Your browser is old and dusty. Try Google Chrome!

Details for slr1778

ORF slr1778
Accession NP_440108.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -287 -273 5.21113 0.14
NP_440795.1_7 Forward -287 -280 14.6904 0.0123
NP_440795.1_7 Reverse -280 -287 14.6904 0.0123
NP_440694.1_8 Forward -383 -364 -2.26216 0.225
NP_441418.1_6 Reverse -279 -298 -19.1751 0.0854
NP_441418.1_6 Forward -288 -269 -20.3551 0.111
NP_442291.1_5 Reverse -278 -294 -0.826444 0.189
NP_440897.1_6 Forward -303 -284 -0.197979 0.182
NP_441453.1_4 Reverse -279 -287 16.539 0.00633
NP_441453.1_4 Forward -288 -280 16.539 0.00633
NP_440226.1_1 Reverse -279 -298 8.35759 0.0885
NP_440226.1_1 Forward -288 -269 3.44104 0.225
NP_440259.1_4 Reverse -54 -68 8.82869 0.292
NP_440348.1_6 Forward -116 -97 5.80098 0.22
NP_440150.1_6 Forward -291 -272 9.53756 0.188
NP_442173.1_1 Forward -287 -279 15.4574 0.00633
NP_442173.1_1 Reverse -280 -288 15.4574 0.00633
NP_442752.1_4 Forward -288 -281 13.8055 0.0199
NP_442752.1_4 Reverse -279 -286 13.8055 0.0199
NP_443027.1_4 Forward -290 -280 13.2547 0.0521
NP_443027.1_4 Reverse -229 -239 6.76487 0.269
NP_443027.1_4 Reverse -277 -287 5.87989 0.294
NP_441812.1_1 Forward -38 -24 14.4536 0.207
NP_441812.1_3 Reverse -118 -132 15.4376 0.106
NP_442975.1_10 Reverse -275 -289 10.8154 0.0516
NP_441675.1_4 Forward -358 -339 5.11266 0.246
NP_440784.1_7 Forward -287 -280 15.9687 0.0123
NP_440784.1_7 Reverse -280 -287 15.9687 0.0123
NP_440061.1_9 Reverse -277 -291 10.6187 0.124
NP_440061.1_9 Forward -301 -287 9.53707 0.143
NP_442062.1_8 Forward -288 -278 19.4496 0.000558
NP_442062.1_8 Reverse -279 -289 10.3048 0.0493
NP_440304.1_4 Forward -290 -280 10.8948 0.051
NP_440304.1_4 Reverse -277 -287 1.84832 0.299
NP_442242.1_4 Forward -287 -280 14.3954 0.0124
NP_442242.1_4 Reverse -280 -287 14.3954 0.0124
NP_440916.1_1 Reverse -339 -353 12.586 0.206
NP_440916.1_1 Reverse -45 -59 8.55439 0.267
NP_441161.1_1 Forward -301 -282 13.175 0.272
NP_441208.1_9 Reverse -276 -290 8.25939 0.219
NP_441594.1_6 Forward -350 -331 0.491109 0.285
NP_442742.1_9 Forward -369 -350 -3.73712 0.221
NP_442110.1_7 Reverse -279 -293 2.5562 0.222
NP_440769.1_3 Reverse -86 -105 14.5516 0.28
NP_440856.1_4 Forward -295 -276 8.55425 0.0597
NP_441083.1_5 Forward -288 -278 11.3864 0.0159
NP_441083.1_5 Reverse -279 -289 11.2881 0.0159
NP_441738.1_2 Forward -286 -279 15.28 0.0102
NP_441738.1_2 Reverse -281 -288 15.28 0.0102
NP_441558.1_5 Forward -130 -111 6.78429 0.202
NP_441558.1_5 Forward -290 -271 5.70265 0.242
NP_440209.1_1 Reverse -279 -287 18.1123 0.00295
NP_440209.1_1 Forward -288 -280 18.1123 0.00295
NP_440447.1_1 Forward -293 -275 13.0972 0.125
NP_440056.1_9 Reverse -355 -374 13.1894 0.295
NP_441713.1_1 Reverse -273 -292 -14.5535 0.259
NP_441713.1_1 Forward -294 -275 -15.9302 0.275
NP_441713.1_1 Reverse -355 -374 -16.7168 0.286
NP_440053.1_6 Forward -79 -60 10.0292 0.297
NP_441716.1_1 Forward -303 -289 4.03116 0.259
NP_442111.1_4 Reverse -278 -292 11.701 0.0486
NP_442111.1_4 Forward -289 -275 5.30946 0.169
NP_441163.1_1 Reverse -271 -288 6.52796 0.255
NP_440906.1_5 Forward -287 -280 15.8704 0.0124
NP_440906.1_5 Reverse -280 -287 15.8704 0.0124
NP_440747.1_10 Forward -291 -279 17.1486 0.000663
NP_440747.1_10 Reverse -276 -288 5.44718 0.0137
NP_440747.1_10 Reverse -116 -128 -12.2524 0.254
NP_442973.1_5 Reverse -270 -289 14.3558 0.142
NP_441486.1_1 Reverse -276 -290 5.21113 0.0384
NP_441486.1_1 Forward -291 -277 -3.83532 0.183
NP_442145.1_4 Forward -254 -235 7.78217 0.208
NP_442634.1_2 Forward -294 -275 6.88262 0.205
NP_442634.1_4 Reverse -277 -291 -1.27871 0.149
NP_442634.1_4 Forward -290 -276 -1.96703 0.149
NP_441265.1_3 Forward -294 -280 4.52282 0.181
NP_440403.1_10 Forward -297 -278 2.65439 0.279
NP_440842.1_6 Reverse -277 -296 16.3215 0.131
NP_441014.1_10 Reverse -75 -94 0.981987 0.236
NP_442848.1_5 Forward -331 -313 12.7038 0.232
NP_442848.1_5 Forward -295 -277 -1.65248 0.276
NP_443018.1_3 Forward -287 -280 14.8871 0.0123
NP_443018.1_3 Reverse -280 -287 14.8871 0.0123
NP_443018.1_3 Reverse -295 -302 10.2655 0.107
NP_441316.1_7 Reverse -277 -292 -2.97003 0.273
NP_441634.1_8 Forward -290 -276 6.09611 0.114
