Your browser is old and dusty. Try Google Chrome!

Details for slr1761

ORF slr1761
Accession NP_440378.1
Symbol
Category Other
Definition FKBP-type peptidyl-prolyl cis-trans isomerase, periplasmic protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -271 -257 -2.45868 0.293
NP_440795.1_7 Forward -146 -139 14.6904 0.0123
NP_440795.1_7 Reverse -139 -146 14.6904 0.0123
NP_441418.1_6 Forward -147 -128 -11.2103 0.0462
NP_441418.1_6 Forward -272 -253 -28.3199 0.204
NP_442291.1_5 Forward -148 -132 -1.02311 0.192
NP_441453.1_4 Reverse -138 -146 16.539 0.00633
NP_441453.1_4 Forward -147 -139 16.539 0.00633
NP_441453.1_4 Forward -272 -264 5.23096 0.157
NP_441453.1_7 Reverse -24 -31 11.6422 0.298
NP_442151.1_6 Reverse -138 -152 8.65272 0.167
NP_441818.1_1 Forward -110 -99 10.9729 0.21
NP_440226.1_1 Reverse -138 -157 12.8808 0.0399
NP_440226.1_1 Forward -147 -128 7.86593 0.0975
NP_441630.1_3 Forward -221 -202 5.80098 0.136
NP_442623.1_3 Forward -271 -252 -10.9153 0.21
NP_441098.1_3 Reverse -366 -385 -5.2577 0.28
NP_442173.1_1 Forward -146 -138 15.4574 0.00633
NP_442173.1_1 Reverse -139 -147 15.4574 0.00633
NP_442173.1_1 Reverse -146 -154 4.73931 0.258
NP_442173.1_6 Forward -318 -304 14.0609 0.118
NP_442752.1_4 Forward -147 -140 13.8055 0.0199
NP_442752.1_4 Reverse -138 -145 13.8055 0.0199
NP_443027.1_4 Forward -149 -139 5.87989 0.294
NP_443027.1_4 Reverse -136 -146 5.87989 0.294
NP_442975.1_10 Forward -151 -137 11.602 0.0497
NP_442975.1_10 Reverse -134 -148 2.45727 0.274
NP_440784.1_7 Forward -146 -139 15.9687 0.0123
NP_440784.1_7 Reverse -139 -146 15.9687 0.0123
NP_440784.1_7 Forward -110 -103 6.43063 0.218
NP_440061.1_9 Reverse -202 -216 8.75042 0.164
NP_440061.1_9 Forward -274 -260 5.21053 0.293
NP_440110.1_8 Forward -215 -196 -3.14714 0.288
NP_442062.1_8 Forward -147 -137 19.4496 0.000558
NP_442062.1_8 Reverse -138 -148 19.4496 0.000558
NP_442826.1_5 Forward -107 -88 12.2908 0.136
NP_440761.1_4 Forward -44 -25 -20.65 0.289
NP_441900.1_2 Reverse -56 -74 -3.91481 0.288
NP_441859.1_3 Reverse -76 -95 2.55527 0.258
NP_440304.1_4 Forward -340 -330 3.91327 0.289
NP_440304.1_4 Forward -149 -139 1.84832 0.299
NP_440304.1_4 Reverse -136 -146 1.84832 0.299
NP_442242.1_4 Forward -146 -139 14.3954 0.0124
NP_442242.1_4 Reverse -139 -146 14.3954 0.0124
NP_440044.1_8 Forward -146 -127 3.44104 0.13
NP_440044.1_8 Reverse -139 -158 -2.95047 0.274
NP_441035.1_3 Reverse -326 -345 15.1424 0.101
NP_440916.1_1 Reverse -246 -260 12.1926 0.206
NP_441200.1_4 Forward -94 -75 12.0942 0.172
NP_440370.1_10 Reverse -129 -148 14.3558 0.103
NP_441109.1_5 Reverse -259 -278 18.3873 0.181
NP_441925.1_4 Forward -115 -96 -16.5208 0.284
NP_441925.1_4 Reverse -56 -75 -17.0125 0.287
NP_440856.1_7 Forward -356 -337 4.03102 0.153
NP_441083.1_5 Forward -147 -137 11.3864 0.0159
NP_441083.1_5 Reverse -138 -148 11.3864 0.0159
NP_441083.1_5 Forward -183 -173 4.10993 0.158
NP_441083.1_5 Forward -272 -262 -0.314959 0.265
NP_442827.1_8 Reverse -196 -215 -0.00131823 0.217
NP_441434.1_7 Forward -145 -131 5.99778 0.225
NP_441434.1_7 Reverse -140 -154 1.86788 0.29
NP_441738.1_2 Forward -145 -138 15.28 0.0102
NP_441738.1_2 Reverse -140 -147 15.28 0.0102
NP_441738.1_2 Forward -102 -95 6.72528 0.236
NP_441558.1_5 Forward -149 -130 5.99764 0.232
NP_440209.1_1 Reverse -138 -146 18.1123 0.00295
NP_440209.1_1 Forward -147 -139 18.1123 0.00295
