Your browser is old and dusty. Try Google Chrome!

Details for slr1780

ORF slr1780
Accession NP_440112.1
Symbol ycf54
Category hypothetical protein YCF54
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -273 -259 5.60446 0.132
NP_441061.1_2 Reverse -218 -232 5.60446 0.132
NP_441061.1_2 Reverse -62 -76 -0.295402 0.227
NP_440795.1_7 Forward -225 -218 14.6904 0.0123
NP_440795.1_7 Reverse -218 -225 14.6904 0.0123
NP_440795.1_7 Reverse -100 -107 7.80726 0.232
NP_440694.1_6 Forward -271 -252 10.2259 0.203
NP_441418.1_6 Forward -226 -207 -20.1584 0.106
NP_441418.1_6 Reverse -217 -236 -28.9099 0.213
NP_443032.1_8 Forward -176 -157 1.17943 0.238
NP_442291.1_5 Forward -227 -211 -1.51476 0.199
NP_440897.1_6 Forward -70 -51 -2.16459 0.205
NP_441453.1_4 Reverse -217 -225 16.539 0.00633
NP_441453.1_4 Forward -226 -218 16.539 0.00633
NP_441453.1_7 Reverse -141 -148 12.1338 0.295
NP_441453.1_8 Reverse -167 -184 13.8052 0.205
NP_441960.1_3 Reverse -91 -110 13.3189 0.287
NP_442151.1_6 Reverse -217 -231 11.0127 0.109
NP_442151.1_6 Forward -226 -212 9.5377 0.145
NP_441818.1_1 Reverse -218 -229 9.79292 0.232
NP_441818.1_1 Forward -225 -214 9.20294 0.25
NP_441818.1_9 Reverse -91 -110 -5.21209 0.251
NP_442744.1_8 Reverse -217 -236 1.47442 0.216
NP_442173.1_1 Forward -225 -217 15.4574 0.00633
NP_442173.1_1 Reverse -218 -226 15.4574 0.00633
NP_442752.1_4 Forward -226 -219 13.8055 0.0199
NP_442752.1_4 Reverse -217 -224 13.8055 0.0199
NP_443027.1_4 Reverse -215 -225 13.2547 0.0521
NP_443027.1_4 Forward -228 -218 11.0914 0.107
NP_439997.1_4 Reverse -267 -286 7.37428 0.266
NP_442975.1_10 Reverse -213 -227 12.782 0.0459
NP_441225.1_4 Reverse -63 -82 -12.5869 0.285
NP_440784.1_7 Forward -225 -218 15.9687 0.0123
NP_440784.1_7 Reverse -218 -225 15.9687 0.0123
NP_440061.1_9 Reverse -215 -229 19.3701 0.00586
NP_440061.1_9 Reverse -166 -180 12.0937 0.102
NP_440061.1_9 Reverse -65 -79 10.717 0.123
NP_440061.1_9 Forward -275 -261 9.04542 0.154
NP_440061.1_9 Forward -276 -262 8.65209 0.167
NP_440061.1_9 Forward -228 -214 5.21053 0.293
NP_441054.1_2 Reverse -299 -318 10.3242 0.284
NP_441476.1_5 Reverse -15 -34 -1.27885 0.202
NP_442062.1_8 Reverse -217 -227 17.3846 0.00193
NP_442062.1_8 Forward -226 -216 10.3048 0.0493
NP_440761.1_4 Reverse -212 -231 -13.8652 0.257
NP_442974.1_5 Reverse -226 -245 11.2092 0.177
NP_442974.1_8 Reverse -241 -260 15.7316 0.294
NP_441859.1_3 Forward -227 -208 2.75194 0.257
NP_440304.1_4 Reverse -215 -225 10.8948 0.051
NP_440304.1_4 Reverse -263 -273 4.60159 0.258
NP_440304.1_4 Reverse -203 -213 3.02829 0.299
NP_440304.1_4 Forward -228 -218 1.84832 0.299
NP_442242.1_4 Forward -225 -218 14.3954 0.0124
NP_442242.1_4 Reverse -218 -225 14.3954 0.0124
NP_441581.1_6 Forward -267 -248 10.359 0.284
NP_441581.1_6 Reverse -218 -237 9.77726 0.291
NP_439918.1_2 Reverse -298 -317 -0.4922 0.232
NP_441208.1_9 Forward -229 -215 7.86607 0.219
NP_440764.1_10 Reverse -11 -30 9.34008 0.297
NP_441594.1_6 Reverse -208 -227 1.57275 0.266
NP_441594.1_6 Forward -235 -216 0.392778 0.287
NP_440132.1_1 Reverse -257 -275 9.45892 0.236
NP_442110.1_7 Forward -183 -169 3.04785 0.218
NP_442110.1_7 Forward -226 -212 2.85119 0.222
NP_442110.1_7 Reverse -217 -231 1.76955 0.222
NP_442367.1_1 Reverse -60 -79 -13.7669 0.286
NP_442726.1_4 Forward -125 -106 5.30933 0.269
NP_441925.1_4 Reverse -225 -244 -10.5227 0.24
NP_441925.1_4 Reverse -57 -76 -16.4225 0.282
NP_441925.1_4 Forward -272 -253 -16.8158 0.285
NP_440330.1_2 Reverse -252 -271 12.3892 0.282
NP_440856.1_1 Reverse -207 -226 -5.99873 0.297
NP_440856.1_7 Reverse -67 -86 -2.55715 0.191
NP_441083.1_5 Reverse -217 -227 20.3345 0.00053
NP_441083.1_5 Forward -226 -216 11.2881 0.0159
NP_442245.1_7 Forward -80 -62 14.8671 0.153
NP_441738.1_2 Forward -224 -217 15.28 0.0102
NP_441738.1_2 Reverse -219 -226 15.28 0.0102
NP_441738.1_4 Reverse -240 -259 4.916 0.209
NP_441558.1_5 Reverse -215 -234 10.7175 0.0937
NP_441558.1_5 Forward -228 -209 10.5209 0.0968
NP_440209.1_1 Reverse -217 -225 18.1123 0.00295
NP_440209.1_1 Forward -226 -218 18.1123 0.00295
NP_442889.1_8 Reverse -214 -228 11.307 0.0733
NP_440447.1_6 Forward -234 -216 5.62401 0.145
NP_441713.1_1 Forward -232 -213 -7.57203 0.133
NP_441713.1_8 Forward -230 -212 10.9339 0.244
NP_440178.1_7 Reverse -315 -334 -22.715 0.272
NP_442570.1_3 Forward -250 -231 -7.57203 0.272
NP_442570.1_3 Forward -148 -129 -9.53865 0.299
NP_442570.1_3 Reverse -306 -325 -9.63698 0.3
NP_441716.1_1 Reverse -217 -231 19.9608 0.00829
NP_441716.1_1 Forward -232 -218 5.99778 0.208
NP_441716.1_1 Forward -226 -212 3.73617 0.259
NP_441598.1_3 Forward -264 -245 21.6153 0.0282
NP_442111.1_4 Forward -227 -213 13.6676 0.0383
NP_442111.1_4 Reverse -216 -230 11.6026 0.0488
NP_440343.1_3 Forward -272 -254 12.703 0.132
NP_440343.1_10 Reverse -47 -65 11.4247 0.267
NP_440906.1_5 Forward -225 -218 15.8704 0.0124
NP_440906.1_5 Reverse -218 -225 15.8704 0.0124
NP_440747.1_1 Forward -90 -72 8.86894 0.246
NP_440747.1_10 Forward -229 -217 26.5883 0.000317
NP_440747.1_10 Reverse -214 -226 7.4138 0.00422