NP_441634.1_8 Reverse -292 -306 3.14618 0.155
NP_440376.1_1 Forward -288 -279 19.4693 0.000692
NP_440376.1_1 Reverse -279 -288 19.4693 0.000692
NP_441588.1_4 Forward -286 -276 7.25653 0.178
NP_442687.1_7 Reverse -278 -288 15.8113 0.0125
NP_442687.1_7 Forward -289 -279 9.02648 0.0994
NP_442191.1_4 Reverse -280 -294 14.9684 0.073
NP_442485.1_3 Forward -299 -280 -2.55715 0.262
NP_441846.1_10 Forward -90 -71 -22.8133 0.266
NP_442658.1_1 Reverse -277 -287 15.9091 0.00966
NP_442658.1_1 Forward -290 -280 14.2375 0.0237
NP_442782.1_2 Reverse -279 -293 10.7177 0.173
NP_442782.1_2 Reverse -303 -317 9.43936 0.198
NP_440656.1_8 Reverse -292 -311 -6.49039 0.245
NP_441414.1_9 Forward -288 -269 -4.91709 0.164
NP_440720.1_5 Forward -90 -71 19.9606 0.0458
NP_440800.1_7 Forward -317 -303 12.0943 0.241
NP_441487.1_6 Forward -125 -106 1.86774 0.254
NP_441487.1_9 Reverse -278 -297 -0.197208 0.25
NP_441958.1_5 Forward -289 -279 21.2195 0.000805
NP_441958.1_5 Reverse -278 -288 12.2714 0.00183
NP_441127.1_1 Reverse -294 -308 13.1759 0.204
NP_442685.1_2 Forward -397 -387 17.0896 0.11
NP_440984.1_7 Reverse -274 -288 11.6026 0.122
NP_440984.1_7 Forward -293 -279 10.1277 0.126
NP_441097.1_2 Forward -126 -109 7.80699 0.238
NP_442911.1_2 Reverse -269 -288 -5.01543 0.148
NP_440153.1_5 Reverse -280 -294 5.30946 0.191
NP_441591.1_10 Forward -290 -271 4.12936 0.297
NP_442064.1_1 Reverse -114 -133 -12.4886 0.277
NP_442064.1_1 Reverse -274 -293 -12.8819 0.283
NP_443055.1_6 Forward -311 -293 0.608397 0.241
NP_440993.1_2 Forward -293 -277 5.17175 0.237
NP_440602.1_2 Reverse -274 -293 1.67108 0.263
NP_442002.1_9 Forward -348 -341 11.1505 0.185
NP_442002.1_9 Reverse -278 -285 10.7572 0.185
NP_442567.1_3 Reverse -340 -356 11.2683 0.283
NP_441294.1_7 Reverse -275 -289 8.86667 0.274
NP_441646.1_1 Reverse -272 -291 1.76941 0.228
NP_442438.1_10 Forward -293 -279 4.71948 0.142
NP_441292.1_2 Reverse -283 -302 -1.67217 0.219
NP_440377.1_1 Forward -118 -101 11.6602 0.271
NP_441000.1_6 Reverse -278 -292 4.71948 0.0933
NP_441000.1_6 Forward -289 -275 -3.93365 0.225
NP_440484.1_1 Forward -361 -342 10.9134 0.214
NP_441674.1_6 Forward -302 -283 2.0644 0.291
NP_440147.1_4 Reverse -277 -290 19.6855 0.00258
NP_440147.1_4 Forward -290 -277 9.06573 0.0437
NP_441550.1_8 Forward -290 -280 15.8108 0.0132
NP_441550.1_8 Reverse -277 -287 8.3377 0.124
NP_441916.1_7 Reverse -279 -289 18.9579 0.00144
NP_441916.1_7 Forward -288 -278 18.4663 0.00144
NP_441041.1_4 Reverse -279 -298 -10.3253 0.231
NP_441041.1_4 Reverse -309 -328 -11.8986 0.254
NP_441041.1_4 Reverse -372 -391 -12.8819 0.276
NP_441041.1_7 Forward -291 -279 13.3454 0.0485
NP_441041.1_7 Reverse -276 -288 9.65268 0.108
NP_442396.1_5 Reverse -275 -288 9.45906 0.129
NP_440569.1_6 Reverse -311 -330 2.16274 0.273
NP_441725.1_4 Forward -293 -279 4.03056 0.278
NP_441725.1_5 Forward -287 -277 2.04498 0.115
NP_441725.1_5 Reverse -280 -290 1.94665 0.115
NP_439966.1_7 Forward -290 -280 14.3359 0.0203
NP_439966.1_7 Reverse -277 -287 9.91099 0.0968
NP_439966.1_9 Reverse -277 -286 0.884706 0.253
NP_440736.1_3 Forward -290 -271 1.67108 0.282
NP_440202.1_8 Forward -296 -277 11.9461 0.272
NP_440202.1_8 Reverse -286 -305 10.1954 0.297
NP_442941.1_3 Reverse -280 -290 19.2529 0.00262
NP_442941.1_3 Forward -287 -277 2.63497 0.14
NP_440289.1_2 Forward -291 -278 -3.52063 0.267
NP_440289.1_2 Reverse -276 -289 -3.61896 0.267
NP_440260.1_8 Forward -297 -279 -1.25915 0.232
NP_442281.1_1 Reverse -274 -288 11.897 0.0428
NP_442281.1_1 Forward -293 -279 8.55376 0.0798
NP_441334.1_7 Reverse -277 -296 -3.63879 0.11
NP_442256.1_2 Forward -290 -272 -5.38906 0.214
NP_440437.1_1 Forward -294 -275 13.5691 0.0288
NP_440647.1_9 Reverse -277 -295 5.82068 0.23
NP_442012.1_1 Forward -294 -275 1.57275 0.214
NP_441556.1_7 Forward -304 -285 -0.787962 0.3
NP_440498.1_1 Reverse -270 -288 6.01734 0.093
NP_440498.1_1 Forward -297 -279 -2.14413 0.235
NP_442982.1_5 Forward -138 -119 -3.04881 0.293
NP_441644.1_6 Reverse -279 -289 19.0557 0.000803
NP_441644.1_6 Forward -288 -278 10.1076 0.0628
NP_441071.1_2 Forward -398 -379 14.3711 0.279
NP_440867.1_9 Forward -298 -279 14.9458 0.249
NP_440867.1_10 Reverse -344 -363 3.34271 0.283