NP_442889.1_8 Forward -150 -136 12.5853 0.0611
NP_442889.1_8 Forward -216 -202 7.17714 0.16
NP_442889.1_8 Reverse -135 -149 3.63724 0.273
NP_441713.1_8 Reverse -296 -314 8.27895 0.293
NP_440178.1_7 Reverse -137 -156 -12.3902 0.121
NP_440178.1_7 Reverse -305 -324 -14.2585 0.152
NP_441716.1_1 Forward -147 -133 7.07942 0.181
NP_442111.1_4 Forward -148 -134 6.48943 0.123
NP_441163.1_1 Reverse -130 -147 6.92128 0.254
NP_440343.1_1 Forward -261 -242 11.2092 0.218
NP_440906.1_5 Forward -146 -139 15.8704 0.0124
NP_440906.1_5 Reverse -139 -146 15.8704 0.0124
NP_440747.1_10 Reverse -135 -147 5.44718 0.0137
NP_440747.1_10 Forward -150 -138 5.44718 0.0137
NP_440747.1_10 Reverse -260 -272 -11.6624 0.131
NP_440747.1_10 Reverse -297 -309 -12.2524 0.254
NP_441486.1_1 Forward -150 -136 21.6324 0.00233
NP_441486.1_1 Reverse -135 -149 21.5341 0.00239
NP_440842.1_10 Forward -42 -28 4.03116 0.254
NP_441695.1_4 Forward -109 -91 10.8356 0.257
NP_441014.1_8 Forward -160 -141 1.96607 0.214
NP_441014.1_8 Forward -226 -207 -8.06369 0.282
NP_442848.1_1 Reverse -132 -146 -2.45868 0.263
NP_443018.1_3 Forward -146 -139 14.8871 0.0123
NP_443018.1_3 Reverse -139 -146 14.8871 0.0123
NP_441634.1_8 Reverse -202 -216 -0.0987402 0.247
NP_441634.1_8 Forward -149 -135 -3.63866 0.295
NP_441634.1_8 Reverse -136 -150 -4.32697 0.295
NP_440376.1_1 Forward -147 -138 19.4693 0.000692
NP_440376.1_1 Reverse -138 -147 19.4693 0.000692
NP_440376.1_1 Reverse -204 -213 3.83464 0.19
NP_441857.1_6 Forward -280 -270 15.9097 0.199
NP_441588.1_4 Reverse -140 -150 16.4996 0.0369
NP_441588.1_4 Forward -145 -135 7.25653 0.178
NP_442687.1_7 Forward -148 -138 15.8113 0.0125
NP_442687.1_7 Reverse -137 -147 15.8113 0.0125
NP_442687.1_7 Forward -24 -14 12.3697 0.0768
NP_442687.1_7 Reverse -173 -183 7.84651 0.123
NP_442687.1_7 Reverse -158 -168 5.5849 0.194
NP_442191.1_4 Reverse -207 -221 12.1566 0.225
NP_440066.1_5 Reverse -254 -273 9.93006 0.251
NP_441846.1_10 Forward -351 -332 -16.4218 0.256
NP_441846.1_10 Forward -78 -59 -20.4534 0.256
NP_442530.1_1 Reverse -114 -133 15.5357 0.0487
NP_441422.1_7 Forward -149 -132 -5.36936 0.247
NP_442296.1_5 Reverse -256 -275 4.03102 0.251
NP_440360.1_10 Reverse -56 -70 12.586 0.133
NP_442658.1_1 Reverse -136 -146 15.9091 0.00966
NP_442658.1_1 Forward -149 -139 15.9091 0.00966
NP_442782.1_2 Reverse -96 -110 3.14618 0.267
NP_442782.1_2 Forward -79 -65 1.17956 0.282
NP_442782.1_2 Forward -315 -301 0.687908 0.286
NP_442782.1_2 Forward -122 -108 0.294584 0.291
NP_442205.1_9 Forward -65 -49 3.20513 0.195
NP_440656.1_8 Forward -158 -139 -7.76869 0.264
NP_441414.1_9 Reverse -138 -157 2.94938 0.0612
NP_441414.1_9 Forward -86 -67 -4.91709 0.164
NP_441414.1_9 Forward -147 -128 -5.11376 0.169
NP_441487.1_9 Reverse -137 -156 2.75272 0.175
NP_442937.1_5 Forward -74 -55 6.98095 0.265
NP_442321.1_1 Forward -41 -22 9.73422 0.0887
NP_441958.1_2 Reverse -129 -148 13.5691 0.203
NP_441958.1_5 Forward -148 -138 12.2714 0.00183
NP_441958.1_5 Reverse -137 -147 12.2714 0.00183
NP_441958.1_5 Forward -273 -263 -0.118297 0.182
NP_442836.1_5 Forward -72 -53 1.76941 0.273
NP_442836.1_10 Forward -280 -270 9.32148 0.277
NP_440203.1_5 Forward -210 -200 11.4843 0.19
NP_440984.1_7 Forward -152 -138 15.3392 0.0563
NP_440984.1_7 Forward -277 -263 7.27608 0.178
NP_442376.1_2 Forward -273 -254 -6.39206 0.286
