP_443000.1_7 Reverse -223 -233 2.33998 0.226
NP_443000.1_7 Forward -361 -351 1.94665 0.226
NP_440076.1_5 Reverse -343 -362 14.7483 0.201
NP_443059.1_10 Forward -343 -324 3.24359 0.23
NP_440275.1_3 Reverse -348 -358 9.12481 0.055
NP_440275.1_3 Forward -361 -351 8.33817 0.0602
NP_440091.1_1 Reverse -346 -358 1.51394 0.197
NP_440091.1_1 Forward -363 -351 0.727295 0.233
NP_441397.1_8 Forward -194 -181 14.3856 0.198
NP_440679.1_10 Reverse -352 -371 -18.2901 0.278
NP_441122.1_1 Reverse -184 -199 3.71647 0.28
NP_440175.1_4 Reverse -246 -265 -12.8819 0.237
NP_440149.1_8 Reverse -350 -369 -3.3438 0.187
NP_442373.1_2 Reverse -311 -330 -11.2103 0.293
NP_440216.1_1 Forward -359 -345 6.58777 0.0145
NP_440216.1_1 Reverse -350 -364 -1.18038 0.0301
NP_440216.1_9 Forward -195 -186 16.9127 0.116
NP_440216.1_9 Forward -319 -310 10.4228 0.286
NP_440172.1_1 Forward -359 -349 17.5813 0.00421
NP_440172.1_1 Reverse -350 -360 8.73149 0.0586
NP_442015.1_10 Forward -363 -350 10.7374 0.0391
NP_442015.1_10 Reverse -346 -359 1.49425 0.204
NP_442015.1_10 Reverse -184 -197 1.10092 0.213
NP_442015.1_10 Reverse -90 -103 0.0192843 0.245
NP_441226.1_7 Forward -358 -351 14.4934 0.0123
NP_441226.1_7 Reverse -351 -358 14.4934 0.0123
NP_441226.1_7 Reverse -113 -120 5.64364 0.286
NP_441485.1_9 Reverse -243 -262 17.5024 0.226
NP_441111.1_7 Forward -358 -350 18.7023 0.00294
NP_441111.1_7 Reverse -351 -359 18.7023 0.00294
NP_441111.1_7 Reverse -95 -103 -0.472234 0.131
NP_442379.1_10 Reverse -343 -360 -1.73112 0.223
NP_441766.1_2 Forward -359 -350 17.5026 0.00297
NP_441766.1_2 Reverse -350 -359 17.5026 0.00297
NP_440416.1_1 Forward -359 -340 -12.1936 0.272
NP_440416.1_9 Reverse -343 -362 -6.39206 0.0899
NP_440416.1_9 Forward -110 -91 -7.27704 0.0988
NP_440416.1_9 Forward -49 -30 -9.93197 0.135
NP_440416.1_9 Forward -354 -335 -15.1435 0.186
NP_440416.1_9 Reverse -181 -200 -17.8968 0.248
NP_440416.1_9 Forward -355 -336 -21.83 0.297
NP_443052.1_8 Reverse -340 -359 -11.0136 0.221
NP_442154.1_1 Reverse -324 -342 -15.0255 0.218
NP_442154.1_1 Reverse -360 -378 -19.2537 0.294
NP_440261.1_5 Reverse -351 -364 -2.53732 0.0924
NP_440261.1_5 Reverse -189 -202 -4.50394 0.151
NP_440261.1_5 Forward -358 -345 -10.6988 0.203
NP_440988.1_10 Forward -250 -236 3.73707 0.281
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAATCCCGAAAAGTATCTTCCCCATCCTCCGCAAAAATGTCGGCGATCGCCTTGCCAGCCACCCGCTCAATCAACACATCCGCATCGAAAAAACGGTACCCCAACTGTTCTGCCAACAACGGCCCGACGGTGGATTTACCACTGCCCATCATGCCGATCAGAAACAGGTTAACGCCTTGTAATTGTTCTTTGATTAGATCCTGGGCCATGGCAAAAGTTACAGAGGTTGAAAAATAGTGAACAGTAATTGGATGTCAGTCCGAAGCCAATTTGCCCCCTAGGGTTCGGCAACGCATCGGCGTTCCCTAGCTTAAATTATCTTGATGTCCAAAGAAGGCTCGCTTTCGGGAATCACCATTACCATTGGAGGGAAAGACGTTGAACTTGTTTAATCGCCATT