NP_442215.1_2 Reverse -277 -293 6.35172 0.0719
NP_442215.1_2 Reverse -312 -328 -4.07137 0.227
NP_442247.1_8 Forward -290 -276 9.43936 0.247
NP_440929.1_8 Forward -288 -279 19.2726 0.000701
NP_440929.1_8 Reverse -279 -288 19.2726 0.000701
NP_442933.1_1 Reverse -16 -35 8.83258 0.253
NP_442933.1_1 Reverse -253 -272 6.73176 0.262
NP_442933.1_10 Forward -288 -279 17.601 0.00325
NP_442933.1_10 Reverse -279 -288 17.601 0.00325
NP_441095.1_4 Reverse -252 -266 14.9452 0.168
NP_441751.2_8 Reverse -280 -294 7.27608 0.0339
NP_442554.1_8 Reverse -280 -290 17.2863 0.00543
NP_442554.1_8 Forward -287 -277 13.2547 0.0187
NP_442554.1_8 Forward -302 -292 3.12662 0.239
NP_442970.1_3 Reverse -261 -279 11.6427 0.276
NP_441762.1_7 Forward -289 -277 10.2654 0.0142
NP_441762.1_7 Reverse -278 -290 2.30059 0.0676
NP_441762.1_7 Reverse -293 -305 -6.2542 0.284
NP_442142.1_4 Forward -291 -278 15.4566 0.0264
NP_442142.1_4 Reverse -276 -289 5.32859 0.194
NP_442292.1_1 Reverse -280 -289 17.5026 0.00435
NP_442292.1_1 Forward -287 -278 9.63616 0.0183
NP_442476.1_6 Forward -287 -273 4.81781 0.142
NP_442476.1_6 Reverse -280 -294 1.27789 0.223
NP_443009.1_5 Forward -289 -278 19.626 0.00102
NP_443009.1_5 Reverse -278 -289 7.82632 0.118
NP_442408.2_1 Forward -288 -269 0.0977854 0.202
NP_441715.1_4 Reverse -280 -290 16.7946 0.0106
NP_441715.1_4 Forward -287 -277 9.41981 0.097
NP_440183.1_9 Forward -301 -282 -2.85214 0.175
NP_441198.1_8 Reverse -301 -311 12.49 0.129
NP_440379.1_5 Reverse -275 -294 2.85105 0.149
NP_441468.1_1 Forward -287 -280 15.8704 0.0124
NP_441468.1_1 Reverse -280 -287 15.8704 0.0124
NP_441618.1_3 Reverse -279 -298 4.03102 0.176
NP_441020.2_6 Reverse -277 -294 12.7235 0.0877
NP_441673.1_1 Forward -288 -279 20.8459 0.000698
NP_441673.1_1 Reverse -279 -288 20.8459 0.000698
NP_441876.1_9 Reverse -343 -353 11.8776 0.269
NP_441826.1_2 Forward -294 -280 -3.34366 0.284
NP_441826.1_5 Forward -392 -373 2.26107 0.276
NP_441330.1_1 Forward -293 -274 -2.75381 0.0791
NP_442868.1_6 Forward -290 -280 10.4031 0.038
NP_442868.1_6 Reverse -277 -287 0.865012 0.205
NP_441911.1_10 Forward -99 -80 7.98055 0.274
NP_442808.1_1 Reverse -278 -288 18.4657 0.00201
NP_442808.1_1 Forward -289 -279 8.73102 0.0481
NP_442808.1_1 Forward -304 -294 5.78111 0.141
NP_442808.1_1 Forward -331 -321 4.20782 0.203
NP_441290.1_5 Reverse -102 -121 6.78429 0.239
NP_441882.1_6 Reverse -342 -361 -4.32711 0.275
NP_440145.1_3 Forward -298 -279 2.65439 0.115
NP_442542.1_9 Forward -295 -281 5.01387 0.279
NP_442050.1_5 Forward -290 -280 15.9091 0.0091
NP_440558.1_2 Forward -297 -278 4.03102 0.152
NP_440558.1_2 Forward -306 -287 -4.22878 0.243
NP_442789.1_4 Reverse -277 -296 -6.39206 0.285
NP_442593.1_9 Forward -367 -348 15.2016 0.278
NP_441878.1_6 Forward -289 -279 10.5014 0.0176
NP_441878.1_6 Reverse -278 -288 10.4031 0.0176
NP_441878.1_6 Reverse -293 -303 0.766681 0.134
NP_441036.1_8 Reverse -278 -288 17.7779 0.000554
NP_441036.1_8 Forward -289 -279 15.713 0.00724
NP_441557.1_5 Forward -288 -279 19.9609 0.000699
NP_441557.1_5 Reverse -279 -288 19.9609 0.000699
NP_442267.1_4 Reverse -307 -326 3.93269 0.207
NP_442066.2_4 Reverse -279 -298 -1.08219 0.182
NP_441433.1_8 Reverse -315 -334 -3.93378 0.285
NP_440744.1_2 Reverse -278 -297 15.4978 0.264
NP_440101.1_3 Reverse -274 -293 4.03102 0.224
NP_441564.1_10 Forward -365 -346 1.17943 0.287
NP_442183.1_1 Forward -288 -274 11.7993 0.0675
NP_442183.1_1 Forward -312 -298 8.55439 0.113
NP_442166.1_7 Reverse -280 -294 10.6193 0.19
NP_440979.1_3 Reverse -280 -298 11.7205 0.234
NP_441549.1_9 Reverse -275 -293 6.11567 0.0925
NP_442347.1_2 Forward -287 -278 11.1111 0.056
NP_442347.1_2 Reverse -280 -289 3.34298 0.284
NP_442645.1_2 Forward -296 -277 -2.85214 0.0487
NP_441037.1_4 Reverse -277 -287 14.7245 0.028
NP_441037.1_4 Forward -290 -280 7.22024 0.237
NP_441633.1_3 Forward -290 -277 3.65753 0.0699
NP_441633.1_3 Reverse -277 -290 3.36254 0.0699
NP_440136.1_2 Forward -287 -280 15.9687 0.0123
NP_440136.1_2 Reverse -280 -287 15.9687 0.0123
NP_442590.1_9 Forward -304 -285 5.11266 0.273
NP_442998.1_5 Forward -349 -339 8.23984 0.267
NP_442998.1_10 Forward -286 -279 15.5754 0.0102