NP_442911.1_2 Forward -157 -138 -1.7705 0.0897
NP_442911.1_2 Forward -193 -174 -7.57203 0.214
NP_442911.1_2 Reverse -128 -147 -10.6203 0.284
NP_440153.1_5 Forward -146 -132 4.32615 0.199
NP_440153.1_8 Reverse -329 -342 12.3107 0.16
NP_440153.1_8 Reverse -306 -319 -2.83231 0.266
NP_440153.1_8 Reverse -54 -67 -3.61896 0.296
NP_441591.1_10 Forward -149 -130 8.35759 0.242
NP_443055.1_6 Forward -155 -137 2.18168 0.218
NP_443055.1_6 Forward -200 -182 0.116744 0.249
NP_443055.1_6 Reverse -204 -222 -1.6532 0.281
NP_440138.1_1 Forward -105 -87 8.96649 0.197
NP_440615.1_8 Reverse -44 -63 18.0924 0.106
NP_442002.1_9 Forward -148 -141 10.7572 0.185
NP_442002.1_9 Reverse -137 -144 10.7572 0.185
NP_440809.1_9 Reverse -129 -147 -6.37237 0.225
NP_441294.1_7 Reverse -134 -148 12.9942 0.0767
NP_441294.1_7 Forward -151 -137 10.9784 0.161
NP_441294.1_7 Forward -217 -203 10.4985 0.185
NP_441646.1_1 Forward -118 -99 -0.000545616 0.257
NP_442438.1_10 Reverse -133 -147 5.1128 0.139
NP_442438.1_10 Forward -152 -138 1.96621 0.188
NP_442438.1_10 Forward -188 -174 0.982901 0.21
NP_442885.1_5 Forward -145 -126 14.0599 0.276
NP_441000.1_6 Reverse -137 -151 13.3726 0.0396
NP_441000.1_6 Forward -148 -134 12.9793 0.0396
NP_441000.1_6 Reverse -76 -90 -0.688726 0.208
NP_440147.1_4 Forward -149 -136 11.4257 0.0326
NP_440147.1_4 Reverse -136 -149 11.4257 0.0326
NP_440147.1_4 Reverse -172 -185 3.26421 0.191
NP_440147.1_4 Forward -274 -261 1.19926 0.235
NP_441550.1_8 Forward -274 -264 12.2709 0.0349
NP_441550.1_8 Reverse -136 -146 8.3377 0.124
NP_441550.1_8 Forward -149 -139 8.3377 0.124
NP_441916.1_7 Forward -147 -137 18.4663 0.00144
NP_441916.1_7 Reverse -138 -148 18.4663 0.00144
NP_441916.1_7 Forward -338 -328 2.43831 0.254
NP_441916.1_7 Reverse -204 -214 1.16001 0.293
NP_441041.1_4 Forward -321 -302 -4.42544 0.136
NP_441041.1_4 Forward -147 -128 -5.70374 0.157
NP_441041.1_4 Reverse -138 -157 -10.7186 0.236
NP_441041.1_7 Forward -150 -138 18.9817 0.00435
NP_441041.1_7 Reverse -135 -147 9.65268 0.108
NP_442396.1_5 Reverse -134 -147 8.47575 0.153
NP_440569.1_5 Reverse -84 -103 20.059 0.0567
NP_441725.1_5 Forward -146 -136 2.04498 0.115
NP_441725.1_5 Reverse -139 -149 2.04498 0.115
NP_439966.1_7 Reverse -136 -146 9.91099 0.0968
NP_439966.1_7 Forward -149 -139 9.91099 0.0968
NP_439966.1_9 Forward -149 -140 0.884706 0.253
NP_439966.1_9 Reverse -136 -145 0.884706 0.253
NP_442941.1_3 Forward -146 -136 2.63497 0.14
NP_442941.1_3 Reverse -139 -149 2.63497 0.14
NP_440289.1_2 Forward -150 -137 5.91914 0.0605
NP_440289.1_2 Reverse -135 -148 -3.52063 0.267
NP_440983.1_5 Forward -167 -148 -6.88371 0.28
NP_440260.1_8 Reverse -93 -111 -5.48739 0.275
NP_442281.1_1 Forward -152 -138 20.7467 0.00192
NP_442281.1_1 Forward -218 -204 8.3571 0.0823
NP_442575.1_8 Forward -75 -56 1.67108 0.196
NP_440437.1_1 Reverse -198 -217 -5.40875 0.282
NP_440647.1_10 Forward -251 -232 9.83255 0.296
NP_441087.1_6 Reverse -61 -79 -4.01314 0.296
NP_441556.1_4 Forward -350 -331 19.2602 0.0935
NP_440498.1_1 Forward -156 -138 4.83737 0.114
NP_440498.1_1 Reverse -129 -147 -3.42244 0.261
NP_442982.1_5 Reverse -194 -213 -2.36049 0.286
NP_440375.1_8 Reverse -139 -158 1.0811 0.252
NP_442068.1_1 Forward -35 -16 4.22769 0.27
NP_441644.1_6 Forward -147 -137 10.1076 0.0628
NP_441644.1_6 Reverse -138 -148 10.1076 0.0628
NP_442215.1_2 Reverse -136 -152 10.0883 0.0514
