Your browser is old and dusty. Try Google Chrome!

Details for slr1772

ORF slr1772
Accession NP_440100.1
Symbol
Category Other
Definition probable hydrolase, periplasmic protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Forward -196 -177 2.75272 0.225
NP_440795.1_7 Reverse -189 -196 10.2655 0.154
NP_440795.1_7 Forward -115 -108 6.43063 0.265
NP_441418.1_6 Forward -197 -178 -19.1751 0.0854
NP_441418.1_6 Reverse -229 -248 -21.6334 0.156
NP_441418.1_6 Reverse -255 -274 -24.19 0.2
NP_441418.1_6 Forward -355 -336 -29.9915 0.249
NP_441418.1_6 Forward -113 -94 -30.5815 0.286
NP_441418.1_6 Reverse -92 -111 -30.7781 0.296
NP_441453.1_4 Reverse -229 -237 7.19758 0.0757
NP_441453.1_4 Forward -238 -230 6.80426 0.121
NP_441453.1_4 Forward -197 -189 4.05099 0.268
NP_441623.1_1 Reverse -187 -205 -3.22577 0.256
NP_442877.1_3 Reverse -218 -237 13.8633 0.176
NP_442151.1_6 Reverse -188 -202 10.7177 0.118
NP_442151.1_6 Forward -355 -341 8.06273 0.183
NP_442151.1_6 Forward -113 -99 5.30946 0.284
NP_440226.1_1 Forward -238 -219 14.8474 0.0289
NP_442623.1_1 Forward -286 -267 -9.83364 0.253
NP_442173.1_1 Forward -237 -229 7.68924 0.142
NP_442173.1_1 Reverse -230 -238 5.72262 0.203
NP_442752.1_4 Forward -238 -231 13.8055 0.0199
NP_442752.1_4 Reverse -371 -378 12.1338 0.0546
NP_442752.1_4 Reverse -274 -281 5.44732 0.202
NP_442752.1_4 Forward -264 -257 5.44732 0.202
NP_443027.1_4 Forward -240 -230 10.9931 0.109
NP_442975.1_10 Forward -359 -345 7.27547 0.138
NP_440784.1_7 Forward -237 -230 6.23397 0.241
NP_440784.1_7 Reverse -230 -237 6.13563 0.241
NP_442861.1_1 Forward -334 -315 9.93088 0.295
NP_440110.1_8 Forward -199 -180 8.65258 0.0906
NP_442062.1_8 Forward -238 -228 16.6963 0.00399
NP_442062.1_8 Reverse -229 -239 7.15819 0.107
NP_442062.1_8 Forward -197 -187 5.87989 0.149
NP_442062.1_8 Forward -264 -254 4.69992 0.201
NP_442062.1_8 Reverse -194 -204 2.83163 0.293
NP_441859.1_3 Reverse -254 -273 5.60352 0.196
NP_440304.1_4 Forward -205 -195 4.3066 0.271
NP_442242.1_4 Reverse -230 -237 10.8555 0.127
NP_441781.1_7 Forward -117 -98 -3.24547 0.295
NP_441208.1_9 Reverse -271 -285 7.9644 0.219
NP_441594.1_6 Forward -206 -187 6.19431 0.193
NP_441594.1_6 Reverse -337 -356 4.52268 0.219
NP_441594.1_6 Forward -119 -100 0.196116 0.291
NP_442110.1_7 Forward -197 -183 0.88457 0.245
NP_441082.1_10 Forward -16 -3 10.4424 0.236
NP_442726.1_7 Reverse -339 -357 2.37909 0.223
NP_440856.1_4 Reverse -315 -334 3.93269 0.115
NP_440856.1_7 Forward -227 -208 -9.73531 0.297
NP_441083.1_3 Reverse -187 -197 15.2208 0.138
NP_441083.1_5 Forward -283 -273 5.97822 0.0967
NP_441083.1_5 Forward -355 -345 1.25834 0.213
NP_441083.1_5 Reverse -346 -356 -0.708283 0.276
NP_441738.1_2 Reverse -231 -238 15.28 0.0102
NP_441738.1_2 Reverse -257 -264 10.2652 0.101
NP_441738.1_2 Forward -281 -274 9.77352 0.143
NP_441738.1_4 Forward -390 -371 6.29264 0.203
NP_441558.1_5 Forward -199 -180 8.45592 0.15
NP_441955.1_8 Forward -244 -227 15.8701 0.163
NP_440209.1_1 Forward -238 -230 8.57422 0.0425
NP_440209.1_1 Reverse -229 -237 5.32929 0.139
NP_442675.1_4 Reverse -338 -356 -4.8974 0.267
NP_440178.1_5 Reverse -235 -244 18.6826 0.137
NP_440178.1_7 Forward -204 -185 -21.9284 0.246
NP_440053.1_2 Reverse -266 -285 10.5209 0.291
NP_442706.1_9 Reverse -85 -104 9.53756 0.241
NP_441716.1_1 Forward -227 -213 10.6193 0.0936
NP_441716.1_1 Reverse -215 -229 5.40779 0.231
NP_441163.1_1 Forward -356 -339 11.6411 0.183
NP_440906.1_5 Forward -237 -230 6.23397 0.234
NP_440906.1_5 Reverse -230 -237 6.13563 0.241
NP_442596.1_9 Forward -398 -379 13.7658 0.283
NP_440747.1_10 Reverse -226 -238 -2.51763 0.0509
NP_440747.1_10 Reverse -343 -355 -4.28759 0.0903
NP_441486.1_1 Forward -241 -227 3.24451 0.0638
NP_441486.1_1 Reverse -343 -357 0.786239 0.126
NP_441486.1_1 Forward -358 -344 -5.50694 0.242
NP_442850.1_1 Forward -199 -180 15.1865 0.275
NP_440842.1_6 Reverse -171 -190 10.52 0.283
NP_441014.1_10 Forward -294 -275 -2.8529 0.289
NP_442848.1_4 Reverse -308 -322 20.5508 0.0858
NP_442848.1_5 Forward -204 -186 -3.22577 0.29
NP_442848.1_9 Reverse -340 -359 1.76941 0.255