NP_442998.1_10 Reverse -281 -288 15.5754 0.0102
NP_440299.1_1 Reverse -275 -288 8.08184 0.098
NP_440299.1_1 Forward -292 -279 7.39353 0.113
NP_441799.1_1 Reverse -275 -289 19.2718 0.00667
NP_441799.1_1 Forward -292 -278 18.1901 0.0089
NP_441007.1_10 Reverse -274 -287 1.59258 0.203
NP_441007.1_10 Forward -293 -280 1.39592 0.203
NP_440256.1_1 Forward -291 -272 1.57275 0.0733
NP_440256.1_1 Reverse -276 -295 0.491109 0.0829
NP_440256.1_1 Reverse -311 -330 -0.590531 0.095
NP_440087.1_1 Forward -297 -278 -3.24547 0.22
NP_441512.1_4 Forward -292 -273 11.4058 0.237
NP_441559.1_8 Forward -293 -279 8.65272 0.0676
NP_441559.1_8 Reverse -274 -288 -7.08024 0.283
NP_441559.1_9 Forward -82 -63 16.0274 0.0924
NP_441395.1_8 Forward -71 -52 3.14605 0.296
NP_440915.1_6 Forward -292 -278 7.86607 0.0637
NP_440915.1_6 Reverse -275 -289 -2.75368 0.28
NP_442785.1_7 Forward -290 -276 19.7641 0.0449
NP_442866.1_1 Reverse -274 -293 -7.08038 0.264
NP_441464.1_8 Forward -288 -274 5.21113 0.26
NP_440026.1_7 Forward -293 -278 19.7444 0.0824
NP_440695.1_5 Reverse -279 -298 0.884433 0.284
NP_442993.1_1 Forward -288 -272 -9.08625 0.179
NP_440677.1_6 Reverse -270 -289 8.16093 0.277
NP_442386.1_9 Reverse -278 -287 15.7322 0.0144
NP_442386.1_9 Forward -289 -280 6.39082 0.219
NP_440570.1_4 Reverse -314 -332 2.47742 0.238
NP_441340.1_5 Forward -287 -280 15.6737 0.0124
NP_441340.1_5 Reverse -280 -287 15.6737 0.0124
NP_439909.1_3 Reverse -61 -80 20.2792 0.146
NP_440161.1_3 Forward -290 -271 7.47261 0.299
NP_440586.1_1 Reverse -311 -330 -5.01543 0.28
NP_440586.1_8 Forward -287 -280 13.2151 0.026
NP_440586.1_8 Reverse -280 -287 13.2151 0.026
NP_440586.1_8 Reverse -295 -302 9.08521 0.178
NP_442251.1_6 Forward -287 -280 15.2804 0.0124
NP_442251.1_6 Reverse -280 -287 15.2804 0.0124
NP_440684.1_9 Reverse -273 -287 11.6026 0.173
NP_441262.1_3 Reverse -279 -286 14.7888 0.0223
NP_441262.1_3 Forward -288 -281 14.7888 0.0223
NP_440027.1_3 Forward -303 -285 4.14829 0.262
NP_443051.1_1 Forward -289 -280 19.5676 0.00335
NP_443051.1_1 Reverse -278 -287 10.4228 0.00754
NP_440439.1_1 Forward -291 -278 18.1122 0.0105
NP_440439.1_1 Reverse -276 -289 10.5407 0.0365
NP_439943.1_1 Reverse -339 -358 0.884433 0.179
NP_439943.1_2 Forward -324 -305 8.75091 0.293
NP_439943.1_7 Reverse -274 -293 1.96607 0.299
NP_440372.1_2 Forward -287 -280 16.3621 0.0124
NP_440372.1_2 Reverse -280 -287 16.3621 0.0124
NP_440316.1_10 Reverse -293 -303 9.02648 0.236
NP_441572.1_7 Forward -294 -275 6.29264 0.0812
NP_440267.1_2 Forward -293 -279 19.5668 0.0168
NP_442384.1_10 Reverse -279 -292 17.9155 0.00564
NP_442384.1_10 Forward -288 -275 15.4572 0.00986
NP_441604.1_4 Reverse -307 -326 -4.03212 0.224
NP_441018.1_7 Reverse -275 -294 8.16093 0.255
NP_442790.1_4 Reverse -270 -289 -5.31042 0.141
NP_442262.1_10 Forward -287 -280 14.1988 0.0123
NP_442262.1_10 Reverse -280 -287 14.1988 0.0123
NP_442262.1_10 Reverse -295 -302 9.18389 0.211
NP_441689.1_5 Forward -290 -280 8.3377 0.132
NP_440344.1_10 Reverse -272 -289 -10.7776 0.19
NP_440282.1_3 Forward -329 -310 -5.31042 0.298
NP_440531.1_6 Forward -296 -277 8.16093 0.0885
NP_441060.1_1 Forward -118 -99 15.2005 0.233
NP_441965.1_10 Forward -291 -275 8.41667 0.125
NP_441965.1_10 Reverse -276 -292 2.22182 0.289
NP_441640.1_8 Forward -329 -310 -2.36049 0.229
NP_442750.1_3 Reverse -326 -345 -11.2103 0.236
NP_442693.1_6 Forward -294 -275 -0.4922 0.29
NP_440297.1_9 Forward -287 -277 -0.118297 0.282
NP_440297.1_9 Forward -302 -292 -0.216628 0.282
NP_440297.1_9 Reverse -280 -290 -0.216628 0.282
NP_440350.1_5 Reverse -75 -94 2.75272 0.158
NP_440350.1_5 Reverse -65 -84 -5.40875 0.289
NP_441896.1_3 Reverse -270 -289 1.67108 0.212
NP_440999.1_9 Reverse -275 -289 6.48943 0.0969
NP_440888.1_2 Reverse -279 -293 15.1419 0.0122
NP_440888.1_2 Forward -288 -274 5.50552 0.276
NP_440792.1_5 Forward -287 -268 6.68596 0.237
NP_440052.1_5 Forward -299 -280 -3.24547 0.234
NP_439969.1_3 Reverse -274 -293 1.37609 0.257
NP_440575.1_8 Forward -396 -377 -7.17871 0.298
NP_441543.1_2 Forward -287 -278 18.486 0.00236
NP_441543.1_2 Reverse -280 -289 15.9293 0.00518
NP_441551.1_5 Reverse -275 -291 11.8575 0.163