NP_442215.1_2 Forward -149 -133 -2.20308 0.193
NP_442215.1_2 Forward -185 -169 -2.39974 0.197
NP_442029.1_1 Reverse -126 -145 -12.2919 0.247
NP_442029.1_6 Forward -95 -76 11.4058 0.16
NP_442029.1_6 Forward -278 -259 6.98095 0.231
NP_440253.1_2 Reverse -138 -156 3.65739 0.114
NP_440929.1_8 Forward -147 -138 19.2726 0.000701
NP_440929.1_8 Reverse -138 -147 19.2726 0.000701
NP_440929.1_8 Forward -272 -263 5.80125 0.117
NP_442933.1_6 Reverse -36 -55 13.8937 0.287
NP_442933.1_10 Forward -147 -138 17.601 0.00325
NP_442933.1_10 Reverse -138 -147 17.601 0.00325
NP_442933.1_10 Forward -272 -263 6.19458 0.131
NP_441751.2_8 Forward -110 -96 -5.50694 0.214
NP_442554.1_8 Forward -146 -136 13.2547 0.0187
NP_442554.1_8 Reverse -139 -149 13.2547 0.0187
NP_442554.1_8 Reverse -264 -274 2.43831 0.272
NP_441762.1_7 Forward -148 -136 19.3118 0.00342
NP_441762.1_7 Reverse -137 -149 19.3118 0.00342
NP_441762.1_7 Forward -87 -75 -6.2542 0.284
NP_442142.1_4 Forward -150 -137 15.1616 0.0289
NP_442142.1_4 Reverse -135 -148 7.2952 0.143
NP_442292.1_1 Forward -146 -137 9.63616 0.0183
NP_442292.1_1 Reverse -139 -148 9.63616 0.0183
NP_442476.1_6 Forward -146 -132 2.35953 0.186
NP_443009.1_5 Reverse -137 -148 11.6612 0.0602
NP_443009.1_5 Forward -148 -137 11.6612 0.0602
NP_443009.1_5 Reverse -173 -184 6.64635 0.154
NP_442301.1_2 Reverse -53 -72 4.03023 0.284
NP_441715.1_4 Reverse -139 -149 9.41981 0.097
NP_441715.1_4 Forward -146 -136 9.41981 0.097
NP_441715.1_4 Forward -182 -172 5.97822 0.165
NP_440881.1_10 Forward -271 -258 12.2123 0.249
NP_440183.1_9 Forward -103 -84 -13.1769 0.26
NP_440183.1_9 Reverse -184 -203 -14.9469 0.273
NP_441198.1_8 Reverse -157 -167 10.1462 0.296
NP_440379.1_5 Forward -42 -23 -10.4236 0.28
NP_441468.1_1 Forward -146 -139 15.8704 0.0124
NP_441468.1_1 Reverse -139 -146 15.8704 0.0124
NP_441020.2_6 Reverse -136 -153 14.4935 0.0528
NP_441015.1_10 Reverse -129 -148 -9.93197 0.282
NP_441015.1_10 Forward -74 -55 -11.2103 0.292
NP_441673.1_1 Forward -147 -138 20.8459 0.000698
NP_441673.1_1 Reverse -138 -147 20.8459 0.000698
NP_441673.1_1 Reverse -263 -272 -8.06341 0.254
NP_441731.1_3 Forward -131 -112 4.71934 0.159
NP_441731.1_7 Reverse -249 -268 7.86593 0.203
NP_441731.1_7 Forward -103 -84 1.37609 0.298
NP_441826.1_2 Reverse -132 -146 -0.197071 0.204
NP_441826.1_2 Forward -153 -139 -4.22864 0.293
NP_441637.1_9 Forward -250 -232 6.50899 0.245
NP_442868.1_6 Forward -149 -139 0.865012 0.205
NP_442868.1_6 Reverse -136 -146 0.865012 0.205
NP_442227.1_2 Reverse -331 -350 0.982764 0.252
NP_442227.1_2 Reverse -328 -347 -1.37718 0.262
NP_442361.1_3 Forward -153 -140 8.37742 0.285
NP_442808.1_1 Forward -148 -138 18.4657 0.00201
NP_442808.1_1 Reverse -137 -147 18.4657 0.00201
NP_442808.1_1 Reverse -269 -279 3.42118 0.24
NP_441101.1_10 Reverse -340 -359 -5.80207 0.285
NP_441290.1_3 Forward -79 -60 14.2574 0.265
NP_442542.1_9 Forward -154 -140 4.42388 0.297
NP_442113.1_10 Reverse -325 -344 1.47442 0.192
NP_441114.1_3 Reverse -115 -124 15.831 0.193
NP_441518.1_3 Forward -157 -138 -3.83545 0.114
NP_441878.1_6 Forward -148 -138 10.4031 0.0176
NP_441878.1_6 Reverse -137 -147 10.4031 0.0176
NP_441878.1_6 Forward -273 -263 -0.118297 0.167
NP_441878.1_6 Forward -214 -204 -0.314959 0.174
NP_441878.1_6 Reverse -29 -39 -7.68978 0.255
NP_441878.1_6 Forward -339 -329 -7.88644 0.278