NP_441130.1_10 Forward -228 -214 13.6676 0.0612
NP_441854.1_10 Reverse -320 -339 3.53937 0.282
NP_441486.1_1 Reverse -214 -228 -3.04867 0.175
NP_442634.1_4 Reverse -215 -229 7.86607 0.0479
NP_442634.1_4 Forward -228 -214 -1.67204 0.149
NP_440842.1_10 Forward -197 -183 2.94952 0.269
NP_440057.1_1 Forward -324 -305 9.14423 0.271
NP_441014.1_8 Forward -264 -245 -9.53865 0.296
NP_441014.1_10 Reverse -120 -139 0.490334 0.243
NP_442848.1_5 Forward -109 -91 -2.43913 0.286
NP_441012.1_4 Reverse -170 -183 16.3422 0.15
NP_443018.1_3 Forward -225 -218 14.8871 0.0123
NP_443018.1_3 Reverse -218 -225 14.8871 0.0123
NP_443018.1_3 Reverse -169 -176 9.38056 0.128
NP_441634.1_8 Forward -228 -214 5.01447 0.114
NP_441634.1_8 Reverse -65 -79 0.687908 0.219
NP_441634.1_8 Forward -238 -224 -3.04867 0.295
NP_441634.1_9 Reverse -239 -258 18.3865 0.104
NP_441634.1_9 Forward -182 -163 18.0915 0.104
NP_440376.1_1 Forward -226 -217 19.4693 0.000692
NP_440376.1_1 Reverse -217 -226 19.4693 0.000692
NP_440376.1_1 Reverse -264 -273 -0.0986038 0.285
NP_441588.1_4 Forward -224 -214 6.76487 0.185
NP_443065.1_6 Forward -230 -211 1.57275 0.237
NP_442687.1_7 Reverse -216 -226 9.02648 0.0994
NP_442687.1_7 Forward -227 -217 8.92815 0.0994
NP_442485.1_3 Forward -237 -218 -5.21209 0.287
NP_441013.1_2 Forward -266 -248 0.0191479 0.254
NP_441013.1_2 Forward -188 -170 -4.79907 0.299
NP_441422.1_7 Reverse -215 -232 -2.51776 0.215
NP_440533.1_9 Reverse -217 -236 6.09597 0.19
NP_441763.1_10 Reverse -206 -225 5.80018 0.284
NP_440360.1_10 Forward -272 -258 4.81781 0.227
NP_442658.1_1 Reverse -215 -225 14.2375 0.0237
NP_442658.1_1 Forward -185 -175 8.53436 0.189
NP_442658.1_1 Forward -228 -218 7.94438 0.199
NP_442658.1_1 Reverse -263 -273 5.87944 0.246
NP_440141.1_8 Reverse -256 -275 10.6192 0.208
NP_442205.1_9 Forward -399 -383 -2.5964 0.272
NP_440607.1_8 Reverse -373 -392 -0.39387 0.289
NP_440607.1_8 Reverse -254 -273 -0.4922 0.289
NP_441487.1_9 Reverse -264 -283 1.27776 0.205
NP_441958.1_5 Reverse -216 -226 21.2195 0.000805
NP_441958.1_5 Forward -227 -217 12.2714 0.00183
NP_441127.1_1 Forward -282 -268 7.66941 0.3
NP_442836.1_5 Forward -232 -213 9.3409 0.132
NP_440203.1_5 Forward -352 -342 12.4676 0.147
NP_440203.1_5 Forward -271 -261 9.12434 0.271
NP_439905.1_1 Forward -273 -260 17.3255 0.0423
NP_441097.1_2 Forward -250 -233 9.97027 0.223
NP_439990.1_5 Forward -231 -218 23.3237 0.000299
NP_439990.1_5 Reverse -212 -225 18.8988 0.0109
NP_442376.1_6 Reverse -176 -195 3.14605 0.295
NP_442376.1_8 Reverse -104 -118 8.16106 0.267
NP_442690.1_1 Reverse -295 -314 -16.1268 0.283
NP_442911.1_2 Reverse -207 -226 -9.44032 0.257
NP_442911.1_2 Forward -236 -217 -10.227 0.273
NP_440153.1_5 Forward -225 -211 4.22782 0.199
NP_440153.1_5 Reverse -218 -232 1.76955 0.245
NP_440153.1_8 Reverse -168 -181 3.46087 0.21
NP_443055.1_3 Forward -235 -216 10.9316 0.273
NP_443055.1_6 Forward -273 -255 4.83661 0.181
NP_440993.1_4 Reverse -61 -78 7.11867 0.232
NP_440993.1_4 Forward -324 -307 3.38209 0.289
NP_440138.1_7 Forward -86 -68 15.0897 0.284
NP_441348.1_3 Forward -81 -62 11.2092 0.176
NP_441099.1_5 Forward -236 -217 -0.0988766 0.0887
NP_441099.1_5 Reverse -207 -226 -1.18052 0.105
NP_442002.1_1 Forward -250 -232 2.0841 0.173
NP_442002.1_9 Forward -283 -276 11.1505 0.185
NP_440809.1_9 Reverse -208 -226 -6.76569 0.225
NP_441294.1_7 Reverse -213 -227 16.4498 0.0144
NP_441646.1_1 Forward -233 -214 6.68596 0.173
NP_441646.1_1 Reverse -60 -79 1.57275 0.231
NP_442438.1_10 Forward -231 -217 0.786239 0.213
NP_441000.1_6 Forward -227 -213 -3.44199 0.221
NP_441110.1_1 Forward -258 -239 12.2908 0.164
NP_440147.1_4 Reverse -215 -228 17.9155 0.00539
NP_440147.1_4 Forward -228 -215 15.7522 0.0148
NP_440147.1_4 Forward -179 -166 -0.0790467 0.271
NP_441550.1_8 Reverse -215 -225 15.8108 0.0132
NP_441550.1_8 Forward -228 -218 15.1225 0.0132
NP_441916.1_7 Forward -226 -216 18.9579 0.00144
NP_441916.1_7 Reverse -217 -227 10.3048 0.0261
NP_441916.1_10 Forward -57 -38 1.37609 0.264
NP_440206.1_4 Reverse -57 -76 10.3234 0.185
NP_441041.1_4 Reverse -217 -236 -3.93378 0.128
NP_441041.1_4 Forward -226 -207 -13.0786 0.28
NP_441041.1_4 Reverse -310 -329 -13.5702 0.291
NP_441041.1_7 Reverse -214 -226 16.6495 0.0131
NP_441041.1_7 Forward -229 -217 7.51478 0.162
NP_441547.1_2 Reverse -206 -224 2.87075 0.294
NP_440703.1_9 Reverse -168 -181 10.0485 0.208
NP_441725.1_4 Reverse -212 -226 4.62054 0.278
NP_441725.1_4 Forward -231 -217 4.42388 0.278
NP_441725.1_5 Forward -273 -263 5.19158 0.115
NP_441725.1_5 Reverse -218 -228 2.04498 0.115
NP_441725.1_5 Forward -225 -215 1.94665 0.115
NP_439966.1_7 Forward -228 -218 15.3192 0.0152
NP_439966.1_7 Reverse -215 -225 14.3359 0.0203
NP_439966.1_7 Forward -19 -9 10.501 0.0881
NP_439966.1_7 Forward -267 -257 4.10949 0.289
NP_439966.1_9 Reverse -372 -381 4.42462 0.253
NP_442941.1_3 Forward -225 -215 19.2529 0.00262
NP_442941.1_3 Reverse -218 -228 19.2529 0.00262
NP_440289.1_2 Reverse -214 -227 12.704 0.0139
NP_440289.1_2 Forward -229 -216 -3.71729 0.267