NP_441178.1_4 Forward -295 -276 21.1406 0.0722
NP_441178.1_6 Forward -306 -287 13.0766 0.188
NP_441469.1_8 Reverse -278 -287 16.126 0.00797
NP_441469.1_8 Forward -289 -280 6.5879 0.227
NP_443064.1_6 Reverse -279 -289 10.8217 0.13
NP_442578.1_7 Forward -287 -280 14.5921 0.026
NP_442578.1_7 Reverse -280 -287 14.5921 0.026
NP_440710.1_1 Forward -296 -278 2.87075 0.119
NP_441462.1_2 Reverse -279 -289 20.2362 0.000805
NP_441462.1_2 Forward -288 -278 11.5831 0.00406
NP_441621.1_7 Reverse -277 -291 4.22782 0.0934
NP_441929.1_3 Forward -348 -329 4.03102 0.266
NP_443062.1_1 Reverse -279 -297 10.106 0.121
NP_443062.1_6 Reverse -271 -290 0.982764 0.283
NP_440519.1_8 Reverse -315 -331 13.3332 0.157
NP_442204.1_1 Forward -292 -281 11.3667 0.0565
NP_442204.1_5 Reverse -269 -288 7.86593 0.125
NP_440516.1_2 Reverse -273 -291 7.00065 0.12
NP_440516.1_6 Reverse -71 -85 6.39049 0.294
NP_440516.1_8 Forward -288 -279 16.9127 0.00442
NP_440516.1_8 Reverse -279 -288 16.9127 0.00442
NP_442428.1_5 Forward -287 -280 15.8704 0.0124
NP_442428.1_5 Reverse -280 -287 15.8704 0.0124
NP_440673.1_3 Forward -286 -279 12.4288 0.0426
NP_440673.1_3 Reverse -281 -288 12.4288 0.0426
NP_441052.1_2 Forward -288 -278 10.5014 0.0285
NP_441052.1_2 Reverse -279 -289 10.4031 0.0285
NP_442219.1_9 Forward -287 -278 8.35786 0.0681
NP_442219.1_9 Reverse -280 -289 8.25953 0.0681
NP_440436.1_4 Forward -287 -278 18.1905 0.00233
NP_440436.1_4 Reverse -280 -289 9.24241 0.0871
NP_441884.1_8 Reverse -310 -329 -8.752 0.262
NP_441884.1_8 Reverse -278 -297 -12.3902 0.271
NP_441884.1_9 Reverse -276 -295 -22.3217 0.277
NP_441884.1_9 Forward -291 -272 -24.8783 0.29
NP_442086.1_3 Reverse -280 -299 9.53756 0.224
NP_442412.1_3 Forward -307 -288 12.9791 0.248
NP_442577.1_9 Forward -334 -320 20.3534 0.106
NP_441086.1_3 Reverse -376 -395 4.9832 0.29
NP_441719.1_4 Forward -287 -280 16.3621 0.0124
NP_441719.1_4 Reverse -280 -287 16.3621 0.0124
NP_441733.1_10 Forward -291 -278 5.82081 0.203
NP_441004.1_2 Reverse -304 -323 -2.0655 0.263
NP_442813.1_4 Reverse -343 -362 -6.98204 0.299
NP_442366.1_3 Forward -289 -271 -1.65248 0.216
NP_442366.1_5 Reverse -276 -286 15.2208 0.0375
NP_440296.1_10 Reverse -276 -295 -13.6686 0.269
NP_440296.1_10 Forward -291 -272 -14.6519 0.27
NP_442694.1_4 Reverse -350 -359 14.1594 0.2
NP_442694.1_4 Reverse -320 -329 11.3078 0.277
NP_442206.1_10 Forward -288 -273 4.50312 0.178
NP_440328.1_4 Forward -294 -275 4.32602 0.167
NP_440328.1_4 Reverse -273 -292 4.03102 0.17
NP_443054.1_2 Forward -290 -276 8.94771 0.104
NP_441851.1_10 Reverse -278 -288 16.008 0.00552
NP_441851.1_10 Forward -289 -279 8.53483 0.114
NP_442208.1_5 Forward -362 -343 -6.39206 0.266
NP_442622.1_5 Reverse -277 -296 -4.32711 0.197
NP_442011.1_1 Reverse -278 -297 -2.45882 0.273
NP_442856.1_7 Forward -297 -278 -3.14714 0.241
NP_441668.1_4 Reverse -305 -324 3.34271 0.187
NP_442515.1_1 Reverse -149 -163 1.86788 0.147
NP_442515.1_1 Forward -289 -275 -4.22864 0.298
NP_440593.1_3 Forward -328 -309 -6.78538 0.28
NP_440165.1_5 Reverse -278 -297 0.58944 0.143
NP_441349.1_10 Forward -298 -279 -8.65367 0.278
NP_441349.1_10 Reverse -269 -288 -8.65367 0.278
NP_442314.1_1 Reverse -283 -301 12.6055 0.136
NP_440432.1_9 Reverse -280 -295 6.07642 0.0481
NP_439960.1_10 Forward -295 -277 -3.71743 0.279
NP_440474.1_8 Forward -287 -273 5.01387 0.26
NP_440431.1_3 Forward -325 -306 -6.58872 0.195
NP_440431.1_4 Forward -182 -163 -6.15965 0.25
NP_442450.1_5 Reverse -277 -287 7.55152 0.13
NP_440588.1_2 Reverse -270 -289 9.83255 0.0422
NP_440954.1_1 Reverse -345 -364 -11.5053 0.295
NP_442335.1_7 Forward -385 -371 16.8135 0.146
NP_440943.1_5 Reverse -312 -326 19.6658 0.147
NP_442006.1_2 Reverse -285 -302 -6.84433 0.169
NP_442006.1_2 Reverse -294 -311 -17.4641 0.276
NP_441570.1_1 Reverse -279 -297 8.08229 0.0149
NP_441570.1_1 Reverse -187 -205 -10.6006 0.174
NP_441078.1_4 Forward -288 -279 19.6659 0.0007
NP_441078.1_4 Reverse -279 -288 19.6659 0.0007
NP_442729.1_5 Reverse -293 -303 9.02648 0.235
NP_441663.1_8 Forward -294 -275 -2.75381 0.272
NP_440707.1_6 Forward -296 -277 12.6833 0.208
NP_441432.1_8 Forward -289 -280 16.8143 0.00595
NP_441432.1_8 Reverse -278 -287 8.25953 0.0755