NP_441036.1_8 Forward -148 -138 17.7779 0.000554
NP_441036.1_8 Reverse -137 -147 17.7779 0.000554
NP_441036.1_8 Forward -343 -333 10.6981 0.158
NP_441557.1_5 Forward -147 -138 19.9609 0.000699
NP_441557.1_5 Reverse -138 -147 19.9609 0.000699
NP_441557.1_5 Forward -272 -263 -0.68859 0.229
NP_441445.1_1 Reverse -129 -148 17.3057 0.0326
NP_441445.1_1 Forward -156 -137 1.0811 0.262
NP_441445.1_1 Reverse -320 -339 0.491109 0.275
NP_441590.1_4 Reverse -290 -309 1.6703 0.299
NP_440101.1_3 Reverse -220 -239 5.30933 0.2
NP_440101.1_3 Reverse -186 -205 0.58944 0.297
NP_442183.1_1 Reverse -263 -277 4.62115 0.254
NP_442397.1_9 Reverse -263 -282 1.17943 0.291
NP_441459.1_6 Reverse -56 -74 9.55725 0.259
NP_442135.1_9 Reverse -66 -85 12.3883 0.264
NP_441574.1_1 Forward -315 -296 -1.27885 0.216
NP_442347.1_2 Forward -146 -137 11.1111 0.056
NP_442347.1_2 Reverse -139 -148 11.1111 0.056
NP_442645.1_2 Reverse -130 -149 -2.65548 0.0487
NP_442645.1_2 Forward -155 -136 -12.2919 0.144
NP_442645.1_2 Forward -215 -196 -21.535 0.29
NP_441037.1_4 Reverse -136 -146 14.7245 0.028
NP_441037.1_4 Forward -149 -139 14.7245 0.028
NP_441037.1_4 Forward -340 -330 6.14821 0.278
NP_442594.1_8 Forward -80 -61 6.4893 0.231
NP_441633.1_3 Forward -149 -136 10.8357 0.0286
NP_441633.1_3 Reverse -136 -149 10.8357 0.0286
NP_441633.1_3 Reverse -172 -185 0.707601 0.117
NP_442764.1_6 Reverse -140 -158 3.06741 0.234
NP_440136.1_2 Forward -146 -139 15.9687 0.0123
NP_440136.1_2 Reverse -139 -146 15.9687 0.0123
NP_442590.1_9 Reverse -328 -347 6.29264 0.261
NP_442998.1_5 Forward -257 -247 11.1898 0.191
NP_442998.1_10 Forward -145 -138 15.5754 0.0102
NP_442998.1_10 Reverse -140 -147 15.5754 0.0102
NP_440899.1_5 Forward -223 -204 3.14605 0.267
NP_440299.1_1 Reverse -134 -147 14.08 0.0259
NP_440299.1_1 Reverse -26 -39 5.91857 0.158
NP_440299.1_1 Forward -151 -138 2.28034 0.292
NP_441799.1_1 Reverse -134 -148 19.8618 0.00596
NP_441799.1_1 Forward -151 -137 14.8469 0.0221
NP_441799.1_1 Reverse -73 -87 3.93223 0.274
NP_440640.1_6 Forward -78 -59 0.392778 0.274
NP_442201.1_10 Forward -158 -139 -6.68705 0.184
NP_442333.2_5 Reverse -290 -309 -15.1435 0.289
NP_440256.1_1 Forward -150 -131 1.57275 0.0733
NP_440256.1_1 Reverse -135 -154 -2.95047 0.125
NP_441512.1_4 Reverse -134 -153 15.8307 0.125
NP_441559.1_8 Reverse -133 -147 9.63603 0.0625
NP_440915.1_6 Reverse -259 -273 9.83269 0.0383
NP_440915.1_6 Forward -151 -137 -3.24533 0.292
NP_440717.1_1 Reverse -139 -158 6.39097 0.265
NP_441464.1_8 Forward -147 -133 5.50613 0.253
NP_442150.1_2 Forward -257 -238 15.1839 0.298
NP_442993.1_1 Forward -338 -322 -0.236458 0.071
NP_442993.1_1 Reverse -138 -154 -7.61128 0.146
NP_442993.1_1 Forward -315 -299 -12.7245 0.278
NP_442386.1_9 Reverse -137 -146 15.7322 0.0144
NP_442386.1_9 Forward -148 -139 15.7322 0.0144
NP_441750.1_4 Reverse -200 -219 1.27776 0.286
NP_441340.1_5 Forward -146 -139 15.6737 0.0124
NP_441340.1_5 Reverse -139 -146 15.6737 0.0124
NP_441340.1_5 Reverse -264 -271 4.07068 0.239
NP_440622.1_7 Forward -134 -115 15.7324 0.265
NP_442791.1_5 Reverse -130 -149 -0.000545616 0.21
NP_442791.1_9 Reverse -58 -77 19.0748 0.105
NP_442714.1_7 Forward -146 -127 3.34271 0.204
NP_440586.1_1 Forward -276 -257 1.76941 0.231
NP_440586.1_8 Forward -146 -139 13.2151 0.026
NP_440586.1_8 Reverse -139 -146 13.2151 0.026
NP_442251.1_6 Forward -146 -139 15.2804 0.0124
