Your browser is old and dusty. Try Google Chrome!

Details for slr1790

ORF slr1790
Accession NP_440128.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -360 -346 11.701 0.236
NP_440815.1_2 Reverse -334 -348 18.7801 0.162
NP_441453.1_7 Forward -40 -33 11.6422 0.298
NP_442151.1_6 Reverse -18 -32 6.78443 0.221
NP_440259.1_4 Reverse -268 -282 11.4317 0.255
NP_440120.1_4 Forward -83 -69 14.4542 0.273
NP_442623.1_4 Reverse -61 -80 -0.4922 0.252
NP_442744.1_9 Forward -249 -235 13.1262 0.28
NP_442861.1_1 Forward -321 -302 9.63589 0.295
NP_442861.1_4 Forward -221 -202 11.0117 0.129
NP_440061.1_9 Reverse -254 -268 6.68548 0.235
NP_441054.1_2 Forward -156 -137 15.5357 0.136
NP_440044.1_8 Forward -343 -324 -3.93378 0.295
NP_441781.1_7 Forward -163 -144 -1.08219 0.268
NP_441492.1_5 Forward -300 -281 2.87099 0.3
NP_439918.1_2 Forward -104 -85 -3.44213 0.254
NP_439957.1_5 Forward -248 -229 8.25926 0.273
NP_441434.1_7 Forward -25 -11 1.86788 0.29
NP_442445.1_1 Reverse -149 -168 17.699 0.122
NP_442111.1_4 Forward -56 -42 3.04785 0.257
NP_440376.1_1 Forward -267 -258 1.1797 0.255
NP_441002.1_5 Forward -248 -229 9.3409 0.296
NP_442687.1_7 Reverse -17 -27 4.0116 0.271
NP_442946.1_7 Forward -165 -150 19.5528 0.142
NP_442530.1_2 Reverse -289 -299 13.1564 0.263
NP_440642.1_10 Forward -347 -333 1.76896 0.289
NP_442205.1_9 Forward -271 -255 2.02515 0.224
NP_442223.1_7 Reverse -250 -269 10.0292 0.239
NP_442544.1_2 Forward -43 -29 -1.18038 0.272
NP_440720.1_6 Reverse -288 -306 18.407 0.174
NP_440607.1_8 Reverse -146 -165 8.75091 0.153
NP_442937.1_5 Reverse -149 -168 13.0775 0.095
NP_440318.1_1 Forward -169 -150 7.86593 0.2
NP_442836.1_10 Forward -118 -108 13.1564 0.227
NP_439905.1_1 Reverse -327 -340 8.37742 0.234
NP_440858.1_1 Forward -262 -243 0.884433 0.212
NP_442064.1_4 Forward -167 -148 10.4217 0.196
NP_442236.1_3 Forward -172 -153 7.66927 0.248
NP_440993.1_4 Reverse -26 -43 7.512 0.227
NP_440827.1_3 Reverse -110 -129 10.3242 0.299
NP_442210.1_9 Forward -354 -336 10.9339 0.23
NP_440138.1_6 Reverse -149 -168 2.35861 0.267
NP_441099.1_6 Reverse -38 -57 10.8159 0.282
NP_440147.1_4 Reverse -16 -29 5.13249 0.136
NP_441550.1_8 Reverse -16 -26 5.58445 0.242
NP_442004.1_6 Forward -356 -342 3.44117 0.24
NP_440736.1_4 Reverse -215 -234 8.35677 0.295
NP_440983.1_5 Forward -163 -144 -7.96535 0.294
NP_440983.1_5 Reverse -26 -45 -8.752 0.295
NP_440260.1_8 Reverse -49 -67 -3.12744 0.249
NP_440260.1_8 Forward -44 -26 -3.81576 0.257
NP_442281.1_1 Reverse -346 -360 2.75226 0.257
NP_441079.1_7 Reverse -231 -250 7.27514 0.122
NP_001035871.2_7 Forward -120 -110 12.8614 0.243
NP_441644.1_6 Reverse -41 -51 3.32285 0.288
NP_442215.1_2 Reverse -158 -174 0.746852 0.148
NP_442215.1_2 Forward -165 -149 -4.26803 0.23
NP_442029.1_10 Forward -23 -4 5.11266 0.287
NP_440253.1_2 Reverse -139 -157 6.41066 0.0812