NP_441432.1_8 Reverse -320 -329 7.27622 0.101
NP_441432.1_9 Forward -113 -100 8.59837 0.287
NP_441432.1_9 Reverse -252 -265 8.40445 0.289
NP_441333.1_1 Reverse -85 -95 13.9731 0.217
NP_441732.1_2 Forward -292 -276 -6.43131 0.0495
NP_441732.1_2 Reverse -275 -291 -17.346 0.253
NP_440629.1_6 Forward -294 -275 12.603 0.289
NP_442003.1_8 Forward -181 -162 16.5191 0.186
NP_440685.1_7 Reverse -273 -292 16.5191 0.274
NP_440760.1_1 Forward -288 -269 -22.125 0.249
NP_440713.1_4 Forward -298 -279 3.04771 0.251
NP_442489.1_7 Forward -288 -279 20.1576 0.000695
NP_442489.1_7 Reverse -279 -288 20.1576 0.000695
NP_440559.1_1 Forward -287 -278 8.75118 0.0586
NP_440559.1_1 Reverse -280 -289 8.65285 0.0586
NP_441659.2_8 Reverse -279 -289 20.9245 0.000805
NP_441659.2_8 Forward -288 -278 11.9764 0.0147
NP_440426.1_7 Forward -298 -279 3.44104 0.207
NP_441022.1_1 Forward -18 -9 11.6421 0.274
NP_441022.1_1 Forward -398 -389 11.0666 0.284
NP_442913.1_10 Forward -297 -278 -1.96717 0.18
NP_442913.1_10 Reverse -270 -289 -4.42544 0.237
NP_441040.1_2 Reverse -270 -289 -15.2418 0.286
NP_441040.1_2 Reverse -343 -362 -16.1268 0.294
NP_442849.1_1 Forward -83 -69 7.66941 0.284
NP_442008.1_2 Reverse -276 -295 4.916 0.232
NP_442776.1_1 Forward -323 -304 18.584 0.0502
NP_442346.1_5 Forward -289 -279 16.303 0.00248
NP_442346.1_5 Reverse -278 -288 9.02648 0.118
NP_440545.1_3 Forward -292 -275 7.512 0.0496
NP_440545.1_3 Reverse -275 -292 4.46374 0.0703
NP_440545.1_3 Reverse -146 -163 -3.5994 0.208
NP_441856.1_3 Reverse -276 -295 0.392778 0.216
NP_441629.1_3 Forward -295 -276 -0.29631 0.24
NP_441786.1_3 Reverse -316 -335 8.25926 0.264
NP_440459.1_2 Reverse -285 -302 8.69197 0.253
NP_441943.1_8 Forward -333 -314 -4.52377 0.219
NP_441888.1_7 Reverse -274 -288 3.73617 0.225
NP_440449.1_6 Reverse -271 -289 9.03394 0.188
NP_441948.1_4 Forward -295 -277 7.09898 0.0626
NP_441948.1_4 Reverse -287 -305 -0.669169 0.139
NP_441833.1_4 Forward -287 -280 15.9687 0.0124
NP_441833.1_4 Reverse -280 -287 15.9687 0.0124
NP_441329.1_3 Reverse -93 -103 13.3642 0.265
NP_441329.1_6 Forward -98 -79 2.53011 0.227
NP_441329.1_6 Forward -94 -75 -3.1994 0.298
NP_441112.1_6 Forward -364 -345 -3.04881 0.296
NP_441112.1_6 Forward -298 -279 -3.3438 0.296
NP_442699.1_8 Forward -355 -336 -11.8003 0.238
NP_442162.1_9 Forward -287 -280 16.2637 0.0124
NP_442162.1_9 Reverse -280 -287 16.2637 0.0124
NP_440224.1_1 Forward -299 -280 -0.885524 0.152
NP_442199.1_5 Forward -296 -277 -7.37537 0.293
NP_442140.1_3 Forward -287 -277 16.2046 0.0255
NP_442140.1_3 Reverse -295 -305 5.19158 0.221
NP_442140.1_3 Reverse -280 -290 4.69992 0.238
NP_441609.1_1 Forward -116 -97 18.6823 0.0286
NP_441609.1_5 Forward -117 -98 8.45592 0.279
NP_441671.1_1 Reverse -283 -302 1.76941 0.263
NP_440875.1_9 Reverse -281 -291 16.5483 0.0145
NP_441813.1_5 Forward -290 -280 18.1713 0.00743
NP_441813.1_5 Reverse -277 -287 9.91146 0.021
NP_440590.1_4 Forward -287 -274 3.36254 0.0746
NP_440590.1_4 Reverse -280 -293 -5.38892 0.277
NP_440567.1_1 Forward -287 -273 13.6676 0.0207
NP_440567.1_1 Reverse -280 -294 9.83269 0.0414
NP_442497.1_10 Reverse -280 -289 17.601 0.00813
NP_442497.1_10 Forward -287 -278 10.4228 0.0087
NP_440821.1_4 Reverse -277 -287 10.2065 0.0163
NP_440821.1_4 Forward -290 -280 2.24165 0.131
NP_441239.1_9 Forward -290 -278 15.5753 0.0186
NP_441239.1_9 Reverse -277 -289 12.3303 0.0477
NP_441239.1_9 Forward -305 -293 10.0687 0.0888
NP_441892.1_1 Forward -333 -316 -5.95935 0.294
NP_442044.1_1 Forward -317 -298 -14.0619 0.283
NP_442193.1_1 Reverse -314 -332 16.5388 0.14
NP_442270.1_9 Reverse -310 -329 -11.4069 0.27
NP_442772.1_4 Reverse -361 -380 2.16274 0.217
NP_441874.1_1 Reverse -317 -331 8.55439 0.298
NP_440354.1_7 Forward -294 -276 6.60732 0.278
NP_442138.1_10 Reverse -279 -298 -7.08038 0.286
NP_440546.1_4 Reverse -279 -289 13.5365 0.0459
NP_440546.1_4 Forward -288 -278 11.8882 0.0679
NP_443033.1_3 Forward -323 -304 9.73422 0.268
NP_440462.1_6 Forward -290 -280 18.7612 0.00454
NP_440462.1_6 Reverse -277 -287 9.02648 0.0498
NP_442611.1_1 Reverse -279 -298 16.9124 0.0415
NP_440868.1_4 Reverse -275 -287 20.2952 0.00865
NP_440868.1_4 Forward -292 -280 15.0836 0.0164