NP_442251.1_6 Reverse -139 -146 15.2804 0.0124
NP_442251.1_6 Forward -182 -175 8.10225 0.245
NP_442251.1_6 Reverse -15 -22 7.11894 0.274
NP_440684.1_9 Forward -278 -264 16.0275 0.0818
NP_441262.1_3 Reverse -138 -145 14.7888 0.0223
NP_441262.1_3 Forward -147 -140 14.7888 0.0223
NP_440027.1_3 Forward -105 -87 8.08151 0.196
NP_440027.1_3 Forward -147 -129 4.04996 0.262
NP_440027.1_3 Reverse -128 -146 3.55831 0.27
NP_443051.1_1 Reverse -137 -146 10.4228 0.00754
NP_443051.1_1 Forward -148 -139 10.4228 0.00754
NP_439984.1_2 Reverse -139 -152 12.409 0.252
NP_439937.1_9 Forward -148 -131 1.11978 0.0948
NP_439937.1_9 Forward -106 -89 -11.4665 0.256
NP_439937.1_9 Reverse -65 -82 -13.5315 0.287
NP_440408.1_3 Forward -359 -340 -2.45882 0.253
NP_440439.1_1 Reverse -135 -148 10.8357 0.0339
NP_440439.1_1 Forward -150 -137 1.39592 0.156
NP_440439.1_1 Reverse -92 -105 -0.177378 0.209
NP_440439.1_1 Forward -345 -332 -0.472371 0.221
NP_440439.1_1 Reverse -260 -273 -2.144 0.298
NP_440372.1_2 Forward -146 -139 16.3621 0.0124
NP_440372.1_2 Reverse -139 -146 16.3621 0.0124
NP_440372.1_2 Reverse -264 -271 4.36568 0.205
NP_440171.1_3 Reverse -92 -111 2.55606 0.285
NP_442783.1_2 Reverse -213 -232 11.8975 0.196
NP_441181.1_6 Reverse -192 -210 6.50899 0.219
NP_440378.1_6 Forward -94 -75 15.9291 0.216
NP_441803.1_2 Forward -152 -133 0.982764 0.242
NP_441572.1_7 Forward -153 -134 -0.197208 0.179
NP_440267.1_2 Forward -218 -204 5.01387 0.285
NP_442384.1_10 Forward -147 -134 16.3422 0.00854
NP_442384.1_10 Forward -39 -26 3.85419 0.176
NP_442262.1_10 Forward -146 -139 14.1988 0.0123
NP_442262.1_10 Reverse -139 -146 14.1988 0.0123
NP_440344.1_10 Forward -154 -137 8.10198 0.0114
NP_440344.1_10 Reverse -131 -148 -2.22277 0.0627
NP_440344.1_10 Forward -220 -203 -13.6292 0.29
NP_440282.1_10 Reverse -296 -315 1.67108 0.172
NP_440531.1_6 Reverse -130 -149 3.14605 0.148
NP_440531.1_6 Forward -155 -136 -4.72043 0.286
NP_440531.1_8 Forward -80 -61 3.53937 0.269
NP_442910.1_1 Reverse -256 -275 -0.983855 0.231
NP_440297.1_9 Forward -38 -28 3.91327 0.253
NP_440297.1_9 Forward -146 -136 -0.118297 0.282
NP_440297.1_9 Reverse -139 -149 -0.118297 0.282
NP_440298.1_2 Forward -356 -337 5.01433 0.282
NP_441896.1_3 Reverse -129 -148 0.786102 0.224
NP_440999.1_5 Forward -118 -99 6.09517 0.291
NP_440999.1_9 Reverse -325 -339 1.76955 0.158
NP_440999.1_9 Reverse -56 -70 0.392915 0.187
NP_440999.1_9 Forward -105 -91 -1.37704 0.236
NP_440999.1_9 Reverse -76 -90 -2.55701 0.27
NP_440888.1_2 Reverse -138 -152 9.43874 0.127
NP_440888.1_2 Forward -147 -133 9.34041 0.13
NP_440888.1_2 Forward -213 -199 8.55376 0.156
NP_440888.1_2 Reverse -306 -320 5.89884 0.258
NP_440179.1_6 Forward -146 -127 4.62101 0.246
NP_442147.1_7 Reverse -129 -148 10.0292 0.251
NP_440491.1_1 Forward -356 -337 8.7687 0.228
NP_439969.1_1 Forward -354 -335 -6.68705 0.288
NP_441543.1_2 Forward -146 -137 18.486 0.00236
NP_441543.1_2 Reverse -139 -148 18.486 0.00236
NP_442845.1_2 Reverse -96 -110 5.89945 0.22
NP_440380.1_1 Forward -75 -56 -11.3086 0.29
NP_441469.1_8 Reverse -137 -146 16.126 0.00797
NP_441469.1_8 Forward -148 -139 16.126 0.00797
NP_442315.1_1 Reverse -127 -145 7.39397 0.251
NP_442578.1_7 Forward -146 -139 14.5921 0.026
NP_442578.1_7 Reverse -139 -146 14.5921 0.026
NP_440071.1_6 Forward -69 -55 17.0045 0.208
NP_442286.1_1 Reverse -60 -79 10.5209 0.214