NP_440780.1_1 Forward -328 -309 12.9387 0.234
NP_441751.2_8 Reverse -47 -61 3.93283 0.0596
NP_442142.1_4 Forward -262 -249 5.32859 0.194
NP_442142.1_4 Forward -166 -153 2.18201 0.299
NP_440357.1_3 Forward -270 -251 2.75272 0.245
NP_441015.1_10 Forward -270 -251 -6.49039 0.249
NP_441876.1_9 Reverse -322 -332 12.0743 0.267
NP_441764.1_4 Reverse -284 -301 12.9419 0.173
NP_442719.1_2 Forward -138 -120 -8.63467 0.252
NP_441612.1_2 Reverse -160 -170 8.25885 0.228
NP_440031.1_10 Forward -122 -103 4.916 0.256
NP_442342.1_9 Reverse -257 -273 1.92682 0.296
NP_441114.1_3 Reverse -53 -62 7.86621 0.231
NP_441114.1_3 Forward -161 -152 7.37455 0.239
NP_440558.1_2 Forward -166 -147 7.07928 0.124
NP_440558.1_2 Reverse -332 -351 -4.22878 0.243
NP_441557.1_4 Reverse -157 -171 10.521 0.291
NP_441433.1_8 Forward -264 -245 -0.295539 0.244
NP_441739.1_2 Forward -250 -234 2.51614 0.288
NP_442397.1_1 Forward -170 -156 15.6542 0.24
NP_442347.1_2 Reverse -342 -351 4.12963 0.284
NP_442645.1_2 Forward -171 -152 -20.65 0.288
NP_442594.1_8 Forward -372 -353 2.85105 0.293
NP_442998.1_5 Forward -82 -72 8.23984 0.267
NP_442998.1_10 Reverse -48 -55 10.2655 0.0946
NP_442007.1_6 Forward -338 -319 6.09597 0.212
NP_442993.1_1 Reverse -120 -136 -12.7245 0.278
NP_442386.1_9 Forward -62 -53 6.68581 0.219
NP_441404.1_8 Reverse -43 -57 12.6836 0.271
NP_441271.1_8 Forward -311 -301 14.0414 0.266
NP_440168.1_2 Forward -171 -152 -4.42544 0.282
NP_440168.1_9 Reverse -137 -156 -1.27885 0.273
NP_442474.1_7 Forward -103 -84 14.5524 0.154
NP_439937.1_9 Reverse -350 -367 -11.0732 0.241
NP_441167.1_1 Forward -300 -281 4.42435 0.256
NP_442511.1_5 Reverse -293 -312 12.9603 0.265
NP_442384.1_10 Forward -27 -14 10.344 0.0461
NP_442384.1_10 Reverse -341 -354 9.85238 0.0484
NP_442384.1_10 Reverse -160 -173 0.707601 0.282
NP_441018.1_7 Forward -236 -217 6.78429 0.282
NP_441018.1_7 Reverse -144 -163 6.29264 0.294
NP_440562.1_2 Forward -227 -210 16.1651 0.187
NP_441592.1_4 Reverse -154 -173 -1.08219 0.247
NP_441592.1_4 Reverse -52 -71 -3.04881 0.274
NP_440888.1_2 Reverse -259 -273 9.43874 0.127
NP_440822.1_8 Forward -114 -95 7.37428 0.262
NP_440052.1_4 Reverse -331 -350 13.8641 0.177
NP_441621.1_7 Forward -374 -360 -5.50694 0.254
NP_441410.1_3 Forward -64 -45 10.8159 0.185
NP_441785.1_1 Forward -169 -155 12.4475 0.245
NP_441033.1_4 Forward -339 -320 18.3865 0.0594
NP_440128.1_3 Forward -137 -118 18.0924 0.181
NP_440128.1_4 Forward -327 -308 19.3707 0.0835
NP_440128.1_5 Forward -363 -344 20.7473 0.0356
NP_440673.1_3 Forward -161 -154 8.98723 0.203
NP_441052.1_2 Reverse -52 -62 2.92996 0.187
NP_441052.1_2 Forward -265 -255 2.14332 0.216
NP_441052.1_2 Forward -169 -159 1.84832 0.225
NP_440436.1_4 Forward -162 -153 7.76745 0.124
NP_441884.1_9 Forward -271 -252 -11.9969 0.135
NP_441884.1_9 Reverse -238 -257 -23.7966 0.284