NP_440260.1_8 Forward -235 -217 1.98577 0.182
NP_441678.1_9 Reverse -315 -334 8.06259 0.17
NP_442281.1_1 Forward -231 -217 8.45543 0.0808
NP_442281.1_1 Reverse -212 -226 8.3571 0.0823
NP_442049.1_6 Forward -250 -231 5.80098 0.231
NP_441556.1_7 Reverse -167 -186 -1.18128 0.3
NP_441556.1_10 Forward -231 -217 12.4606 0.195
NP_441644.1_6 Forward -226 -216 19.0557 0.000803
NP_441644.1_6 Reverse -217 -227 17.3841 0.00127
NP_441644.1_6 Reverse -168 -178 11.2876 0.0524
NP_440867.1_10 Reverse -255 -274 1.17943 0.299
NP_442215.1_2 Forward -185 -169 -7.61128 0.3
NP_440253.1_2 Forward -226 -208 2.57575 0.136
NP_440253.1_2 Reverse -256 -274 -2.83245 0.278
NP_440929.1_8 Forward -226 -217 19.2726 0.000701
NP_440929.1_8 Reverse -217 -226 19.2726 0.000701
NP_442933.1_10 Forward -226 -217 17.601 0.00325
NP_442933.1_10 Reverse -217 -226 17.601 0.00325
NP_441751.2_8 Reverse -218 -232 14.7492 0.0119
NP_441751.2_8 Forward -225 -211 12.4876 0.0193
NP_440096.1_6 Reverse -204 -223 17.7974 0.141
NP_442554.1_8 Forward -225 -215 17.2863 0.00543
NP_442554.1_8 Reverse -218 -228 16.2046 0.0065
NP_442554.1_8 Reverse -4 -14 4.89658 0.168
NP_442554.1_8 Reverse -169 -179 4.20827 0.193
NP_442554.1_8 Forward -176 -166 3.12662 0.239
NP_441762.1_7 Reverse -255 -267 -3.50094 0.11
NP_441762.1_7 Reverse -216 -228 -6.64753 0.284
NP_441762.1_7 Forward -227 -215 -6.84419 0.284
NP_442142.1_4 Forward -229 -216 14.08 0.0317
NP_442142.1_4 Reverse -214 -227 11.6217 0.054
NP_442142.1_4 Reverse -171 -184 5.32859 0.194
NP_442142.1_4 Reverse -31 -44 5.32859 0.194
NP_442292.1_1 Reverse -218 -227 18.486 0.00229
NP_442292.1_1 Forward -225 -216 17.5026 0.00435
NP_440895.1_6 Forward -232 -219 18.8988 0.039
NP_442381.1_8 Reverse -214 -233 -6.39206 0.16
NP_441523.1_6 Reverse -213 -232 15.9291 0.152
NP_441523.1_6 Forward -230 -211 5.70265 0.23
NP_443009.1_5 Forward -227 -216 14.5128 0.02
NP_443009.1_5 Reverse -216 -227 10.1862 0.0792
NP_441715.1_4 Reverse -218 -228 17.3846 0.0106
NP_441715.1_4 Forward -225 -215 16.7946 0.0106
NP_441448.1_1 Reverse -254 -273 4.81767 0.27
NP_440183.1_9 Reverse -170 -189 -19.8634 0.282
NP_440379.1_5 Reverse -90 -109 -1.96717 0.194
NP_441468.1_1 Forward -225 -218 15.8704 0.0124
NP_441468.1_1 Reverse -218 -225 15.8704 0.0124
NP_441468.1_2 Forward -336 -322 20.8458 0.0372
NP_441020.2_6 Reverse -254 -271 8.98696 0.182
NP_441015.1_10 Reverse -247 -266 4.22769 0.127
NP_441015.1_10 Forward -75 -56 -4.03212 0.197
NP_441673.1_1 Forward -226 -217 20.8459 0.000698
NP_441673.1_1 Reverse -217 -226 20.8459 0.000698
NP_441731.1_3 Forward -234 -215 3.14605 0.164
NP_442757.1_7 Reverse -93 -112 12.1925 0.233
NP_441876.1_9 Reverse -189 -199 12.8609 0.267
NP_441826.1_2 Forward -232 -218 6.78443 0.09
NP_441826.1_2 Reverse -168 -182 3.8345 0.105
NP_441826.1_2 Reverse -211 -225 -1.8687 0.257
NP_442490.1_9 Reverse -217 -236 -9.047 0.299
NP_441764.1_8 Forward -309 -299 12.842 0.284
NP_442868.1_6 Forward -228 -218 19.2529 0.00563
NP_442868.1_6 Reverse -215 -225 10.4031 0.038
NP_442719.1_2 Reverse -265 -283 -10.1096 0.269
NP_441056.1_1 Reverse -217 -236 -4.52377 0.25
NP_441612.1_2 Reverse -217 -227 8.54929 0.21
NP_442808.1_1 Reverse -216 -226 8.73102 0.0481
NP_442808.1_1 Forward -227 -217 8.63269 0.0481
NP_442808.1_1 Reverse -225 -235 1.74956 0.281
NP_441101.1_10 Forward -230 -211 -7.37537 0.29
NP_440145.1_3 Forward -236 -217 17.994 0.00908
NP_442542.1_2 Reverse -215 -228 7.88576 0.168
NP_442050.1_5 Reverse -215 -225 15.9091 0.0091
NP_442050.1_5 Forward -228 -218 14.3359 0.0206
NP_442342.1_9 Forward -228 -212 3.99177 0.256
NP_442342.1_9 Reverse -257 -273 3.20513 0.267
NP_441114.1_3 Forward -272 -263 7.57121 0.231
NP_440558.1_2 Forward -235 -216 0.884433 0.185
NP_440558.1_2 Reverse -58 -77 -3.54046 0.236
NP_440558.1_2 Forward -277 -258 -3.63879 0.237
NP_440558.1_2 Forward -79 -60 -6.58872 0.277
NP_440558.1_2 Forward -229 -210 -6.98204 0.284
NP_442789.1_4 Forward -34 -15 5.70265 0.144
NP_441878.1_6 Reverse -216 -226 10.5014 0.0176
NP_441878.1_6 Forward -227 -217 10.4031 0.0176
NP_441878.1_6 Forward -233 -223 -0.0199663 0.163
NP_441878.1_6 Reverse -264 -274 -6.60814 0.193
NP_441036.1_8 Reverse -216 -226 15.713 0.00724
NP_441036.1_8 Forward -227 -217 8.33817 0.174
NP_441557.1_5 Forward -226 -217 19.9609 0.000699
NP_441557.1_5 Reverse -217 -226 19.9609 0.000699
NP_441590.1_4 Forward -266 -247 1.76863 0.299
NP_442267.1_4 Reverse -242 -261 2.94938 0.223
NP_442267.1_4 Reverse -308 -327 2.45773 0.223
NP_442066.2_9 Reverse -213 -226 10.1474 0.156
NP_441433.1_8 Forward -69 -50 6.4893 0.174
NP_442830.1_5 Reverse -232 -246 3.93223 0.246
NP_442166.1_7 Forward -225 -211 8.94771 0.21
NP_441116.1_9 Reverse -364 -378 12.1926 0.26
NP_441459.1_3 Forward -115 -96 10.6499 0.296
NP_440861.1_3 Forward -93 -75 14.2771 0.186
NP_442347.1_2 Reverse -218 -227 12.4878 0.056
NP_442347.1_2 Forward -225 -216 3.34298 0.284
NP_442645.1_2 Forward -234 -215 -15.3402 0.197
NP_442645.1_2 Reverse -166 -185 -18.1918 0.27
NP_441037.1_4 Reverse -215 -225 7.22024 0.237
NP_442594.1_8 Forward -244 -225 4.52268 0.26