NP_441462.1_2 Forward -147 -137 11.5831 0.00406
NP_441462.1_2 Reverse -138 -148 11.5831 0.00406
NP_441462.1_2 Reverse -263 -273 -0.41329 0.225
NP_441621.1_7 Forward -149 -135 -3.73699 0.193
NP_441621.1_7 Reverse -136 -150 -3.73699 0.193
NP_443062.1_1 Reverse -138 -156 18.3942 0.0224
NP_443062.1_6 Reverse -130 -149 13.4708 0.0914
NP_441601.1_4 Forward -106 -87 -5.99873 0.295
NP_442537.1_3 Forward -356 -337 13.2741 0.239
NP_442537.1_3 Reverse -338 -357 11.5042 0.28
NP_440516.1_2 Reverse -132 -150 6.41066 0.122
NP_440516.1_2 Forward -153 -135 -1.84914 0.292
NP_440516.1_8 Forward -147 -138 16.9127 0.00442
NP_440516.1_8 Reverse -138 -147 16.9127 0.00442
NP_441033.1_2 Forward -157 -138 8.45592 0.0464
NP_442428.1_4 Reverse -16 -35 1.67108 0.287
NP_442428.1_5 Forward -146 -139 15.8704 0.0124
NP_442428.1_5 Reverse -139 -146 15.8704 0.0124
NP_441790.1_3 Reverse -139 -158 -4.91709 0.291
NP_442120.1_10 Forward -315 -296 -15.5368 0.294
NP_440673.1_2 Reverse -128 -147 13.4137 0.117
NP_440673.1_3 Forward -145 -138 12.4288 0.0426
NP_440673.1_3 Reverse -140 -147 12.4288 0.0426
NP_440673.1_3 Reverse -331 -338 6.62729 0.281
NP_441052.1_2 Forward -213 -203 11.6814 0.0285
NP_441052.1_2 Forward -147 -137 10.5014 0.0285
NP_441052.1_2 Reverse -138 -148 10.5014 0.0285
NP_440992.1_1 Forward -197 -178 19.469 0.122
NP_442219.1_9 Forward -146 -137 8.35786 0.0681
NP_442219.1_9 Reverse -139 -148 8.35786 0.0681
NP_440436.1_4 Forward -146 -137 18.1905 0.00233
NP_440436.1_4 Reverse -139 -148 18.1905 0.00233
NP_441884.1_8 Forward -273 -254 -5.80207 0.196
NP_441884.1_8 Forward -148 -129 -10.7186 0.268
NP_441884.1_8 Reverse -137 -156 -11.0136 0.268
NP_441884.1_9 Forward -275 -256 -12.9802 0.138
NP_441884.1_9 Forward -216 -197 -13.2752 0.138
NP_441884.1_9 Forward -150 -131 -22.0267 0.275
NP_441884.1_9 Reverse -326 -345 -22.125 0.275
NP_441884.1_9 Reverse -171 -190 -22.9117 0.284
NP_440314.1_9 Forward -112 -93 -8.752 0.253
NP_440314.1_9 Reverse -264 -283 -10.0303 0.282
NP_442907.1_9 Forward -110 -91 -7.08038 0.293
NP_441719.1_4 Forward -146 -139 16.3621 0.0124
NP_441719.1_4 Reverse -139 -146 16.3621 0.0124
NP_441733.1_10 Forward -150 -137 10.1474 0.106
NP_441004.1_1 Forward -272 -253 -11.3086 0.237
NP_441004.1_1 Forward -84 -65 -11.4069 0.238
NP_442366.1_3 Reverse -137 -155 13.9821 0.0236
NP_442366.1_5 Reverse -135 -145 15.2208 0.0375
NP_442366.1_5 Forward -150 -140 12.7626 0.108
NP_442139.1_7 Forward -74 -55 9.73422 0.24
NP_441115.1_4 Forward -148 -130 7.88485 0.269
NP_442206.1_10 Forward -272 -257 9.71466 0.154
NP_440328.1_4 Reverse -327 -346 3.14605 0.186
NP_440328.1_4 Forward -153 -134 2.85105 0.191
NP_443054.1_2 Reverse -136 -150 11.5043 0.0761
NP_443054.1_2 Reverse -202 -216 7.9644 0.134
NP_443054.1_2 Forward -149 -135 1.96621 0.245
NP_443054.1_2 Forward -156 -142 0.491246 0.262
NP_441851.1_10 Forward -148 -138 16.008 0.00552
NP_441851.1_10 Reverse -137 -147 16.008 0.00552
NP_442622.1_1 Reverse -76 -95 -3.44213 0.177
NP_442622.1_1 Forward -273 -254 -12.2919 0.262
NP_442856.1_7 Reverse -335 -354 -5.21209 0.275
NP_441668.1_4 Forward -282 -263 -2.65548 0.293
NP_441396.1_5 Forward -71 -62 18.0926 0.141
NP_440165.1_5 Forward -273 -254 -7.17871 0.259
NP_440940.1_7 Forward -348 -330 2.77167 0.295
NP_441349.1_10 Reverse -92 -111 -5.11376 0.192
NP_441349.1_10 Forward -157 -138 -9.14533 0.284