NP_442907.1_9 Forward -60 -41 -0.000545616 0.212
NP_442873.1_9 Reverse -5 -24 3.83357 0.287
NP_442515.1_1 Forward -268 -254 2.45787 0.135
NP_442709.1_2 Reverse -347 -366 6.09517 0.12
NP_442689.1_8 Forward -258 -241 -2.3211 0.235
NP_442843.1_1 Forward -155 -136 -10.9153 0.282
NP_440431.1_3 Reverse -200 -219 -8.16202 0.226
NP_440588.1_2 Reverse -247 -266 -1.96717 0.158
NP_440588.1_5 Reverse -164 -178 15.6743 0.215
NP_440023.1_7 Forward -77 -58 5.99764 0.269
NP_441003.1_9 Reverse -247 -266 14.1591 0.213
NP_442243.1_1 Reverse -51 -69 -1.75153 0.279
NP_442038.1_7 Reverse -60 -79 13.8641 0.101
NP_442729.1_5 Reverse -153 -163 9.12481 0.235
NP_442348.1_2 Reverse -121 -130 10.6195 0.259
NP_441432.1_3 Reverse -294 -313 9.53674 0.298
NP_441432.1_8 Reverse -153 -162 5.40793 0.158
NP_441333.1_1 Reverse -274 -284 14.0684 0.217
NP_441732.1_2 Reverse -337 -353 -16.5594 0.174
NP_441800.1_3 Forward -72 -54 5.23069 0.286
NP_441185.1_2 Reverse -302 -321 5.11266 0.26
NP_440545.1_3 Reverse -37 -54 -7.13932 0.298
NP_441786.1_3 Forward -40 -21 6.68596 0.287
NP_441923.1_6 Reverse -149 -163 8.16106 0.28
NP_440486.1_6 Forward -266 -247 13.4708 0.207
NP_440459.1_2 Reverse -145 -162 14.4935 0.119
NP_440010.1_3 Reverse -110 -129 -6.29373 0.25
NP_440010.1_10 Forward -39 -20 3.14605 0.264
NP_442603.1_7 Forward -265 -251 7.07881 0.216
NP_440751.1_3 Reverse -252 -271 17.1082 0.127
NP_441329.1_6 Reverse -179 -198 -1.57604 0.293
NP_442699.1_3 Reverse -91 -110 2.0644 0.226
NP_440671.1_5 Reverse -259 -273 15.9285 0.208
NP_442089.1_6 Reverse -259 -278 3.93269 0.262
NP_440590.1_4 Forward -162 -149 -3.32397 0.255
NP_441892.1_1 Reverse -32 -49 -5.76269 0.288
NP_442669.1_1 Forward -212 -193 2.85105 0.175
NP_442044.1_1 Forward -273 -254 5.70265 0.119
NP_442044.1_1 Reverse -336 -355 -13.8652 0.28
NP_442270.1_9 Reverse -143 -162 -6.58872 0.207
NP_441874.1_1 Reverse -150 -164 12.291 0.24
NP_440462.1_4 Reverse -4 -18 10.6193 0.23
NP_442479.1_5 Forward -324 -305 10.1721 0.222
NP_442840.1_10 Reverse -323 -342 13.3725 0.229
NP_442402.1_10 Forward -169 -159 10.5993 0.287
NP_440036.1_10 Forward -73 -61 14.592 0.284
NP_441848.1_7 Reverse -138 -157 -3.14789 0.277
NP_440843.1_4 Forward -152 -133 12.5858 0.181
NP_441811.1_1 Forward -345 -326 4.03102 0.299
NP_442360.1_5 Reverse -114 -124 12.6647 0.298
NP_441959.1_5 Reverse -98 -117 13.4708 0.113
NP_441102.1_2 Reverse -233 -252 10.7175 0.226
NP_442533.1_6 Forward -265 -256 2.458 0.255
NP_442533.1_6 Reverse -58 -67 1.96635 0.28
NP_441482.1_7 Reverse -335 -349 -11.6035 0.275
NP_442203.1_1 Forward -285 -271 17.4866 0.15
NP_440816.1_8 Reverse -300 -314 16.2235 0.282
NP_442202.1_6 Reverse -223 -242 2.85105 0.265
NP_442202.1_10 Reverse -325 -339 4.03116 0.278
NP_441106.1_3 Forward -198 -179 15.5357 0.135
NP_442058.1_1 Forward -191 -172 17.6982 0.115
NP_440886.1_7 Reverse -360 -370 3.32285 0.287