NP_441633.1_3 Forward -228 -215 3.36254 0.0699
NP_441633.1_3 Reverse -215 -228 -3.71729 0.177
NP_441633.1_3 Forward -357 -344 -6.56889 0.259
NP_440136.1_2 Forward -225 -218 15.9687 0.0123
NP_440136.1_2 Reverse -218 -225 15.9687 0.0123
NP_442590.1_9 Reverse -255 -274 5.80098 0.267
NP_442590.1_10 Reverse -246 -265 7.17762 0.23
NP_442590.1_10 Forward -226 -207 5.60432 0.258
NP_442998.1_10 Forward -224 -217 15.5754 0.0102
NP_442998.1_10 Reverse -219 -226 15.5754 0.0102
NP_440299.1_1 Forward -230 -217 20.2748 0.00128
NP_440299.1_1 Reverse -170 -183 7.98351 0.1
NP_440299.1_1 Reverse -330 -343 5.32859 0.18
NP_440299.1_1 Reverse -213 -226 2.87033 0.269
NP_441799.1_1 Forward -230 -216 7.57046 0.138
NP_441799.1_1 Reverse -213 -227 5.89884 0.19
NP_441799.1_4 Forward -273 -254 -5.11376 0.219
NP_441007.1_10 Reverse -260 -273 1.29759 0.203
NP_442334.1_2 Forward -236 -219 -14.4158 0.3
NP_440256.1_1 Forward -229 -210 9.3409 0.0206
NP_440256.1_1 Forward -180 -161 0.491109 0.0829
NP_440256.1_1 Forward -245 -226 -5.70374 0.189
NP_440256.1_1 Reverse -246 -265 -6.1954 0.205
NP_440087.1_1 Forward -235 -216 -8.16202 0.278
NP_441559.1_8 Forward -231 -217 12.4876 0.0574
NP_441559.1_8 Reverse -212 -226 11.701 0.0574
NP_441559.1_8 Reverse -126 -140 9.93102 0.0624
NP_441559.1_8 Reverse -222 -236 -5.60527 0.267
NP_440915.1_6 Forward -230 -216 19.6658 0.00738
NP_440915.1_6 Reverse -213 -227 11.3077 0.0263
NP_442785.1_7 Reverse -215 -229 11.2093 0.228
NP_442785.1_7 Reverse -166 -180 8.35772 0.298
NP_441464.1_1 Forward -230 -211 12.1925 0.24
NP_441464.1_1 Reverse -213 -232 11.2092 0.24
NP_441464.1_10 Reverse -254 -268 11.3077 0.223
NP_440695.1_5 Reverse -217 -236 -1.47551 0.284
NP_441939.1_3 Forward -225 -206 9.73422 0.134
NP_442993.1_1 Forward -226 -210 0.255197 0.0642
NP_442993.1_1 Reverse -217 -233 -6.92296 0.146
NP_440677.1_1 Reverse -208 -227 8.55425 0.208
NP_442386.1_9 Forward -227 -218 13.8639 0.0289
NP_442386.1_9 Reverse -216 -225 6.39082 0.219
NP_440570.1_5 Forward -251 -232 -3.63879 0.291
NP_441340.1_5 Forward -225 -218 15.6737 0.0124
NP_441340.1_5 Reverse -218 -225 15.6737 0.0124
NP_440327.1_8 Forward -247 -228 16.8141 0.164
NP_442240.1_2 Forward -182 -163 -12.3902 0.163
NP_440211.1_4 Forward -143 -133 15.2213 0.23
NP_440586.1_8 Forward -225 -218 13.2151 0.026
NP_440586.1_8 Reverse -218 -225 13.2151 0.026
NP_442251.1_6 Forward -225 -218 15.2804 0.0124
NP_442251.1_6 Reverse -218 -225 15.2804 0.0124
NP_440192.1_4 Forward -142 -123 12.2112 0.184
NP_441262.1_3 Reverse -217 -224 14.7888 0.0223
NP_441262.1_3 Forward -226 -219 14.7888 0.0223
NP_440027.1_3 Reverse -217 -235 11.3264 0.159
NP_440027.1_3 Reverse -168 -186 4.04996 0.262
NP_440027.1_8 Forward -229 -210 8.75009 0.246
NP_443051.1_1 Reverse -216 -225 19.5676 0.00335
NP_443051.1_1 Forward -227 -218 10.4228 0.00754
NP_439937.1_9 Forward -227 -210 -16.5797 0.287
NP_442294.1_3 Forward -31 -17 12.3887 0.289
NP_440408.1_7 Forward -115 -96 8.25926 0.282
NP_440408.1_10 Reverse -250 -269 8.45592 0.176
NP_440439.1_1 Forward -229 -216 8.86907 0.0488
NP_440439.1_1 Reverse -214 -227 3.75586 0.11
NP_439943.1_7 Forward -182 -163 5.01433 0.273
NP_439943.1_7 Forward -231 -212 4.42435 0.278
NP_440372.1_2 Forward -225 -218 16.3621 0.0124
NP_440372.1_2 Reverse -218 -225 16.3621 0.0124
NP_440316.1_10 Forward -233 -223 8.4365 0.239
NP_440316.1_10 Forward -65 -55 7.35486 0.251
NP_441803.1_2 Forward -273 -254 5.89931 0.16
NP_441803.1_2 Reverse -169 -188 2.85105 0.203
NP_439977.1_5 Forward -232 -213 -0.688862 0.233
NP_439977.1_5 Reverse -211 -230 -1.27885 0.245
NP_441572.1_7 Reverse -211 -230 3.44104 0.117
NP_441572.1_7 Reverse -73 -92 -1.96717 0.19
NP_442384.1_10 Reverse -217 -230 20.8655 0.00194
NP_442384.1_10 Forward -226 -213 11.524 0.0348
NP_442384.1_10 Reverse -168 -181 8.18076 0.0685
NP_442384.1_10 Forward -183 -170 3.16588 0.199
NP_441018.1_7 Forward -181 -162 10.0292 0.218
NP_441018.1_7 Forward -80 -61 9.0459 0.236
NP_442790.1_4 Forward -235 -216 2.55606 0.0729
NP_442790.1_4 Reverse -208 -227 -15.8318 0.297
NP_442790.1_4 Forward -186 -167 -15.9302 0.3
NP_442262.1_10 Forward -225 -218 14.1988 0.0123
NP_442262.1_10 Reverse -218 -225 14.1988 0.0123
NP_442262.1_10 Reverse -169 -176 9.47889 0.187
NP_441689.1_5 Reverse -215 -225 8.3377 0.132
NP_441689.1_5 Forward -228 -218 5.78111 0.197
NP_440344.1_10 Reverse -210 -227 3.77542 0.0262
NP_440531.1_6 Forward -333 -314 -4.22878 0.278
NP_441060.1_1 Forward -242 -223 16.2719 0.18
NP_440562.1_3 Reverse -218 -235 4.6604 0.19
NP_441965.1_10 Reverse -214 -230 8.22001 0.131
NP_441640.1_8 Forward -213 -194 -5.31042 0.281
NP_442693.1_7 Forward -77 -58 7.96426 0.276
NP_440297.1_9 Forward -273 -263 4.10993 0.245
NP_440297.1_9 Reverse -218 -228 -0.118297 0.282
NP_440297.1_9 Forward -225 -215 -0.216628 0.282
NP_442280.1_10 Reverse -305 -323 6.03883 0.28
NP_441592.1_4 Reverse -217 -236 8.84924 0.124
NP_443036.1_10 Forward -275 -256 6.58763 0.243
NP_442078.1_3 Forward -317 -298 0.785326 0.24
NP_440999.1_9 Reverse -213 -227 11.2093 0.0474