NP_443018.1_3 Forward -237 -230 12.6255 0.0471
NP_443018.1_3 Reverse -226 -233 8.20058 0.153
NP_443018.1_3 Reverse -230 -237 5.25066 0.214
NP_443018.1_3 Reverse -189 -196 4.36568 0.254
NP_443018.1_3 Forward -196 -189 4.07068 0.299
NP_441634.1_8 Forward -199 -185 2.94952 0.158
NP_440376.1_1 Reverse -346 -355 7.47288 0.0751
NP_440376.1_1 Forward -355 -346 0.688044 0.262
NP_440376.1_1 Reverse -371 -380 0.0980582 0.285
NP_440376.1_1 Forward -238 -229 -0.000272808 0.285
NP_440376.1_1 Forward -264 -255 -0.0986038 0.285
NP_440376.1_1 Reverse -229 -238 -0.0986038 0.285
NP_441588.1_4 Reverse -231 -241 6.96153 0.178
NP_442687.1_7 Forward -239 -229 5.78156 0.188
NP_442687.1_7 Forward -356 -346 5.38824 0.206
NP_442687.1_7 Forward -228 -218 4.89658 0.23
NP_441846.1_10 Forward -198 -179 -16.1268 0.256
NP_441422.1_3 Reverse -269 -288 16.5473 0.196
NP_441422.1_7 Reverse -99 -116 -4.38605 0.243
NP_440533.1_9 Forward -238 -219 12.5858 0.0892
NP_442658.1_1 Reverse -186 -196 6.76441 0.214
NP_442658.1_1 Reverse -227 -237 6.56775 0.224
NP_442658.1_1 Forward -240 -230 6.17443 0.235
NP_442658.1_1 Forward -205 -195 5.48612 0.265
NP_442782.1_2 Forward -238 -224 11.3077 0.173
NP_442496.1_5 Forward -210 -192 14.6705 0.174
NP_440656.1_8 Forward -249 -230 -3.73712 0.198
NP_441414.1_9 Reverse -346 -365 -7.37537 0.217
NP_442937.1_5 Reverse -189 -208 12.3892 0.111
NP_441958.1_5 Forward -239 -229 1.55333 0.095
NP_441958.1_5 Forward -265 -255 -2.57657 0.28
NP_441127.1_1 Reverse -185 -199 7.66941 0.3
NP_440203.1_5 Reverse -257 -267 9.321 0.263
NP_440203.1_5 Forward -280 -270 8.82935 0.283
NP_442911.1_2 Reverse -178 -197 -1.27885 0.0834
NP_442911.1_2 Forward -365 -346 -5.11376 0.15
NP_442536.1_4 Forward -289 -271 7.00065 0.299
NP_443055.1_3 Forward -247 -228 12.0775 0.231
NP_443055.1_6 Forward -388 -370 5.42659 0.179
NP_440993.1_3 Reverse -94 -113 18.6815 0.0527
NP_440993.1_3 Forward -123 -104 0.686995 0.247
NP_440993.1_3 Reverse -178 -197 -0.39464 0.266
NP_440496.1_2 Forward -155 -136 16.2241 0.115
NP_440602.1_8 Reverse -229 -243 17.1092 0.103
NP_441129.1_3 Forward -277 -258 -9.73531 0.228
NP_441099.1_5 Reverse -184 -203 -11.5053 0.283
NP_442002.1_9 Forward -239 -232 10.7572 0.185
NP_441646.1_1 Forward -210 -191 5.211 0.182
NP_441646.1_5 Reverse -138 -157 17.6007 0.287
NP_442438.1_10 Reverse -183 -197 14.8476 0.0304
NP_441000.1_6 Forward -239 -225 4.22782 0.0964
NP_441000.1_6 Reverse -228 -242 -3.44199 0.221
NP_441674.1_6 Forward -202 -183 15.1424 0.0749
NP_441550.1_8 Forward -184 -174 6.17443 0.214
NP_441916.1_7 Reverse -229 -239 15.9097 0.0072
NP_441916.1_7 Reverse -346 -356 7.25653 0.0718
NP_441916.1_7 Forward -238 -228 6.66654 0.0875
NP_441916.1_10 Forward -211 -192 4.32602 0.223
NP_441916.1_10 Forward -205 -186 1.17943 0.27
NP_440206.1_4 Reverse -178 -197 2.6536 0.289
NP_440206.1_4 Reverse -184 -203 -0.689632 0.29
NP_440016.1_9 Reverse -223 -242 8.55425 0.3
NP_441725.1_4 Reverse -224 -238 3.04726 0.279
NP_441725.1_5 Reverse -195 -205 4.79825 0.115
NP_441725.1_5 Reverse -230 -240 1.455 0.135
NP_439966.1_7 Forward -240 -230 8.73102 0.13
NP_439966.1_7 Reverse -227 -237 7.45273 0.15
NP_439966.1_9 Forward -240 -231 0.983037 0.253
NP_442941.1_3 Reverse -230 -240 1.65166 0.147
NP_442941.1_3 Reverse -189 -199 0.766681 0.171
NP_442941.1_3 Reverse -347 -357 -0.609952 0.264
NP_440289.1_2 Forward -241 -228 -4.40561 0.288
NP_440289.1_8 Forward -325 -311 18.2885 0.135
NP_441554.1_4 Forward -172 -158 14.5017 0.244
NP_442281.1_1 Forward -243 -229 12.6836 0.035
NP_442281.1_1 Reverse -224 -238 9.6354 0.0684
NP_442281.1_1 Reverse -250 -264 9.34041 0.0717
NP_442281.1_1 Reverse -220 -234 9.14375 0.0736
NP_442281.1_1 Forward -202 -188 1.86729 0.285
NP_440437.1_1 Reverse -182 -201 -5.40875 0.282
NP_442012.1_1 Reverse -188 -207 5.11266 0.154
NP_442012.1_1 Forward -270 -251 0.687771 0.235
NP_441457.1_7 Forward -205 -186 3.53937 0.234
NP_441556.1_4 Forward -250 -231 12.9937 0.201
NP_441556.1_10 Reverse -189 -203 11.9739 0.205
NP_443030.1_4 Reverse -277 -296 -5.60541 0.272
NP_441644.1_6 Forward -355 -345 4.89613 0.22