NP_440083.1_9 Reverse -209 -228 10.7772 0.281
NP_442264.1_2 Forward -269 -252 4.95539 0.288
NP_440841.1_4 Reverse -152 -171 -9.63698 0.26
NP_442794.1_1 Reverse -135 -147 5.34885 0.225
NP_440387.1_1 Forward -55 -39 -6.13632 0.268
NP_440855.1_5 Reverse -50 -69 5.11187 0.285
NP_441431.1_3 Forward -73 -54 4.916 0.263
NP_441065.1_2 Reverse -307 -326 13.4617 0.18
NP_441853.1_7 Forward -33 -14 15.8307 0.245
NP_441510.2_7 Reverse -26 -40 9.83206 0.281
NP_442930.1_1 Reverse -293 -303 11.091 0.26
NP_440502.1_7 Reverse -152 -171 12.2908 0.291
NP_441332.1_6 Reverse -58 -68 12.4212 0.23
NP_440524.1_2 Forward -161 -142 -2.0655 0.27
NP_442514.1_5 Reverse -50 -69 19.6648 0.0153
NP_440756.1_2 Forward -299 -281 19.1397 0.254
NP_441428.1_8 Reverse -251 -270 1.76941 0.296
NP_442703.1_9 Forward -300 -282 3.16574 0.299
NP_443000.1_7 Forward -352 -342 8.82982 0.0437
NP_443000.1_7 Reverse -339 -349 1.65166 0.235
NP_440127.1_1 Reverse -59 -78 28.7121 0.000685
NP_440127.1_3 Reverse -264 -283 22.418 0.0388
NP_440127.1_4 Reverse -149 -163 19.0758 0.139
NP_440127.1_5 Reverse -231 -249 21.947 0.0566
NP_441207.1_7 Reverse -240 -254 7.7064 0.295
NP_439929.1_4 Reverse -302 -316 17.9873 0.273
NP_440216.1_9 Reverse -209 -218 14.0611 0.184
NP_440216.1_9 Reverse -285 -294 5.50626 0.292
NP_440216.1_9 Forward -161 -152 5.50626 0.292
NP_442015.1_3 Reverse -16 -35 16.2232 0.162
NP_442015.1_10 Reverse -252 -265 1.39592 0.204
NP_440416.1_9 Forward -164 -145 -17.7985 0.247
NP_440416.1_9 Reverse -359 -378 -18.5851 0.26
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTTGAATGATATTGTTTAAATCCGAGGGACGATATGGGCGTAGATGGATGGTGTTCACTTTGGCTACCTTGGGACGAAAGTTGCCAATCTTTGGCTGAGAAATATTTTGCAATGTAAAGTTAAAAAGCAGAGGGGGTCAGCACCATGGTTAAAATTTCCGATATCTTGGTCGTTTTAATTGCTTTCCTTGGAACTTGCTTGTAATGTAACCAGTTTTAATACACTCCCTTGGTTTTCACCATTGCCAATGCAGAGATTTGGAGGGTTAAACCAAGTCCCCTAGGGTCTGGGAACAGGACTTTGCATTTGAATCGGACAGTGCAAAATGATTTGGGACTGGGCAAGGCGATATAATGGCCCCCTTGGGTATGAGCTGATGACCCACCCTGTTCCTGGGAA

CDS

ATGCCCAAGCGCGAGTATTTCTCCCTCCCTTGTCCACTGTCAACGTTTACCATGGCCTACTACTGGTTTAAAGCCTTCCACTTGATTGGCATTGTTGTTTGGTTTGCTGGATTATTTTATTTAGTGCGTCTTTTTGTCTATCACGCCGAGGCAGACCAGGAGCCGGAACCAGCTAAAACTATCCTCAAAAAACAGTATGAGTTGATGGAAAAGCGGCTTTACAACATCATCACTACCCCCGGCATGGTAGTTACGGTGGCTATGGCGATCGGTCTCATTTTCACAGAACCCGAAATTCTCAAATCCGGCTGGCTCCACATCAAACTCACCTTTGTGGCGTTACTGTTGCTTTACCATTTCTATTGTGGTCGGGTGATGAAAAAGCTAGCCCAGGGGGAATCCCAATGGAGTGGGCAACAGTTCCGGGCTTTAAATGAGGCACCGACTATTTTGCTCGTGGTGATTGTCCTACTGGCGGTGTTTAAGAATAATTTGCCCCTGGATGCGACCACTTGGTTAATTGTAGCTTTGGTTATTGCCATGGCTGCTTCGATTCAACTCTACGCTAAAAAACGTCGCCGGGACCAAGCACTATTAACGGAACAGCAAAAAGCGGCTTCTGCTCAGAATTAG

Protein

MPKREYFSLPCPLSTFTMAYYWFKAFHLIGIVVWFAGLFYLVRLFVYHAEADQEPEPAKTILKKQYELMEKRLYNIITTPGMVVTVAMAIGLIFTEPEILKSGWLHIKLTFVALLLLYHFYCGRVMKKLAQGESQWSGQQFRALNEAPTILLVVIVLLAVFKNNLPLDATTWLIVALVIAMAASIQLYAKKRRRDQALLTEQQKAASAQN