NP_440999.1_9 Forward -230 -216 7.57108 0.0846
NP_440888.1_2 Forward -226 -212 16.5185 0.00647
NP_440888.1_2 Reverse -217 -231 16.1252 0.00789
NP_442892.1_9 Forward -368 -354 11.4053 0.296
NP_441771.1_4 Forward -309 -290 5.89931 0.192
NP_442277.1_4 Reverse -208 -227 15.8299 0.0355
NP_442033.1_10 Reverse -215 -234 8.55425 0.0535
NP_441543.1_2 Reverse -218 -227 16.9127 0.00359
NP_441543.1_2 Forward -225 -216 15.9293 0.00518
NP_442845.1_2 Forward -232 -218 5.99778 0.219
NP_442845.1_2 Forward -82 -68 5.01447 0.247
NP_442845.1_2 Reverse -211 -225 3.93283 0.272
NP_440380.1_1 Reverse -253 -272 -3.24547 0.2
NP_441319.1_5 Reverse -218 -237 14.2574 0.236
NP_441319.1_8 Forward -232 -214 4.44404 0.297
NP_440982.1_1 Forward -266 -247 6.68515 0.294
NP_441469.1_8 Reverse -216 -225 6.5879 0.227
NP_441469.1_8 Forward -227 -218 6.48957 0.227
NP_442315.1_1 Reverse -95 -113 4.14905 0.28
NP_443064.1_6 Reverse -217 -227 12.5669 0.0796
NP_443064.1_6 Forward -226 -216 10.8217 0.13
NP_442578.1_7 Forward -225 -218 14.5921 0.026
NP_442578.1_7 Reverse -218 -225 14.5921 0.026
NP_440710.1_1 Forward -333 -315 -2.53746 0.194
NP_440071.1_4 Reverse -168 -187 14.2574 0.234
NP_441462.1_2 Forward -226 -216 20.2362 0.000805
NP_441462.1_2 Reverse -217 -227 11.5831 0.00406
NP_443062.1_1 Reverse -121 -139 9.03346 0.142
NP_443062.1_1 Forward -226 -208 8.83844 0.145
NP_443062.1_1 Reverse -217 -235 7.66836 0.17
NP_443062.1_6 Reverse -209 -228 3.04771 0.245
NP_442204.1_1 Reverse -213 -224 11.7601 0.0565
NP_442204.1_1 Forward -230 -219 11.5634 0.0565
NP_442204.1_1 Forward -181 -170 0.94365 0.281
NP_442204.1_2 Reverse -207 -226 18.1907 0.144
NP_441560.1_8 Forward -231 -212 16.2847 0.0771
NP_442487.1_5 Reverse -216 -235 7.96345 0.198
NP_440516.1_2 Forward -232 -214 6.31233 0.122
NP_440516.1_2 Reverse -211 -229 3.65739 0.145
NP_440516.1_8 Forward -226 -217 16.9127 0.00442
NP_440516.1_8 Reverse -217 -226 16.9127 0.00442
NP_442428.1_5 Forward -225 -218 15.8704 0.0124
NP_442428.1_5 Reverse -218 -225 15.8704 0.0124
NP_442120.1_10 Forward -55 -36 -12.9802 0.279
NP_441867.1_2 Reverse -255 -274 -13.1769 0.277
NP_440673.1_2 Reverse -89 -108 12.3406 0.149
NP_440673.1_3 Forward -224 -217 12.4288 0.0426
NP_440673.1_3 Reverse -219 -226 12.4288 0.0426
NP_440673.1_7 Reverse -72 -91 3.04771 0.216
NP_440865.1_9 Reverse -211 -230 -5.9004 0.218
NP_441052.1_2 Reverse -217 -227 19.9412 0.00106
NP_441052.1_2 Forward -226 -216 10.4031 0.0285
NP_442219.1_8 Forward -236 -217 8.36037 0.249
NP_442219.1_8 Forward -284 -265 6.33108 0.3
NP_442219.1_9 Reverse -218 -227 17.7976 0.00718
NP_442219.1_9 Forward -225 -216 8.25953 0.0681
NP_440592.1_8 Reverse -23 -42 17.5024 0.139
NP_440436.1_4 Reverse -218 -227 17.2072 0.00233
NP_440436.1_4 Forward -225 -216 9.24241 0.0871
NP_440314.1_9 Reverse -218 -237 10.0292 0.0293
NP_440314.1_9 Forward -225 -206 -7.4737 0.24
NP_441719.1_4 Forward -225 -218 16.3621 0.0124
NP_441719.1_4 Reverse -218 -225 16.3621 0.0124
NP_441004.1_1 Reverse -244 -263 -11.0136 0.231
NP_441004.1_2 Reverse -254 -273 2.75272 0.212
NP_441004.1_3 Reverse -256 -275 1.27776 0.296
NP_442366.1_3 Forward -227 -209 -1.94747 0.219
NP_442366.1_3 Reverse -216 -234 -4.20908 0.266
NP_442873.1_5 Reverse -327 -346 7.27514 0.278
NP_442873.1_5 Forward -147 -128 6.68515 0.299
NP_441115.1_4 Forward -227 -209 11.9164 0.123
NP_443054.1_2 Forward -275 -261 7.47274 0.153
NP_443054.1_2 Forward -228 -214 1.08123 0.251
NP_441851.1_10 Forward -227 -217 15.8113 0.00552
NP_441851.1_10 Reverse -216 -226 8.53483 0.114
NP_441195.1_7 Forward -63 -44 20.1573 0.0344
NP_442856.1_7 Forward -235 -216 8.16093 0.106
NP_442856.1_7 Forward -267 -248 -2.26216 0.236
NP_442856.1_7 Reverse -58 -77 -4.72043 0.265
NP_442515.1_1 Reverse -25 -39 -1.67204 0.26
NP_442515.1_1 Forward -227 -213 -4.7203 0.298
NP_441396.1_5 Reverse -257 -266 7.66954 0.241
NP_440165.1_5 Reverse -216 -235 3.04771 0.103
NP_441046.1_2 Reverse -94 -113 -1.7705 0.292
NP_441349.1_10 Forward -236 -217 -1.57384 0.105
NP_441409.1_6 Forward -232 -213 -0.0988766 0.0673
NP_441409.1_6 Reverse -211 -230 -8.26035 0.165
NP_441107.1_10 Reverse -222 -236 15.6342 0.235
NP_440432.1_7 Reverse -163 -182 14.8474 0.131
NP_442843.1_1 Forward -49 -30 -5.50708 0.244
NP_442843.1_1 Forward -147 -128 -10.817 0.281
NP_439960.1_3 Reverse -223 -242 14.9458 0.126
NP_439960.1_10 Forward -233 -215 -4.30741 0.293
NP_440474.1_8 Forward -110 -96 8.84875 0.175
NP_441477.1_10 Forward -233 -215 7.00065 0.181
NP_440431.1_3 Reverse -216 -235 -6.78538 0.195
NP_440588.1_2 Forward -235 -216 -2.26216 0.163
NP_442006.1_2 Forward -64 -47 -8.90928 0.197
NP_440483.1_1 Reverse -251 -270 -2.65548 0.208
NP_442243.1_1 Forward -261 -243 -0.178247 0.243
NP_441570.1_1 Forward -242 -224 -16.5005 0.247
NP_440078.1_10 Reverse -217 -236 16.6174 0.121
NP_441078.1_4 Forward -226 -217 19.6659 0.0007
NP_441078.1_4 Reverse -217 -226 19.6659 0.0007
NP_441663.1_8 Reverse -211 -230 -3.04881 0.276
NP_442348.1_2 Reverse -264 -273 11.8978 0.225
NP_440707.1_6 Forward -333 -314 10.0284 0.297