NP_441644.1_6 Reverse -188 -198 3.71617 0.267
NP_443049.1_6 Reverse -243 -253 12.7145 0.238
NP_442215.1_2 Reverse -216 -232 0.451859 0.151
NP_442215.1_2 Forward -357 -341 -2.79306 0.204
NP_442215.1_2 Forward -115 -99 -3.67804 0.22
NP_440253.1_2 Reverse -229 -247 -3.12744 0.286
NP_442933.1_10 Reverse -229 -238 15.1427 0.00958
NP_442933.1_10 Forward -238 -229 7.96454 0.0937
NP_442933.1_10 Forward -355 -346 4.81794 0.212
NP_441751.2_8 Reverse -230 -244 -4.81863 0.183
NP_441751.2_8 Reverse -189 -203 -5.21195 0.199
NP_442554.1_8 Reverse -189 -199 5.38824 0.15
NP_442554.1_8 Forward -202 -192 5.19158 0.157
NP_442554.1_8 Reverse -230 -240 4.0116 0.2
NP_442554.1_8 Forward -196 -186 2.04498 0.285
NP_441762.1_7 Reverse -228 -240 3.97222 0.0602
NP_441762.1_7 Forward -239 -227 -5.07423 0.187
NP_442142.1_4 Forward -241 -228 12.8017 0.0409
NP_442142.1_4 Reverse -226 -239 2.28034 0.295
NP_442292.1_1 Reverse -230 -239 -0.196935 0.239
NP_442292.1_1 Forward -354 -345 -0.393597 0.245
NP_442292.1_1 Reverse -189 -198 -0.68859 0.268
NP_442476.1_6 Forward -237 -223 1.47456 0.214
NP_442381.1_8 Forward -241 -222 -13.2752 0.268
NP_443009.1_5 Forward -198 -187 5.76138 0.189
NP_443009.1_5 Forward -265 -254 3.8931 0.274
NP_441715.1_4 Forward -237 -227 7.84651 0.107
NP_441715.1_4 Reverse -347 -357 7.05986 0.118
NP_441715.1_4 Reverse -230 -240 6.46988 0.143
NP_441448.1_2 Forward -288 -269 -0.689632 0.266
NP_440379.1_5 Reverse -179 -198 -9.83364 0.267
NP_440464.1_10 Forward -252 -242 12.2442 0.242
NP_441468.1_1 Forward -237 -230 6.13563 0.209
NP_441468.1_1 Reverse -230 -237 6.0373 0.223
NP_441468.1_1 Reverse -189 -196 4.46401 0.224
NP_441020.2_6 Forward -103 -86 5.84037 0.289
NP_441015.1_10 Forward -202 -183 -9.53865 0.282
NP_441673.1_1 Forward -355 -346 1.57302 0.0764
NP_441673.1_1 Reverse -346 -355 1.57302 0.0764
NP_441673.1_1 Forward -238 -229 1.27803 0.155
NP_441673.1_1 Reverse -229 -238 1.27803 0.155
NP_442253.1_5 Reverse -191 -208 -6.64766 0.298
NP_441826.1_2 Forward -203 -189 -3.34366 0.284
NP_442868.1_6 Reverse -344 -354 0.865012 0.205
NP_442868.1_6 Forward -199 -189 0.865012 0.205
NP_441056.1_1 Reverse -188 -207 -7.96535 0.282
NP_442227.1_2 Reverse -257 -276 -1.86883 0.268
NP_442361.1_3 Forward -244 -231 7.88576 0.285
NP_442808.1_1 Reverse -228 -238 8.63269 0.0481
NP_442808.1_1 Forward -284 -274 5.09279 0.173
NP_440145.1_3 Reverse -219 -238 -0.885524 0.144
NP_440145.1_4 Reverse -256 -266 15.6142 0.193
NP_442542.1_2 Reverse -186 -199 10.344 0.126
NP_442542.1_9 Forward -245 -231 10.717 0.111
NP_442542.1_9 Reverse -181 -195 9.24208 0.138
NP_440334.1_2 Reverse -54 -67 17.6205 0.203
NP_442977.1_9 Forward -79 -61 15.7582 0.295
NP_440558.1_2 Forward -206 -187 -0.4922 0.203
NP_442789.1_4 Forward -115 -96 -1.08219 0.213
NP_442789.1_4 Reverse -372 -391 -3.14714 0.246
NP_442789.1_4 Forward -202 -183 -5.80207 0.279
NP_441518.1_3 Forward -207 -188 -4.13045 0.119
NP_441518.1_3 Forward -248 -229 -5.40875 0.123
NP_442792.1_8 Forward -354 -335 9.53756 0.205
NP_441878.1_1 Reverse -252 -271 19.9633 0.173
NP_441878.1_6 Forward -204 -194 2.33998 0.0405
NP_441878.1_6 Forward -228 -218 0.57002 0.14
NP_441878.1_6 Reverse -187 -197 -7.29646 0.217
NP_441036.1_8 Forward -239 -229 12.7631 0.0678
NP_441036.1_8 Reverse -228 -238 8.1415 0.176
NP_441036.1_8 Forward -356 -346 7.45319 0.197
NP_441036.1_8 Reverse -187 -197 5.5849 0.271
NP_441557.1_5 Forward -238 -229 8.94785 0.0289
NP_441557.1_5 Forward -355 -346 0.688044 0.128
NP_441557.1_5 Reverse -346 -355 0.688044 0.128
NP_441557.1_5 Reverse -229 -238 0.688044 0.128
NP_441557.1_5 Reverse -188 -197 -1.77023 0.299
NP_441557.1_8 Forward -379 -369 15.7125 0.18
NP_441445.1_1 Forward -364 -345 7.17762 0.138
NP_442777.1_1 Reverse -256 -275 8.25844 0.225
NP_442419.1_2 Reverse -224 -243 5.50599 0.17
NP_442419.1_2 Reverse -189 -208 4.22769 0.185
NP_442183.1_1 Reverse -229 -243 8.06273 0.124
NP_442397.1_9 Reverse -212 -231 2.26107 0.28
NP_441655.1_10 Reverse -190 -208 3.65739 0.273
NP_441574.1_1 Forward -209 -190 -7.37537 0.289
NP_440058.1_7 Forward -98 -79 7.66927 0.247