NP_441084.1_6 Forward -290 -276 13.5133 0.128
NP_441084.1_6 Forward -78 -64 10.6046 0.234
NP_441084.1_6 Forward -356 -342 9.92586 0.257
NP_441084.1_6 Reverse -292 -306 9.05325 0.295
NP_440653.1_10 Forward -323 -304 3.73603 0.265
NP_442882.1_7 Reverse -272 -286 11.2087 0.261
NP_440843.1_3 Reverse -1 -20 11.1109 0.211
NP_442039.1_4 Forward -287 -280 15.1821 0.0124
NP_442039.1_4 Reverse -280 -287 15.1821 0.0124
NP_442679.1_1 Forward -72 -53 -5.01543 0.288
NP_442829.1_2 Forward -370 -354 12.6829 0.287
NP_440825.1_7 Forward -287 -277 12.4217 0.155
NP_442837.1_3 Forward -287 -280 15.7721 0.0124
NP_442837.1_3 Reverse -280 -287 15.7721 0.0124
NP_440160.1_2 Reverse -359 -378 -7.17871 0.283
NP_442053.1_1 Forward -288 -279 18.3876 0.0007
NP_442053.1_1 Reverse -279 -288 18.3876 0.0007
NP_440505.1_3 Forward -290 -280 17.188 0.00332
NP_440505.1_3 Reverse -301 -311 8.92815 0.131
NP_440505.1_3 Reverse -277 -287 6.76487 0.169
NP_440505.1_7 Reverse -272 -291 2.16274 0.237
NP_442532.1_7 Forward -288 -274 4.52282 0.171
NP_442532.1_7 Reverse -294 -308 1.57289 0.279
NP_440914.1_1 Reverse -279 -289 16.3248 0.00196
NP_440914.1_1 Forward -288 -278 8.6151 0.186
NP_441011.1_8 Forward -287 -278 16.9127 0.00602
NP_441011.1_8 Reverse -280 -289 16.6177 0.00602
NP_442533.1_6 Forward -288 -279 17.2076 0.00137
NP_442533.1_6 Reverse -279 -288 17.2076 0.00137
NP_442229.1_9 Reverse -243 -262 22.8114 0.027
NP_443016.1_1 Forward -294 -275 -5.80207 0.251
NP_441482.1_7 Forward -294 -280 -2.85201 0.1
NP_442293.1_6 Forward -65 -46 14.2574 0.298
NP_439944.1_9 Reverse -280 -290 9.12481 0.1
NP_441028.1_6 Reverse -342 -352 6.37109 0.23
NP_440116.1_5 Reverse -276 -293 9.77361 0.147
NP_440116.1_8 Reverse -280 -299 -3.54046 0.154
NP_441527.1_4 Forward -97 -78 7.30471 0.0947
NP_441527.1_4 Forward -78 -59 -2.33998 0.156
NP_441527.1_4 Forward -96 -77 -4.24981 0.182
NP_441527.1_4 Forward -79 -60 -6.15965 0.215
NP_441527.1_4 Forward -94 -75 -6.44613 0.218
NP_441527.1_4 Forward -95 -76 -8.06949 0.24
NP_441527.1_4 Forward -81 -62 -8.16498 0.241
NP_441527.1_4 Forward -91 -72 -10.1703 0.266
NP_441527.1_4 Forward -98 -79 -11.7937 0.284
NP_441527.1_5 Forward -130 -111 12.0176 0.297
NP_440115.1_6 Forward -291 -281 14.0414 0.0615
NP_439965.1_1 Forward -297 -278 -4.6221 0.195
NP_441972.1_5 Forward -322 -303 -4.81876 0.211
NP_441106.1_1 Forward -289 -280 18.486 0.0028
NP_441106.1_1 Reverse -278 -287 18.191 0.0028
NP_439903.1_6 Forward -291 -272 4.71854 0.191
NP_442306.1_10 Forward -293 -274 -20.7484 0.226
NP_442306.1_10 Reverse -289 -308 -21.24 0.254
NP_441286.1_1 Forward -289 -277 -3.40261 0.145
NP_441286.1_1 Reverse -278 -290 -3.59927 0.145
NP_440670.1_8 Forward -288 -279 18.3876 0.000699
NP_440670.1_8 Reverse -279 -288 18.3876 0.000699
NP_441479.1_1 Reverse -276 -295 11.0125 0.211
NP_440886.1_7 Reverse -278 -288 17.7774 0.0011
NP_440886.1_7 Forward -289 -279 8.04271 0.0805
NP_442614.1_2 Reverse -279 -293 8.25939 0.255
NP_442614.1_2 Forward -128 -114 7.07942 0.275
NP_442072.1_9 Reverse -278 -296 -21.122 0.206
NP_441427.1_5 Forward -53 -34 7.96426 0.291
NP_440907.2_8 Forward -287 -277 14.2375 0.0312
NP_440907.2_8 Reverse -280 -290 9.616 0.103
NP_441021.1_8 Forward -121 -103 2.77242 0.239
NP_442842.1_10 Reverse -77 -96 5.7076 0.207
NP_442842.1_10 Reverse -76 -95 0.174202 0.27
NP_442893.1_3 Forward -207 -188 15.8299 0.19
NP_441626.1_2 Forward -287 -280 15.7721 0.0124
NP_441626.1_2 Reverse -280 -287 15.7721 0.0124
NP_442365.1_7 Reverse -275 -294 -5.60541 0.274
NP_442615.1_1 Reverse -270 -288 5.82068 0.0374
NP_442615.1_1 Forward -297 -279 2.87075 0.0614
NP_441962.1_4 Reverse -289 -308 -10.7186 0.232
NP_440387.1_1 Forward -288 -272 22.6747 0.00191
NP_440387.1_1 Reverse -279 -295 -1.3181 0.142
NP_441431.1_2 Forward -291 -277 16.7152 0.033
NP_441431.1_2 Reverse -276 -290 7.66879 0.237
NP_441836.1_10 Forward -372 -353 9.24257 0.197
NP_441174.1_2 Forward -291 -277 16.0275 0.0864
NP_440114.1_10 Forward -288 -274 12.6843 0.0754
NP_440114.1_10 Reverse -279 -293 9.04604 0.186
NP_440114.1_10 Forward -312 -298 7.17775 0.243
NP_440293.1_10 Reverse -312 -331 1.0811 0.219
NP_441311.1_2 Forward -294 -280 14.1586 0.229