NP_442443.1_1 Reverse -257 -276 -1.37718 0.233
NP_442443.1_1 Forward -351 -332 -4.03212 0.268
NP_442443.1_1 Forward -147 -128 -6.29373 0.294
NP_441091.1_5 Reverse -213 -232 7.47261 0.204
NP_440526.1_3 Reverse -218 -229 8.02298 0.126
NP_440526.1_3 Forward -225 -214 1.92649 0.267
NP_441432.1_8 Reverse -216 -225 16.8143 0.00595
NP_441432.1_8 Forward -227 -218 16.8143 0.00595
NP_441432.1_8 Reverse -321 -330 6.98123 0.112
NP_441432.1_8 Reverse -264 -273 3.83464 0.243
NP_441432.1_8 Forward -178 -169 3.44131 0.245
NP_442344.1_7 Reverse -218 -237 -6.58872 0.171
NP_441732.1_2 Reverse -213 -229 -5.74299 0.0483
NP_441732.1_2 Forward -230 -214 -16.1661 0.165
NP_440629.1_4 Forward -318 -299 16.4207 0.148
NP_440760.1_1 Reverse -217 -236 -13.5702 0.107
NP_440461.1_3 Forward -83 -64 14.6508 0.281
NP_442353.1_4 Reverse -211 -230 6.48849 0.175
NP_442353.1_8 Forward -59 -40 18.5831 0.15
NP_440913.1_1 Reverse -166 -184 6.214 0.229
NP_440713.1_4 Forward -236 -217 4.71934 0.223
NP_440713.1_4 Reverse -207 -226 1.37609 0.287
NP_442489.1_7 Forward -226 -217 20.1576 0.000695
NP_442489.1_7 Reverse -217 -226 20.1576 0.000695
NP_440559.1_1 Reverse -218 -227 17.4043 0.00658
NP_440559.1_1 Forward -225 -216 8.65285 0.0586
NP_441659.2_8 Forward -226 -216 20.9245 0.000805
NP_441659.2_8 Reverse -217 -227 18.1713 0.00133
NP_441659.2_8 Forward -108 -98 2.83163 0.187
NP_441659.2_8 Reverse -168 -178 0.963343 0.254
NP_442913.1_10 Forward -235 -216 -3.63879 0.214
NP_441040.1_2 Reverse -248 -267 -8.55534 0.236
NP_439956.1_7 Forward -183 -164 6.98095 0.257
NP_440708.1_6 Forward -353 -334 -10.522 0.282
NP_442346.1_5 Forward -227 -217 16.6963 0.00248
NP_442346.1_5 Reverse -216 -226 16.303 0.00248
NP_442346.1_5 Forward -178 -168 5.09324 0.262
NP_442346.1_5 Reverse -173 -183 4.3066 0.291
NP_440545.1_3 Forward -230 -213 5.44704 0.0616
NP_440545.1_3 Reverse -213 -230 -1.14113 0.163
NP_441856.1_6 Reverse -251 -265 15.1426 0.265
NP_440025.1_3 Reverse -269 -283 9.83628 0.29
NP_440831.1_3 Forward -79 -60 7.35791 0.256
NP_440555.1_1 Forward -237 -218 1.27776 0.294
NP_440459.1_2 Reverse -215 -232 7.80699 0.278
NP_440010.1_1 Reverse -250 -269 7.7676 0.219
NP_440010.1_10 Forward -238 -219 7.17762 0.226
NP_442311.1_8 Reverse -255 -274 18.0924 0.0685
NP_442603.1_7 Reverse -217 -231 18.7801 0.0119
NP_441888.1_7 Forward -231 -217 3.73617 0.225
NP_441888.1_7 Reverse -212 -226 2.5562 0.225
NP_441888.1_7 Forward -182 -168 1.76955 0.239
NP_441948.1_4 Reverse -1 -19 -4.20908 0.22
NP_441833.1_4 Forward -225 -218 15.9687 0.0124
NP_441833.1_4 Reverse -218 -225 15.9687 0.0124
NP_441329.1_6 Reverse -351 -370 0.715766 0.249
NP_442162.1_9 Forward -225 -218 16.2637 0.0124
NP_442162.1_9 Reverse -218 -225 16.2637 0.0124
NP_440788.1_8 Reverse -255 -274 7.57094 0.286
NP_440671.1_4 Forward -232 -218 10.7177 0.151
NP_440671.1_4 Forward -88 -74 10.4227 0.158
NP_440671.1_4 Reverse -211 -225 7.47274 0.217
NP_440671.1_5 Reverse -163 -177 13.6669 0.293
NP_442821.1_2 Forward -281 -262 21.2389 0.00952
NP_440772.1_8 Reverse -211 -230 10.4225 0.253
NP_440204.1_1 Reverse -245 -264 7.37428 0.278
NP_442199.1_5 Reverse -160 -179 -3.3438 0.205
NP_442199.1_5 Forward -351 -332 -5.50708 0.247
NP_442140.1_3 Reverse -218 -228 10.3048 0.0902
NP_442140.1_3 Forward -11 -1 6.8632 0.158
NP_442140.1_3 Forward -225 -215 4.69992 0.238
NP_442140.1_3 Reverse -169 -179 3.42162 0.297
NP_440875.1_9 Forward -224 -214 15.867 0.0233
NP_440875.1_9 Forward -15 -5 9.92942 0.233
NP_440875.1_9 Reverse -123 -133 8.95605 0.233
NP_440875.1_9 Reverse -219 -229 8.37203 0.233
NP_441813.1_5 Reverse -215 -225 18.1713 0.00743
NP_441813.1_5 Forward -228 -218 18.1713 0.00743
NP_440590.1_4 Reverse -218 -231 14.7689 0.0106
NP_440590.1_4 Forward -225 -212 14.6706 0.0106
NP_440590.1_4 Reverse -9 -22 2.77255 0.0813
NP_440590.1_4 Forward -189 -176 -1.06236 0.21
NP_442497.1_10 Forward -225 -216 17.601 0.00813
NP_442497.1_10 Reverse -218 -227 10.4228 0.0087
NP_440821.1_4 Forward -228 -218 9.41981 0.0286
NP_440821.1_4 Reverse -215 -225 2.24165 0.131
NP_441239.1_9 Reverse -215 -227 13.0187 0.0389
NP_441239.1_9 Reverse -166 -178 10.2654 0.0834
NP_441239.1_9 Forward -228 -216 5.25052 0.223
NP_441239.1_9 Forward -267 -255 3.97222 0.269
NP_441892.1_1 Reverse -208 -225 1.8088 0.147
NP_441017.1_6 Reverse -201 -215 13.8636 0.17
NP_441017.1_6 Reverse -213 -227 12.6836 0.217
NP_441617.1_6 Forward -373 -354 2.45773 0.2
NP_442138.1_10 Reverse -217 -236 -4.42544 0.255
NP_442052.1_8 Reverse -314 -324 13.353 0.253
NP_440546.1_4 Forward -177 -167 13.9243 0.0459
NP_440546.1_4 Forward -226 -216 13.5365 0.0459
NP_440546.1_4 Reverse -217 -227 10.046 0.109
NP_441509.1_2 Reverse -234 -252 5.82068 0.29
NP_440462.1_4 Forward -41 -27 8.25939 0.268
NP_440462.1_6 Reverse -215 -225 18.7612 0.00454
NP_440462.1_6 Forward -228 -218 9.61647 0.0429
NP_442611.1_1 Reverse -217 -236 0.982764 0.251
NP_440868.1_4 Forward -230 -218 8.00379 0.0602
NP_440868.1_4 Reverse -213 -225 1.02229 0.193
NP_442479.1_9 Reverse -296 -315 -12.8819 0.287
NP_441848.1_4 Forward -314 -298 10.7019 0.245