NP_442347.1_2 Reverse -230 -239 10.9145 0.0571
NP_442347.1_2 Forward -354 -345 5.3096 0.233
NP_442645.1_2 Forward -101 -82 -16.7168 0.24
NP_442645.1_2 Forward -205 -186 -16.9135 0.245
NP_442965.1_2 Reverse -372 -391 -3.24547 0.255
NP_440547.1_1 Reverse -177 -196 14.2566 0.16
NP_440932.1_10 Reverse -156 -175 22.2223 0.0359
NP_441633.1_3 Reverse -102 -115 -1.65234 0.16
NP_441633.1_3 Reverse -344 -357 -3.32397 0.177
NP_441633.1_3 Reverse -227 -240 -4.20895 0.185
NP_440136.1_2 Forward -237 -230 6.23397 0.171
NP_440136.1_2 Reverse -230 -237 6.13563 0.193
NP_442590.1_9 Reverse -228 -247 6.29264 0.261
NP_442590.1_10 Forward -361 -342 3.24438 0.294
NP_442998.1_2 Forward -118 -99 5.30853 0.257
NP_442998.1_5 Reverse -376 -386 12.7631 0.159
NP_442998.1_10 Reverse -231 -238 15.5754 0.0102
NP_440899.1_9 Reverse -244 -263 27.6305 0.00176
NP_440299.1_1 Reverse -190 -203 5.72191 0.166
NP_441799.1_1 Reverse -318 -332 4.22722 0.261
NP_441799.1_1 Reverse -225 -239 3.8339 0.279
NP_440640.1_9 Reverse -356 -375 11.5042 0.298
NP_441007.1_10 Reverse -183 -196 -0.37404 0.277
NP_440256.1_1 Reverse -226 -245 4.81767 0.0411
NP_440256.1_1 Forward -383 -364 -8.65367 0.264
NP_441559.1_8 Forward -288 -274 -4.03198 0.215
NP_440915.1_6 Reverse -367 -381 0.294584 0.17
NP_442158.1_4 Forward -361 -351 12.4681 0.252
NP_441704.1_8 Reverse -183 -202 6.39016 0.262
NP_440748.1_5 Forward -201 -182 -0.590531 0.26
NP_441464.1_8 Reverse -194 -208 11.2093 0.178
NP_441464.1_10 Reverse -153 -167 9.73436 0.262
NP_441939.1_3 Forward -196 -177 8.16093 0.18
NP_441494.1_6 Reverse -189 -202 8.47575 0.23
NP_442993.1_1 Reverse -188 -204 -1.12144 0.0876
NP_442993.1_1 Reverse -346 -362 -11.2495 0.24
NP_440677.1_1 Reverse -337 -356 10.3242 0.174
NP_440677.1_1 Reverse -179 -198 7.96426 0.221
NP_442386.1_9 Reverse -228 -237 6.9808 0.219
NP_442386.1_9 Forward -381 -372 6.78414 0.219
NP_442386.1_9 Reverse -254 -263 6.39082 0.219
NP_442386.1_9 Forward -239 -230 5.9975 0.23
NP_441750.1_4 Reverse -226 -245 3.04771 0.235
NP_441750.1_7 Reverse -267 -277 14.533 0.254
NP_441340.1_5 Forward -237 -230 6.23397 0.132
NP_441340.1_5 Reverse -230 -237 5.84064 0.208
NP_441340.1_5 Forward -196 -189 3.97235 0.274
NP_441947.1_4 Forward -249 -230 19.0757 0.047
NP_441947.1_4 Reverse -204 -223 11.9958 0.239
NP_442791.1_5 Forward -246 -227 -10.817 0.281
NP_442791.1_9 Reverse -186 -205 17.5015 0.138
NP_442240.1_1 Reverse -96 -115 4.22689 0.273
NP_442240.1_2 Forward -237 -218 -10.817 0.137
NP_440161.1_3 Forward -275 -256 11.0125 0.221
NP_440161.1_3 Reverse -227 -246 10.5209 0.23
NP_440586.1_1 Forward -120 -101 -4.91709 0.278
NP_440586.1_8 Forward -237 -230 14.69 0.026
NP_440586.1_8 Reverse -226 -233 9.08521 0.178
NP_442251.1_6 Reverse -230 -237 12.0355 0.0627
NP_440684.1_9 Reverse -340 -354 17.8958 0.0428
NP_440684.1_9 Forward -203 -189 10.9143 0.185
NP_441262.1_3 Forward -238 -231 14.7888 0.0223
NP_443051.1_1 Forward -239 -230 0.884706 0.125
NP_439996.1_2 Reverse -180 -199 12.7825 0.113
NP_439996.1_2 Forward -196 -177 4.03102 0.244
NP_439937.1_9 Reverse -253 -270 -12.8431 0.276
NP_441595.1_2 Reverse -39 -52 8.84703 0.28
NP_440439.1_1 Forward -241 -228 -0.37404 0.215
NP_440439.1_1 Forward -267 -254 -1.75067 0.281
NP_440439.1_1 Reverse -226 -239 -1.849 0.285
NP_440372.1_2 Forward -237 -230 6.82395 0.0854
NP_440372.1_2 Reverse -230 -237 6.52896 0.188
NP_441803.1_2 Reverse -99 -118 -0.39387 0.275
NP_442384.1_10 Forward -283 -270 2.67422 0.216
NP_442384.1_10 Reverse -173 -186 2.18257 0.235
NP_442384.1_10 Reverse -346 -359 1.49425 0.257
NP_440364.1_6 Forward -349 -336 14.67 0.275
NP_442262.1_10 Forward -237 -230 12.9205 0.0422
NP_442262.1_10 Reverse -226 -233 9.38056 0.202
NP_440163.1_10 Forward -241 -231 15.2213 0.0762
NP_440163.1_10 Forward -200 -190 10.6981 0.198
NP_440344.1_10 Forward -245 -228 -4.38605 0.0956
NP_440344.1_10 Reverse -339 -356 -12.5475 0.257
NP_440344.1_10 Reverse -364 -381 -13.5308 0.287
NP_440531.1_6 Forward -246 -227 -0.688862 0.218
NP_441335.1_4 Reverse -183 -202 9.24257 0.26
NP_441335.1_8 Reverse -273 -292 9.14423 0.232