NP_442867.1_8 Forward -301 -282 6.39097 0.262
NP_442867.1_8 Reverse -346 -365 5.211 0.276
NP_440457.1_1 Forward -292 -280 10.2654 0.092
NP_440457.1_1 Reverse -290 -302 7.90546 0.101
NP_440798.1_6 Reverse -280 -293 10.8357 0.0721
NP_440798.1_6 Forward -287 -274 5.52582 0.14
NP_440801.1_10 Reverse -290 -309 9.83255 0.272
NP_440473.1_1 Forward -291 -272 24.2723 0.0026
NP_440473.1_9 Reverse -268 -287 -0.000545616 0.128
NP_442509.1_9 Forward -288 -278 16.2041 0.00739
NP_442509.1_9 Reverse -279 -289 8.04271 0.192
NP_442936.1_10 Forward -399 -385 10.8908 0.23
NP_440554.1_4 Reverse -280 -290 17.9746 0.0131
NP_440554.1_4 Forward -287 -277 7.35486 0.103
NP_441885.1_5 Forward -288 -278 11.4848 0.00668
NP_441885.1_5 Reverse -279 -289 11.3864 0.00668
NP_440478.1_10 Reverse -277 -291 15.0442 0.107
NP_440478.1_10 Forward -305 -291 12.9793 0.14
NP_442341.1_7 Forward -289 -275 7.17775 0.11
NP_442341.1_9 Forward -290 -276 10.717 0.133
NP_442341.1_9 Reverse -277 -291 7.07881 0.204
NP_441756.1_5 Reverse -275 -294 -4.72043 0.295
NP_441173.1_3 Reverse -192 -211 13.5691 0.248
NP_441173.1_9 Reverse -94 -102 12.1137 0.21
NP_440191.1_5 Forward -386 -367 17.109 0.143
NP_443000.1_7 Forward -290 -280 20.3345 0.00223
NP_443000.1_7 Reverse -277 -287 1.94665 0.226
NP_440076.1_5 Forward -295 -276 11.7 0.293
NP_441842.1_10 Reverse -272 -286 15.2409 0.0465
NP_440275.1_3 Forward -290 -280 16.1063 0.0155
NP_440275.1_3 Reverse -277 -287 8.33817 0.0602
NP_440091.1_1 Reverse -275 -287 0.727295 0.233
NP_442354.1_8 Reverse -351 -370 11.7992 0.223
NP_441397.1_8 Forward -350 -337 13.0487 0.245
NP_442638.1_3 Forward -182 -163 10.3605 0.298
NP_442638.1_3 Forward -122 -103 10.074 0.298
NP_441207.1_7 Forward -99 -85 12.8375 0.237
NP_441207.1_7 Forward -98 -84 7.90002 0.293
NP_439962.1_4 Forward -296 -277 -7.27704 0.288
NP_440175.1_7 Reverse -21 -39 9.46071 0.28
NP_440216.1_1 Reverse -279 -293 26.254 0.000481
NP_440216.1_1 Forward -288 -274 -1.18038 0.0301
NP_440216.1_9 Forward -126 -117 12.4878 0.237
NP_440172.1_1 Reverse -279 -289 17.5813 0.00421
NP_440172.1_1 Forward -288 -278 8.73149 0.0586
NP_442015.1_10 Reverse -275 -288 10.7374 0.0391
NP_442015.1_10 Forward -292 -279 3.75586 0.178
NP_441226.1_7 Forward -287 -280 14.4934 0.0123
NP_441226.1_7 Reverse -280 -287 14.4934 0.0123
NP_440305.1_1 Forward -266 -252 15.6723 0.16
NP_441111.1_7 Forward -287 -279 18.7023 0.00294
NP_441111.1_7 Reverse -280 -288 18.7023 0.00294
NP_442379.1_10 Forward -295 -278 0.137172 0.223
NP_441766.1_2 Forward -288 -279 17.5026 0.00297
NP_441766.1_2 Reverse -279 -288 17.5026 0.00297
NP_442417.1_5 Reverse -290 -304 8.45605 0.158
NP_442417.1_5 Reverse -279 -293 4.52282 0.292
NP_440416.1_9 Forward -295 -276 1.17943 0.0473
NP_440416.1_9 Reverse -272 -291 -14.7502 0.18
NP_443052.1_8 Reverse -269 -288 -9.34199 0.189
NP_443052.1_8 Forward -298 -279 -13.5702 0.29
NP_440261.1_5 Reverse -280 -293 6.60746 0.0318
NP_440261.1_5 Forward -287 -274 -2.53732 0.0924
NP_440261.1_5 Forward -302 -289 -8.24052 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGAAAAAATTTGTTTCCACTGGCTTCGGTAAAGAATTGGCCCAAAAAGCCGGGGGCAAATATTATCAACTCCCCAAAGCCACTGACCAAGGTATTGCCTCCATGGCCCGCCAGGCGATCGCCGACATGCAATAGAATAAACTGACAAAATGTGCATTAAGTAACATCCCCTTTAGCTCGAAGGTTCAAGGTTGCCTCCACACAACTCAATCATCGATGAAAGATGAAATTAAACAAGTTAATGATGTCGCCAAGCAATTTAAGATGTCAAAAGTCCAACGCAAGGAATTTGGCCGATTTTTGGAAAAAAAGAAACAGGAAGGAAAGGGAGGAACAAAAAATGGACGGGGAGATTTTACTTACCCAGAATTAGAACAACAAGCCAAAGAGTTTCTAAAATC

CDS

ATGAATATTTCTTTTATTTCTTCGACAAATACATCCCCTCAAAAACTTGATCAACGTTATTTAAATAAGCTAATTAATTTGCAGATAAATGGTAAAATTTGCTGGCAAGCTCATCTAGGTTATGGGCAAGAATTATGTCTAGAAATTGGTCAAAAAATTCCCTACTCTTCTCCTAGGCTTCAAGGCGAATCCAAAGGTGAATGGCAGTTTGGGACTAGAGCCTCAGACTGGTCTATTATAACTGCCGGCAAAAGGCCCTGTTTCTTTGTCAAATCATCAGAAGATGAATCAATAATTAGGAGTAAGATAGAAAAACTTAATAATCAGGTCGTTAAAGGCATTAGAATTATCAACTATTCCCCAGGTTATTGCTACTGTTTTAATTTAGGTCATTATGATCTTTTGATTCCCGACCAAAATAATGATGATGGTTTATCTTTATGGGAATTGTTTATACCCGAGCCCGATCGCCTTGTGTTGGAGGTATTTCCCCATCTGAGATTTCAACTACATTCCCAAGATGAAAGTGCCTGA

Protein

MNISFISSTNTSPQKLDQRYLNKLINLQINGKICWQAHLGYGQELCLEIGQKIPYSSPRLQGESKGEWQFGTRASDWSIITAGKRPCFFVKSSEDESIIRSKIEKLNNQVVKGIRIINYSPGYCYCFNLGHYDLLIPDQNNDDGLSLWELFIPEPDRLVLEVFPHLRFQLHSQDESA