NP_440696.1_3 Forward -187 -169 3.26407 0.21
NP_442039.1_4 Forward -225 -218 15.1821 0.0124
NP_442039.1_4 Reverse -218 -225 15.1821 0.0124
NP_442039.1_7 Reverse -22 -32 10.7964 0.257
NP_442039.1_7 Forward -146 -136 6.76487 0.299
NP_441926.1_3 Forward -226 -210 7.82668 0.17
NP_442837.1_3 Forward -225 -218 15.7721 0.0124
NP_442837.1_3 Reverse -218 -225 15.7721 0.0124
NP_439994.1_3 Reverse -216 -235 10.3896 0.221
NP_442053.1_1 Forward -226 -217 18.3876 0.0007
NP_442053.1_1 Reverse -217 -226 18.3876 0.0007
NP_440505.1_3 Forward -228 -218 18.3679 0.00213
NP_440505.1_3 Reverse -215 -225 17.188 0.00332
NP_440505.1_7 Forward -176 -157 5.80098 0.18
NP_440505.1_7 Reverse -174 -193 0.884433 0.256
NP_441701.1_7 Reverse -9 -28 17.404 0.122
NP_441102.1_1 Forward -225 -206 3.53937 0.286
NP_441408.2_7 Reverse -215 -234 0.982764 0.215
NP_440914.1_1 Reverse -217 -227 17.5935 0.000537
NP_440914.1_1 Forward -226 -216 16.3248 0.00196
NP_441011.1_8 Forward -225 -216 16.6177 0.00602
NP_441011.1_8 Reverse -218 -227 8.25953 0.144
NP_442533.1_1 Forward -73 -54 -14.4552 0.243
NP_442533.1_1 Forward -157 -138 -14.7502 0.247
NP_442533.1_6 Forward -226 -217 17.2076 0.00137
NP_442533.1_6 Reverse -217 -226 17.2076 0.00137
NP_442533.1_6 Forward -177 -168 4.71961 0.177
NP_442533.1_6 Forward -273 -264 4.0313 0.194
NP_442533.1_6 Reverse -168 -177 3.83464 0.202
NP_442533.1_6 Reverse -174 -183 2.94966 0.232
NP_442533.1_6 Forward -17 -8 1.57302 0.294
NP_442541.1_10 Forward -274 -260 11.1104 0.186
NP_442541.1_10 Reverse -61 -75 3.04726 0.254
NP_442541.1_10 Reverse -168 -182 0.883986 0.295
NP_440263.1_3 Reverse -211 -230 3.73603 0.244
NP_443016.1_10 Forward -235 -216 8.35759 0.289
NP_441219.1_6 Forward -71 -53 11.4255 0.218
NP_441482.1_7 Forward -232 -218 -0.590395 0.0612
NP_441482.1_7 Reverse -211 -225 -2.36035 0.0963
NP_439944.1_9 Reverse -218 -228 10.5014 0.0887
NP_439944.1_9 Forward -225 -215 9.12481 0.1
NP_441028.1_6 Reverse -188 -198 3.8145 0.281
NP_442202.1_2 Forward -179 -160 15.4366 0.29
NP_440116.1_8 Reverse -218 -237 -2.16383 0.126
NP_440116.1_8 Forward -225 -206 -5.50708 0.194
NP_440116.1_8 Forward -213 -194 -7.86702 0.24
NP_440115.1_6 Forward -229 -219 16.008 0.0325
NP_440115.1_6 Reverse -214 -224 4.89658 0.28
NP_440007.1_9 Reverse -213 -227 10.521 0.163
NP_440007.1_9 Forward -230 -216 8.84938 0.171
NP_440007.1_10 Forward -267 -248 14.7483 0.248
NP_441680.1_4 Forward -257 -238 -3.54046 0.299
NP_440112.1_1 Forward -126 -107 33.5303 0.0000564
NP_440112.1_2 Forward -189 -170 27.2371 0.00202
NP_440112.1_3 Forward -65 -46 30.3828 0.0000542
NP_440112.1_4 Forward -105 -86 26.8438 0.00498
NP_440112.1_5 Forward -165 -146 21.6323 0.115
NP_440112.1_6 Forward -288 -269 27.3355 0.00345
NP_440112.1_7 Forward -363 -344 19.764 0.0823
NP_441602.1_6 Forward -43 -24 12.8808 0.277
NP_441170.1_4 Forward -85 -67 4.6407 0.243
NP_441972.1_5 Reverse -206 -225 -2.26216 0.18
NP_441972.1_5 Reverse -68 -87 -6.09707 0.228
NP_441106.1_1 Reverse -216 -225 18.486 0.0028
NP_441106.1_1 Forward -227 -218 9.63616 0.0311
NP_439903.1_6 Forward -328 -309 3.04693 0.213
NP_439903.1_6 Reverse -214 -233 1.37531 0.248
NP_442588.1_2 Reverse -166 -185 17.6007 0.117
NP_441286.1_1 Forward -227 -215 5.93884 0.0258
NP_441286.1_1 Reverse -216 -228 3.48056 0.0467
NP_440670.1_8 Forward -226 -217 18.3876 0.000699
NP_440670.1_8 Reverse -217 -226 18.3876 0.000699
NP_441930.1_2 Forward -242 -232 13.8447 0.236
NP_441930.1_2 Reverse -264 -274 11.9764 0.271
NP_440886.1_7 Reverse -216 -226 8.04271 0.0805
NP_440886.1_7 Forward -227 -217 7.94438 0.0805
NP_440886.1_7 Forward -266 -256 5.87944 0.158
NP_440828.1_1 Reverse -69 -88 0.588665 0.262
NP_440828.1_4 Forward -275 -256 -5.50783 0.258
NP_442614.1_2 Reverse -217 -231 9.14437 0.242
NP_442382.1_9 Reverse -63 -82 9.24175 0.281
NP_441399.1_6 Reverse -61 -80 11.11 0.295
NP_442072.1_9 Forward -227 -209 -3.71743 0.0374
NP_440028.1_6 Reverse -254 -272 11.0322 0.274
NP_442022.1_4 Forward -88 -69 14.0608 0.166
NP_440907.2_8 Forward -225 -215 9.616 0.103
NP_442264.1_2 Forward -236 -219 7.61033 0.236
NP_441021.1_1 Forward -225 -206 8.55425 0.0482
NP_441021.1_3 Forward -273 -254 11.3075 0.205
NP_441463.1_6 Forward -72 -58 7.86544 0.25
NP_441463.1_6 Forward -275 -261 6.8991 0.267
NP_441626.1_2 Forward -225 -218 15.7721 0.0124
NP_441626.1_2 Reverse -218 -225 15.7721 0.0124
NP_442365.1_7 Forward -230 -211 -1.18052 0.189
NP_442365.1_7 Forward -181 -162 -5.70374 0.277
NP_442209.1_6 Forward -264 -245 20.354 0.182
NP_442794.1_1 Forward -230 -218 20.0002 0.00523
NP_442615.1_1 Reverse -208 -226 -1.84914 0.134
NP_442615.1_1 Forward -235 -217 -2.53746 0.145
NP_441962.1_9 Forward -264 -245 12.5858 0.191
NP_440387.1_1 Reverse -217 -233 6.64671 0.0282
NP_441431.1_2 Forward -268 -254 5.89884 0.284
NP_441431.1_3 Forward -88 -69 8.75091 0.236
NP_441488.1_8 Forward -231 -217 9.73373 0.146
NP_441488.1_8 Reverse -212 -226 6.88214 0.289
NP_441521.1_4 Forward -27 -8 12.4875 0.259
NP_441836.1_1 Forward -237 -218 11.5967 0.298
NP_441836.1_2 Reverse -211 -230 6.19431 0.116