NP_441965.1_10 Forward -241 -225 4.18844 0.247
NP_440297.1_9 Reverse -189 -199 -0.41329 0.283
NP_440297.1_9 Reverse -230 -240 -0.511621 0.289
NP_440100.1_2 Forward -334 -317 28.7515 0.0018
NP_440298.1_6 Forward -139 -125 17.1085 0.251
NP_440894.1_10 Forward -360 -341 14.8474 0.0958
YP_680420.1_10 Forward -243 -224 15.8307 0.274
NP_442067.1_4 Reverse -177 -196 13.3725 0.0909
NP_440999.1_9 Reverse -184 -198 2.2612 0.152
NP_440888.1_2 Forward -380 -366 10.5204 0.0919
NP_440888.1_2 Forward -197 -183 5.80051 0.262
NP_440803.1_7 Reverse -305 -324 17.8957 0.2
NP_442557.1_2 Forward -206 -188 14.9655 0.156
NP_440491.1_1 Forward -116 -97 14.7136 0.0994
NP_442033.1_10 Forward -285 -266 -8.35868 0.196
NP_442033.1_10 Reverse -252 -271 -10.1286 0.228
NP_441543.1_2 Forward -237 -228 13.5694 0.0248
NP_441543.1_2 Reverse -230 -239 8.65285 0.0968
NP_441543.1_2 Reverse -347 -356 5.89959 0.169
NP_442845.1_2 Forward -203 -189 5.30946 0.237
NP_441469.1_8 Reverse -187 -196 13.5694 0.073
NP_441469.1_8 Forward -204 -195 7.76787 0.227
NP_441469.1_8 Forward -239 -230 6.39124 0.227
NP_442578.1_7 Forward -237 -230 14.6904 0.026
NP_440220.1_4 Forward -393 -374 5.99684 0.204
NP_441462.1_2 Forward -238 -228 1.25834 0.0964
NP_441462.1_2 Reverse -346 -356 0.373358 0.154
NP_441621.1_7 Forward -199 -185 -4.13031 0.208
NP_441621.1_7 Forward -196 -182 -6.39192 0.29
NP_443062.1_1 Forward -238 -220 6.69328 0.194
NP_441351.1_8 Reverse -186 -205 7.27595 0.192
NP_440516.1_2 Forward -289 -271 4.24738 0.138
NP_440516.1_8 Forward -238 -229 0.983037 0.13
NP_442428.1_5 Forward -237 -230 6.13563 0.209
NP_442428.1_5 Reverse -230 -237 6.0373 0.212
NP_442428.1_5 Reverse -189 -196 4.759 0.223
NP_442428.1_5 Forward -354 -347 3.67736 0.298
NP_442859.1_2 Forward -237 -218 6.88262 0.199
NP_442120.1_10 Forward -203 -184 -8.65367 0.237
NP_441867.1_2 Forward -212 -193 -13.4719 0.277
NP_440673.1_3 Reverse -231 -238 12.4288 0.0426
NP_440673.1_3 Forward -353 -346 7.41394 0.263
NP_440865.1_9 Forward -203 -184 -6.49039 0.226
NP_441052.1_2 Forward -355 -345 8.23984 0.0482
NP_441052.1_2 Forward -227 -217 1.84832 0.225
NP_442219.1_8 Forward -207 -188 7.58731 0.267
NP_442219.1_8 Reverse -184 -203 6.52434 0.294
NP_442219.1_9 Forward -354 -345 5.3096 0.177
NP_440436.1_4 Reverse -230 -239 8.55409 0.0997
NP_440436.1_4 Forward -237 -228 7.37413 0.132
NP_441884.1_8 Forward -239 -220 1.76941 0.138
NP_441884.1_9 Forward -116 -97 -22.3217 0.277
NP_441884.1_9 Forward -206 -187 -23.5016 0.284
NP_442086.1_3 Forward -237 -218 5.99764 0.288
NP_442907.1_2 Forward -202 -184 14.7688 0.169
NP_441719.1_4 Forward -237 -230 13.5105 0.026
NP_441719.1_4 Reverse -230 -237 6.52896 0.188
NP_441733.1_10 Forward -241 -228 8.67241 0.138
NP_441733.1_10 Forward -267 -254 5.82081 0.203
NP_441004.1_1 Forward -209 -190 0.982764 0.111
NP_441004.1_2 Forward -214 -195 -3.24547 0.274
NP_441004.1_4 Forward -206 -196 10.5998 0.254
NP_442366.1_3 Reverse -228 -246 3.3624 0.111
NP_442366.1_5 Reverse -343 -353 12.7626 0.108
NP_440129.1_10 Forward -245 -231 3.73617 0.189
NP_442873.1_3 Reverse -178 -197 11.2084 0.169
NP_442694.1_4 Reverse -154 -163 13.8644 0.217
NP_442694.1_4 Forward -263 -254 11.1111 0.279
NP_443054.1_2 Forward -357 -343 -0.197071 0.288
NP_442430.1_10 Reverse -219 -238 9.83173 0.277
NP_441851.1_10 Forward -239 -229 13.2547 0.0333
NP_441851.1_10 Forward -265 -255 6.07655 0.187
NP_441851.1_10 Reverse -370 -380 4.79825 0.247
NP_442622.1_1 Reverse -178 -197 -4.6221 0.248
NP_442011.1_1 Reverse -165 -184 -1.08219 0.268
NP_442856.1_7 Reverse -179 -198 -2.95047 0.239
NP_442515.1_1 Reverse -345 -359 12.586 0.0337
NP_442515.1_1 Reverse -83 -97 -2.75368 0.279
NP_442515.1_1 Reverse -193 -207 -3.54032 0.292
NP_440593.1_3 Reverse -99 -118 -3.73712 0.241
NP_440593.1_3 Reverse -189 -208 -4.03212 0.244
NP_442689.1_8 Reverse -79 -96 -8.81095 0.298
NP_440432.1_9 Reverse -230 -245 0.0782283 0.16
NP_442843.1_1 Reverse -372 -391 8.45592 0.118
NP_442843.1_1 Forward -272 -253 7.7676 0.135
NP_442843.1_1 Forward -131 -112 -9.83364 0.271
NP_440474.1_8 Reverse -230 -244 12.192 0.0915