CDS

ATGGGTAAGAATCTCCTCGAACAACTGCGCCAATTTACAGTGGTGGTGGCCGACACCGGCGACATCCAAGCCATTGAAACCTTTACCCCCAGGGATTCCACCACTAATCCTTCTTTGATTACGGCGGCGGCCCAGATGCCCCAGTACCAGGAAATTGTGGACAGCACCCTGCTCAAAGCTAAGGACGAAGCTGGGGAAAATGCATCTATTAAAGACATTGTCCGATTGGCCTTTGACCGTTTGGCGGTGGCTTTTGGCCTCAAAATTCTGCAAATTATCCCCGGCCGGGTTTCTACGGAAGTTGATGCCCGCCTTTCCTACGACACGGAAGCCACCATTGCCAAAGCTCGCTACCTAATTGGGGAATATGCCAAAGCTGGCATTGATAAAAAACGCATTCTGATCAAAATTGCTTCCACTTGGGAGGGTATTAAGGCTGCAGAAGTATTGGAACAAGAAGGTATTCACTGTAACCTTACTCTACTATTCGGTCTCCACCAGGCGATCGCCTGTGCCGAAGCCAAAGTCACCCTAATTTCCCCCTTTGTGGGACGCATTTTGGATTGGTACAAAAAAAGTACTGGCAAGGAATATGACAGCCACGAAGACCCAGGGGTACAGTCTGTTACAACCATTTACAACTACTACAAACGCTTTGGTTACAAAACTGAAGTGATGGGAGCCAGCTTCCGTAACATTGGCGAAATCATCGAACTGGCCGGCTGTGACCTGTTGACCATTTCCCCCCAACTGTTGGATCAACTGCGGAACACCGAAGGGGATTTACCTCGCAAACTCGACCCCGCCACGGTGCCCCAGGACATTGAAAAAATTGTTATGGACAAGGCCACCTTCGACAAAATGCATGCCGAAGATCCGATGGCCTCGGAAAAACTGGCCGAAGGCATTGCCGGTTTCACCAAGGCTCTGGAGGTGTTGGAACATTTATTGGAAGAAAGGTTAAAAGTTCTCGATGGCCAAGAGCACATCAAACATGGGGCAGAGGAAATTTTCCATGCCTATGATCTAGATGGGGACGGTTTTATTACCAGGGAGGAATGGGCCGGCACCGATGTGGTTTTTGATGCCCTAGACCGGGACCATGATGGCAAAATCACCGCCGCTGAAATGTCCGCTGGGTTGGGAGCCGCTTTCCGTTTAGCCTCTGTTGGTTAG

Protein

MGKNLLEQLRQFTVVVADTGDIQAIETFTPRDSTTNPSLITAAAQMPQYQEIVDSTLLKAKDEAGENASIKDIVRLAFDRLAVAFGLKILQIIPGRVSTEVDARLSYDTEATIAKARYLIGEYAKAGIDKKRILIKIASTWEGIKAAEVLEQEGIHCNLTLLFGLHQAIACAEAKVTLISPFVGRILDWYKKSTGKEYDSHEDPGVQSVTTIYNYYKRFGYKTEVMGASFRNIGEIIELAGCDLLTISPQLLDQLRNTEGDLPRKLDPATVPQDIEKIVMDKATFDKMHAEDPMASEKLAEGIAGFTKALEVLEHLLEERLKVLDGQEHIKHGAEEIFHAYDLDGDGFITREEWAGTDVVFDALDRDHDGKITAAEMSAGLGAAFRLASVG