NP_441836.1_2 Reverse -162 -181 -1.37718 0.217
NP_441993.1_1 Forward -232 -213 2.33652 0.26
NP_441993.1_1 Reverse -316 -335 2.23906 0.261
NP_441993.1_1 Reverse -211 -230 0.972113 0.288
NP_440814.1_4 Reverse -208 -227 -12.3902 0.23
NP_440467.1_3 Forward -225 -206 13.6978 0.188
NP_440114.1_10 Forward -226 -212 9.04604 0.186
NP_440114.1_10 Forward -177 -163 8.75105 0.195
NP_442684.1_4 Reverse -12 -31 19.2715 0.257
NP_442323.1_7 Forward -231 -212 5.60352 0.203
NP_441510.2_6 Forward -236 -217 11.995 0.296
NP_440287.1_6 Forward -235 -216 5.01433 0.188
NP_440293.1_3 Reverse -257 -276 -4.6221 0.264
NP_441237.1_9 Forward -273 -263 10.8948 0.214
NP_441531.1_6 Reverse -28 -41 7.19745 0.285
NP_439910.1_2 Reverse -209 -226 -21.594 0.183
NP_439910.1_2 Forward -119 -102 -22.6756 0.285
NP_442867.1_4 Forward -351 -332 9.3409 0.267
NP_442867.1_8 Reverse -302 -321 7.07928 0.247
NP_440457.1_1 Forward -230 -218 7.61046 0.101
NP_440457.1_1 Reverse -213 -225 6.43049 0.121
NP_440142.1_7 Reverse -218 -237 8.75091 0.228
NP_441984.1_3 Forward -99 -81 6.11567 0.275
NP_441984.1_3 Reverse -95 -113 5.62401 0.279
NP_441436.1_2 Reverse -249 -268 -5.21209 0.294
NP_441436.1_8 Reverse -315 -334 7.7676 0.293
NP_442509.1_9 Reverse -217 -227 8.14104 0.192
NP_442509.1_9 Forward -226 -216 8.04271 0.192
NP_442514.1_5 Reverse -160 -179 -7.47443 0.276
NP_440554.1_4 Forward -225 -215 17.9746 0.0131
NP_440554.1_4 Reverse -218 -228 8.92815 0.0646
NP_442862.1_1 Forward -264 -245 10.1275 0.269
NP_442862.1_3 Reverse -299 -316 9.97027 0.219
NP_441885.1_5 Reverse -217 -227 20.9245 0.000538
NP_441885.1_5 Forward -226 -216 11.3864 0.00668
NP_440478.1_10 Reverse -215 -229 5.99778 0.3
NP_442341.1_7 Forward -227 -213 3.63784 0.217
NP_442341.1_9 Reverse -215 -229 13.372 0.083
NP_441756.1_5 Forward -230 -211 10.5209 0.117
NP_441756.1_5 Reverse -213 -232 -2.26216 0.272
NP_441756.1_5 Reverse -88 -107 -5.01543 0.298
NP_441756.1_6 Reverse -58 -77 14.3549 0.28
NP_440423.1_6 Forward -71 -52 -20.2567 0.252
NP_443000.1_3 Forward -65 -46 13.3647 0.242
NP_443000.1_7 Reverse -215 -225 20.3345 0.00223
NP_443000.1_7 Forward -228 -218 19.9412 0.00223
NP_441832.1_3 Forward -233 -214 10.7175 0.264
NP_440275.1_3 Reverse -215 -225 16.1063 0.0155
NP_440275.1_3 Forward -228 -218 15.123 0.0182
NP_441397.1_5 Reverse -290 -306 14.6911 0.295
NP_441359.1_5 Forward -229 -210 4.32602 0.225
NP_439962.1_4 Forward -324 -305 5.211 0.176
NP_439962.1_4 Reverse -248 -267 1.96607 0.197
NP_440149.1_8 Forward -183 -164 -7.96535 0.296
NP_441105.1_3 Reverse -206 -225 4.22769 0.081
NP_441105.1_3 Reverse -56 -75 -6.1954 0.23
NP_441105.1_3 Forward -237 -218 -8.55534 0.274
NP_442373.1_2 Reverse -247 -266 -7.27704 0.233
NP_440216.1_1 Forward -226 -212 8.06273 0.0068
NP_440216.1_1 Reverse -217 -231 -0.492064 0.0284
NP_440216.1_9 Forward -74 -65 11.5045 0.262
NP_440216.1_9 Reverse -170 -179 5.89959 0.289
NP_440172.1_1 Forward -226 -216 17.5813 0.00421
NP_440172.1_1 Reverse -217 -227 15.0247 0.00945
NP_442015.1_10 Forward -230 -217 21.1604 0.00329
NP_442015.1_10 Reverse -213 -226 4.93583 0.156
NP_441226.1_7 Forward -225 -218 14.4934 0.0123
NP_441226.1_7 Reverse -218 -225 14.4934 0.0123
NP_440198.1_3 Reverse -176 -195 14.2566 0.277
NP_441111.1_7 Forward -225 -217 18.7023 0.00294
NP_441111.1_7 Reverse -218 -226 18.7023 0.00294
NP_441766.1_2 Forward -226 -217 17.5026 0.00297
NP_441766.1_2 Reverse -217 -226 17.5026 0.00297
NP_440416.1_9 Reverse -210 -229 -14.6519 0.179
NP_440416.1_9 Forward -233 -214 -14.8485 0.18
NP_440416.1_9 Forward -221 -202 -16.0285 0.206
NP_440416.1_9 Forward -243 -224 -20.0601 0.281
NP_443052.1_9 Forward -272 -253 -5.99873 0.276
NP_440591.1_9 Forward -233 -215 15.2604 0.0839
NP_442154.1_1 Forward -42 -24 -0.570838 0.116
NP_442154.1_1 Reverse -257 -275 -11.4856 0.215
NP_440261.1_5 Reverse -218 -231 4.93583 0.0478
NP_440261.1_5 Forward -225 -212 -4.60227 0.158
NP_440261.1_5 Reverse -224 -237 -6.47056 0.201
NP_440261.1_5 Forward -273 -260 -12.1738 0.272
NP_440988.1_10 Reverse -24 -38 4.7052 0.253
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGAGTAGTTGAGCAGTTACAATCCCGACATATTCCCGTTAGTCTTTTCATCGACCCGGATGTGGCCCAACTGAAAGCCTCTGCCCAAACCGGAGCAAAATTCATTGAATTACATACGGGCAAATATGCCAATGCCCCCACCGCTGACGACCAAGCTAGGGAATTGGGGTCCCTGGCGATCGCCTGTGACATTGCTCTAGAACTGGGGCTAAGGATCAACGCTGGCCATGGGTTGACCTATTGGAATGTGCGCCCAGTGGCGGAATTACCGGGCATGGAAGAGTTAAACATCGGCCACAGCATCATGAGCCGGGCCATTCTGGTGGGCATGGAAAGGGCCGTGCGGGAAATGAAATTAGCCATGTTGGGGCTGCCATTTTAGCGCCGAGCCCATGGTAGG

CDS

GTGGAAAGTTGGGCATTGACGACCCCACCCATCGACATAGTCAATCAGTATTTATTTTTTATAAAACGTAAAACAAACTATATGGCTACCTATTATTATGCTTTGGCAAGTCAAAAATTTCTCTTGGAAGAGGAACCCTTTGAAGAGGTGCTGAAAGAACGGCGACGGGATTATGGTGAAAAAAATAAGGAAATTGACTTTTGGCAGGTGATCCAACCGGCCTTTCTTAATGCCCCAGAATTAGCCGAAGCTAAAGCTAAAGCTCCCGAAAAAAATGTAGCCATTGTTTCCACCAATAAGTCTTTTATTGTTTGGGTAAAACTCCGGTTGGAATATGTCTTAACTGGAGAATTTGAAGCTCCCTCCGATGCCATTCCTGACCCCCTTGCATCCCTGGATTAG

Protein

MESWALTTPPIDIVNQYLFFIKRKTNYMATYYYALASQKFLLEEEPFEEVLKERRRDYGEKNKEIDFWQVIQPAFLNAPELAEAKAKAPEKNVAIVSTNKSFIVWVKLRLEYVLTGEFEAPSDAIPDPLASLD