NP_440474.1_8 Reverse -189 -203 5.30886 0.251
NP_441124.1_5 Reverse -376 -386 10.7163 0.286
NP_442450.1_5 Forward -240 -230 6.07655 0.204
NP_442168.1_5 Reverse -372 -391 10.7175 0.137
NP_442006.1_2 Forward -197 -180 -15.2025 0.22
NP_442006.1_2 Reverse -179 -196 -15.3008 0.221
NP_442006.1_2 Forward -247 -230 -16.6774 0.261
NP_441003.1_9 Reverse -179 -198 10.2259 0.213
NP_442243.1_1 Reverse -182 -200 3.75497 0.2
NP_441570.1_1 Reverse -229 -247 -9.42063 0.137
NP_441078.1_4 Reverse -346 -355 0.589713 0.174
NP_441078.1_4 Forward -355 -346 0.393051 0.205
NP_441078.1_4 Reverse -229 -238 0.0980582 0.205
NP_441078.1_4 Forward -238 -229 0.0980582 0.205
NP_441078.1_4 Forward -203 -194 -1.57357 0.266
NP_441078.1_4 Reverse -188 -197 -1.86856 0.272
NP_442348.1_2 Forward -264 -255 15.3394 0.146
NP_440526.1_3 Reverse -256 -267 6.54802 0.195
NP_441432.1_8 Reverse -345 -354 4.22796 0.235
NP_442320.1_8 Forward -244 -230 3.14618 0.0674
NP_442320.1_8 Reverse -223 -237 -1.96703 0.0847
NP_442320.1_8 Reverse -249 -263 -3.73699 0.131
NP_442320.1_8 Forward -203 -189 -5.40861 0.225
NP_442003.1_4 Forward -282 -263 10.2259 0.288
NP_440760.1_1 Reverse -84 -103 -15.1435 0.142
NP_442797.1_6 Reverse -190 -209 8.61286 0.265
NP_440199.1_10 Forward -241 -231 14.533 0.0861
NP_440199.1_10 Forward -200 -190 8.82982 0.229
NP_441805.1_2 Reverse -177 -196 -2.0655 0.223
NP_442353.1_4 Reverse -340 -359 4.62021 0.204
NP_442400.1_1 Reverse -226 -245 -3.93378 0.253
NP_442489.1_7 Reverse -229 -238 7.57121 0.057
NP_442489.1_7 Forward -355 -346 0.884706 0.145
NP_442489.1_7 Reverse -346 -355 0.884706 0.145
NP_442489.1_7 Forward -238 -229 0.589713 0.17
NP_442489.1_7 Reverse -188 -197 -1.37691 0.195
NP_442489.1_7 Forward -203 -194 -1.57357 0.213
NP_442489.1_7 Reverse -194 -203 -2.06522 0.288
NP_440559.1_1 Forward -237 -228 5.80125 0.136
NP_441659.2_8 Forward -197 -187 3.61828 0.154
NP_441659.2_8 Reverse -229 -239 0.0783647 0.277
NP_442913.1_10 Forward -236 -217 -3.93378 0.221
NP_440779.1_5 Reverse -229 -246 -6.25434 0.17
NP_442346.1_5 Forward -198 -188 10.4031 0.0967
NP_442346.1_5 Forward -228 -218 10.2065 0.103
NP_442346.1_5 Reverse -345 -355 9.51814 0.118
NP_442346.1_5 Forward -204 -194 4.79825 0.272
NP_440545.1_3 Forward -201 -184 -0.157821 0.149
NP_440025.1_1 Reverse -225 -244 11.0125 0.157
NP_440555.1_7 Forward -199 -180 15.3391 0.267
NP_441923.1_6 Forward -196 -182 17.3058 0.129
NP_440459.1_6 Forward -137 -118 14.6508 0.2
NP_440010.1_4 Reverse -94 -113 0.195343 0.25
NP_440847.1_3 Reverse -256 -270 10.717 0.283
NP_441888.1_7 Reverse -366 -380 6.29277 0.225
NP_441948.1_4 Forward -245 -227 -2.93078 0.179
NP_441833.1_4 Reverse -230 -237 6.52896 0.0924
NP_441833.1_4 Forward -237 -230 6.23397 0.163
NP_441112.1_6 Forward -248 -229 -3.14714 0.296
NP_442699.1_8 Forward -326 -307 -12.0953 0.238
NP_442162.1_9 Forward -237 -230 6.62729 0.142
NP_442162.1_9 Reverse -230 -237 6.52896 0.178
NP_442055.1_8 Forward -69 -50 11.995 0.254
NP_440671.1_4 Forward -244 -230 5.30946 0.286
NP_440671.1_6 Reverse -216 -235 12.1917 0.234
NP_442140.1_3 Forward -196 -186 5.09324 0.227
NP_442140.1_3 Forward -237 -227 4.69992 0.238
NP_440875.1_9 Forward -236 -226 9.63741 0.233
NP_440875.1_9 Forward -378 -368 9.15072 0.233
NP_440875.1_9 Reverse -231 -241 8.37203 0.233
NP_441813.1_5 Reverse -227 -237 9.02648 0.0313
NP_441813.1_5 Forward -240 -230 7.45319 0.0746
NP_440590.1_4 Reverse -275 -288 -5.88057 0.293
NP_440567.1_1 Reverse -230 -244 2.45787 0.174
NP_442497.1_1 Forward -286 -267 20.8447 0.0463
NP_442497.1_10 Reverse -230 -239 0.589713 0.153
NP_442497.1_10 Forward -237 -228 -1.18024 0.256
NP_440821.1_4 Forward -240 -230 9.32148 0.03
NP_440821.1_4 Forward -357 -347 -0.0199663 0.217
NP_441239.1_9 Forward -205 -193 8.00379 0.145
NP_441239.1_9 Reverse -186 -198 6.62715 0.182
NP_441239.1_9 Reverse -227 -239 5.84051 0.206
NP_441239.1_9 Reverse -253 -265 5.05386 0.231
NP_441727.1_3 Reverse -187 -206 4.22769 0.268
NP_441892.1_1 Forward -247 -230 9.38028 0.073
NP_440665.1_1 Reverse -176 -195 8.06259 0.107
NP_441874.1_1 Forward -215 -201 9.34103 0.277
NP_442138.1_10 Forward -355 -336 7.96426 0.0616
NP_442138.1_10 Reverse -229 -248 -7.96535 0.296
NP_442809.1_6 Forward -203 -184 3.6377 0.256
NP_440546.1_4 Reverse -371 -381 8.78555 0.171
NP_440546.1_6 Forward -396 -377 7.17762 0.278
NP_439974.1_4 Reverse -177 -196 10.9142 0.24
NP_440462.1_6 Forward -240 -230 12.1731 0.0371
NP_440462.1_6 Reverse -227 -237 6.96153 0.0932
NP_440868.1_4 Reverse -225 -237 7.80712 0.0637
NP_440868.1_4 Forward -242 -230 -1.04266 0.291
NP_441848.1_4 Forward -94 -78 12.4208 0.206
NP_441848.1_4 Reverse -131 -147 7.26419 0.292
NP_440653.1_10 Forward -92 -73 2.26107 0.289
NP_440696.1_3 Forward -238 -220 1.39578 0.217
NP_442039.1_7 Reverse -342 -352 15.0247 0.211
NP_442273.1_10 Forward -313 -295 3.85406 0.288
NP_442679.1_3 Reverse -132 -150 1.69077 0.253
NP_440825.1_6 Reverse -296 -315 7.7676 0.285
NP_442837.1_3 Reverse -230 -237 12.1338 0.0702
NP_442837.1_3 Forward -237 -230 6.0373 0.25
NP_442837.1_3 Forward -354 -347 4.16902 0.28
NP_442053.1_1 Reverse -229 -238 6.8829 0.111
NP_440505.1_3 Forward -240 -230 4.99491 0.252
NP_440505.1_3 Reverse -369 -379 4.50326 0.284
NP_440505.1_5 Forward -324 -310 20.1574 0.0394
NP_440505.1_7 Reverse -155 -174 0.982764 0.253
NP_441252.1_6 Reverse -281 -288 11.6422 0.288
NP_441203.1_1 Forward -233 -214 -17.2085 0.283
NP_440914.1_1 Forward -348 -338 7.5416 0.232
NP_441011.1_8 Forward -237 -228 8.55452 0.144
NP_441011.1_8 Reverse -230 -239 7.07956 0.179
NP_442533.1_1 Reverse -267 -286 -17.3068 0.285
NP_442533.1_6 Forward -238 -229 5.40793 0.14
NP_442533.1_6 Reverse -346 -355 5.3096 0.145
NP_442533.1_6 Forward -355 -346 4.71961 0.177
NP_442533.1_6 Reverse -218 -227 4.42462 0.179
NP_442533.1_6 Forward -380 -371 4.12963 0.191
NP_442533.1_6 Reverse -188 -197 3.7363 0.204
NP_442541.1_10 Reverse -194 -208 7.17714 0.245
NP_440263.1_5 Forward -395 -381 7.57108 0.294
NP_442232.1_3 Forward -118 -99 -15.8318 0.296
NP_441326.1_2 Forward -197 -178 8.75091 0.288
NP_439944.1_9 Reverse -189 -199 7.35486 0.144
NP_441028.1_6 Reverse -197 -207 5.19112 0.265
NP_442728.1_7 Forward -164 -150 13.5693 0.246
NP_441602.1_3 Reverse -189 -208 2.26107 0.199
NP_441602.1_4 Forward -249 -230 8.35759 0.293
NP_441972.1_5 Forward -202 -183 -3.44213 0.2
NP_441106.1_1 Forward -239 -230 8.45619 0.0548
NP_441106.1_1 Reverse -228 -237 7.66954 0.0776
NP_439903.1_6 Forward -358 -339 -0.886293 0.287
NP_442306.1_10 Forward -393 -374 -21.0434 0.242
NP_441286.1_1 Reverse -345 -357 -4.77924 0.175
NP_441286.1_1 Reverse -193 -205 -5.27089 0.194
NP_441479.1_1 Forward -334 -315 13.9625 0.127
NP_441930.1_2 Forward -204 -194 15.2213 0.19
NP_440886.1_7 Reverse -345 -355 6.37109 0.13
NP_441427.1_5 Forward -388 -369 7.7676 0.291
NP_440907.2_8 Reverse -256 -266 7.15773 0.127
NP_441021.1_1 Reverse -195 -214 -12.5869 0.291
NP_441463.1_3 Forward -248 -229 -3.24547 0.171
NP_441626.1_2 Forward -237 -230 6.13563 0.177
NP_441626.1_2 Reverse -230 -237 5.93897 0.231
NP_439958.1_5 Forward -311 -292 18.0924 0.172
NP_442615.1_1 Forward -364 -346 -5.19239 0.206
NP_441962.1_4 Forward -202 -183 -0.197208 0.117
NP_441962.1_4 Reverse -189 -208 -7.37537 0.188
NP_440387.1_1 Forward -355 -339 -4.85801 0.203
NP_441431.1_3 Reverse -365 -384 7.7676 0.236
NP_441993.1_1 Reverse -188 -207 13.5441 0.0842
NP_441993.1_1 Forward -203 -184 9.4509 0.136
NP_440114.1_10 Forward -264 -250 8.65272 0.198
NP_440114.1_10 Reverse -229 -243 5.89945 0.292
NP_440293.1_3 Forward -272 -253 -3.54046 0.247
NP_440766.1_4 Forward -242 -228 2.65453 0.176
NP_442103.1_2 Reverse -179 -197 14.6697 0.192
NP_442930.1_1 Forward -147 -137 10.796 0.275
NP_439910.1_2 Reverse -221 -238 -12.8425 0.103
NP_442867.1_8 Reverse -230 -249 6.29264 0.264
NP_440457.1_1 Reverse -367 -379 3.48056 0.195
NP_440457.1_1 Forward -238 -226 0.923956 0.25
NP_440457.1_1 Forward -242 -230 -0.256015 0.259
NP_440457.1_1 Forward -268 -256 -0.551008 0.268
NP_440457.1_1 Reverse -184 -196 -1.04266 0.289
NP_441984.1_1 Forward -188 -170 11.5239 0.196
NP_440554.1_4 Forward -237 -227 8.82982 0.0646
NP_440554.1_4 Reverse -230 -240 4.99491 0.167
NP_440554.1_4 Forward -196 -186 2.7333 0.254
NP_441885.1_5 Forward -355 -345 1.65166 0.106
NP_441885.1_5 Forward -238 -228 0.766681 0.123
NP_441885.1_5 Forward -283 -273 -0.806614 0.228
NP_442341.1_7 Reverse -345 -359 4.91614 0.175
NP_442341.1_7 Reverse -228 -242 1.96621 0.274
NP_441756.1_5 Reverse -184 -203 7.7676 0.152
NP_441756.1_5 Forward -189 -170 -1.27885 0.255
NP_441173.1_9 Reverse -314 -322 10.2454 0.261
NP_440423.1_6 Forward -246 -227 -3.3438 0.126
NP_443000.1_7 Reverse -227 -237 1.06167 0.274
NP_441842.1_10 Forward -245 -231 12.1926 0.107
NP_440091.1_1 Forward -242 -230 8.59377 0.0631
NP_440679.1_10 Reverse -231 -250 -16.2252 0.255
NP_442451.1_2 Reverse -167 -186 -5.01543 0.217
NP_442451.1_2 Reverse -186 -205 -7.17871 0.232
NP_440175.1_4 Forward -205 -186 -10.6203 0.177
NP_440149.1_8 Forward -203 -184 10.0292 0.0507
NP_440149.1_8 Reverse -371 -390 -4.91709 0.215
NP_442373.1_2 Forward -200 -181 -10.1286 0.272
NP_440216.1_1 Forward -238 -224 -4.13031 0.1
NP_440172.1_1 Forward -348 -338 7.74818 0.0738
NP_440172.1_1 Reverse -194 -204 1.74999 0.299
NP_442015.1_10 Reverse -184 -197 2.77255 0.187
NP_442015.1_10 Reverse -342 -355 -0.865694 0.285
NP_441226.1_7 Forward -379 -372 8.29857 0.205
NP_441111.1_7 Reverse -230 -238 8.86921 0.0589
NP_441111.1_7 Reverse -189 -197 -0.472234 0.131
NP_441111.1_7 Forward -354 -346 -0.570565 0.233
NP_441111.1_7 Reverse -347 -355 -0.570565 0.233
NP_441766.1_2 Forward -238 -229 8.1612 0.0645
NP_441766.1_2 Forward -355 -346 4.42462 0.181
NP_441766.1_2 Reverse -188 -197 3.24465 0.227
NP_442417.1_5 Reverse -92 -106 7.66941 0.18
NP_442417.1_5 Forward -197 -183 6.09611 0.237
NP_442252.1_3 Forward -245 -227 15.1621 0.0849
NP_440416.1_1 Forward -238 -219 -13.6686 0.281
NP_440416.1_9 Forward -245 -226 -17.1101 0.231
NP_443052.1_8 Reverse -245 -264 -3.83545 0.108
NP_443052.1_8 Forward -248 -229 -11.9969 0.244
NP_442403.1_8 Reverse -231 -250 -2.65548 0.278
NP_442154.1_1 Reverse -236 -254 -18.6637 0.284
NP_440261.1_5 Reverse -256 -269 -11.2888 0.255
NP_440988.1_10 Forward -199 -185 8.19046 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTTGGTTTAGCCGCAGATTTACCCATCCCCGGTGTGGTTATTTACGGTGGTCGCCAATGTCGTTTCATCGGTGAATGGTTGGCGGAACAACAACCCAAAAGCCTGGTTTACATTGCCGAAGATCCCCAACAATCGGGGGGATTGGTGCTTCATACCCAAAACGGCGATCGATGGGTCATGGTCACCTTTAAGGATGGGGAAATGGCCACCGCAGCGGGGGTGTTCAGTCAGCGACAACAAAAAGCCAAGGGTTTACATTTTCTCTGGCTCCAACCGGATAATTCGGGGGTGACTACCACGGGGGTCTGGTTATTGCAAAAGTAATAGAACATTAGCATTTCCATTTTCAATTAAGCTCAAAGAACCTAGAAACTAGACCATGAATTTCTGAGTTTGGGAC

CDS

ATGGTCGGGGCGATCGCCCGATGGGCATCCCTTAAGATTGTGATGAACCCTAGACAGTTGACAAAGACAATGAATATTCAGTTTCTCGGTAACATTACAACGGCCATACTGCTAGCAGTAGTGCTACAGATTACCCTTTGGCCCTCAGCGGCCCAGGCCTGCACCAGAATTTTGTGGAATAACAATAAATTAGCTGTGGTGGTCGGCCGAACAATGGACTGGCCGGAATCCACCGAGCCCGAGTTGATGGTTTTTCCCCAGGGCATCAAAAGAAATGGAGGCATGTTGGGGGACATGTTAGTGGTTAAAGACAACCCAGCCCAATGGACTTCCAAATATGGCAGTGTAGTCACCACGGTTTATGGCATGGGTACGGTGGACGGCTTGAATGAAAAAGGACTGGGCATGCATATGCTTTACTTAACAGCGACGGATTTTGGCCCCCGCAATCCCAAGAAAGCCGGGGTACAGGCGGGACTGTGGGGACAATATTTACTGGACAATGCCGCCACTGTGAAGGAAGCCCTTGCGTTGATGAATGAGATTCAGCCGGTAATGGTTGCCCTGGATGATATGAAGGCAACGGTGCATTTAGCCATTGAAGATGCCAGTGGAGATTCGGCCATTCTGGAATACGTGGAGGGTAAGCTGGTTGTCCACCACGGCCCAGAGTATCGGGTGATGACGAACGATCCCACCTACGATCAACAATTGAAATTCTTGGAAACTTGGGATTTTACCAATGCCACCCGCCAAACTCCCTTGCCTGGCAATGTGGATCCCAAAGATCGTTTTGTTCGGGCTAGCTATTACCAGATGATGTTGCCGGAACCGAAAACTGAACAGGAAGCCATTGCTGGTATTTTGGCGATCGCCCGCAATACTTCTGTTCCTTTTGGTGCCCCCAATAATATTCCTGGTTCTCTGTATAACACGGAATATCGCACCGCCATTGACCTAACGAATCGTCGTTACTTTTTTGAGTTAACCACTAGCCCCAATGTCATTTGGGTCAACCTTGATCAACTTAATCTTGCCCCTGGTGCACCAGTGTTAAGTCTTGATCCTGATAATTTGGATCTGTCGGGAAATGTTACCGATAAATTTACTAAAGTGCTAAAAAGTCCATTTTAG

Protein

MVGAIARWASLKIVMNPRQLTKTMNIQFLGNITTAILLAVVLQITLWPSAAQACTRILWNNNKLAVVVGRTMDWPESTEPELMVFPQGIKRNGGMLGDMLVVKDNPAQWTSKYGSVVTTVYGMGTVDGLNEKGLGMHMLYLTATDFGPRNPKKAGVQAGLWGQYLLDNAATVKEALALMNEIQPVMVALDDMKATVHLAIEDASGDSAILEYVEGKLVVHHGPEYRVMTNDPTYDQQLKFLETWDFTNATRQTPLPGNVDPKDRFVRASYYQMMLPEPKTEQEAIAGILAIARNTSVPFGAPNNIPGSLYNTEYRTAIDLTNRRYFFELTTSPNVIWVNLDQLNLAPGAPVLSLDPDNLDLSGNVTDKFTKVLKSPF