NP_441349.1_10 Reverse -128 -147 -9.24366 0.287
NP_440432.1_9 Reverse -139 -154 -0.118434 0.164
NP_442843.1_1 Reverse -87 -106 -3.24547 0.222
NP_442843.1_1 Forward -84 -65 -5.11376 0.241
NP_442843.1_1 Forward -94 -75 -9.44032 0.266
NP_440474.1_8 Reverse -139 -153 8.16044 0.189
NP_440474.1_8 Forward -337 -323 6.48882 0.226
NP_440474.1_8 Reverse -327 -341 3.93223 0.296
NP_442450.1_5 Reverse -136 -146 7.55152 0.13
NP_442450.1_5 Forward -149 -139 7.55152 0.13
NP_442006.1_2 Forward -95 -78 -15.5958 0.228
NP_442006.1_2 Forward -156 -139 -16.8741 0.265
NP_442006.1_2 Reverse -119 -136 -17.0707 0.269
NP_442006.1_2 Forward -192 -175 -18.0541 0.287
NP_442006.1_2 Forward -347 -330 -18.3491 0.29
NP_442006.1_2 Forward -32 -15 -18.939 0.296
NP_441003.1_9 Reverse -77 -96 3.04771 0.3
NP_441570.1_1 Forward -147 -129 -5.88071 0.0761
NP_441570.1_1 Forward -272 -254 -8.14232 0.104
NP_441570.1_1 Reverse -138 -156 -10.1089 0.16
NP_441078.1_4 Forward -147 -138 19.6659 0.0007
NP_441078.1_4 Reverse -138 -147 19.6659 0.0007
NP_441078.1_4 Forward -213 -204 -1.96689 0.282
NP_441094.1_7 Forward -97 -78 18.1889 0.126
NP_440526.1_3 Reverse -139 -150 2.02482 0.267
NP_441432.1_8 Reverse -137 -146 8.25953 0.0755
NP_441432.1_8 Forward -148 -139 8.25953 0.0755
NP_441432.1_8 Forward -316 -307 3.34298 0.248
NP_442320.1_8 Forward -153 -139 5.21113 0.0401
NP_442344.1_7 Reverse -139 -158 19.764 0.0121
NP_441732.1_2 Forward -151 -135 -16.1661 0.165
NP_441732.1_2 Forward -219 -203 -16.6577 0.186
NP_441732.1_2 Reverse -302 -318 -17.0511 0.231
NP_441732.1_2 Reverse -134 -150 -17.2477 0.247
NP_440759.1_10 Forward -88 -69 3.83436 0.253
NP_440760.1_1 Reverse -138 -157 -18.7818 0.217
NP_442353.1_4 Forward -153 -134 2.45694 0.229
NP_441072.1_2 Reverse -127 -146 7.37428 0.257
NP_440713.1_4 Reverse -253 -272 8.25926 0.17
NP_440713.1_4 Reverse -128 -147 7.37428 0.182
NP_442489.1_7 Forward -147 -138 20.1576 0.000695
NP_442489.1_7 Reverse -138 -147 20.1576 0.000695
NP_442489.1_7 Reverse -204 -213 5.3096 0.0708
NP_442489.1_7 Forward -183 -174 -1.86856 0.259
NP_442079.1_7 Forward -146 -127 1.17943 0.26
NP_440559.1_1 Reverse -139 -148 8.75118 0.0586
NP_440559.1_1 Forward -146 -137 8.75118 0.0586
NP_440559.1_1 Reverse -264 -273 5.11294 0.151
NP_441659.2_8 Forward -147 -137 11.9764 0.0147
NP_441659.2_8 Reverse -138 -148 11.9764 0.0147
NP_442913.1_10 Forward -156 -137 9.14423 0.0462
NP_442776.1_1 Forward -38 -19 3.24438 0.29
NP_440779.1_5 Reverse -138 -155 -5.86102 0.152
NP_442346.1_5 Forward -339 -329 9.51814 0.118
NP_442346.1_5 Forward -148 -138 9.02648 0.118
NP_442346.1_5 Reverse -137 -147 9.02648 0.118
NP_442346.1_5 Forward -24 -14 5.09324 0.262
NP_442346.1_10 Forward -185 -166 4.916 0.168
NP_440545.1_3 Reverse -124 -141 -3.40274 0.203
NP_440545.1_3 Forward -151 -134 -5.56602 0.253
NP_441856.1_3 Reverse -204 -223 1.57275 0.213
NP_440831.1_3 Reverse -254 -273 12.0176 0.153
NP_440831.1_3 Forward -156 -137 7.8433 0.24
NP_440486.1_6 Reverse -287 -306 16.0274 0.207
NP_440459.1_2 Reverse -129 -146 8.59364 0.254
NP_440010.1_10 Forward -284 -265 12.3892 0.19
NP_442603.1_7 Forward -213 -199 8.25877 0.178
NP_441948.1_4 Reverse -131 -149 20.6687 0.0121
NP_441948.1_4 Forward -154 -136 14.3755 0.0318
NP_441047.1_2 Reverse -81 -100 -0.688862 0.264
NP_441833.1_4 Forward -146 -139 15.9687 0.0124
NP_441833.1_4 Reverse -139 -146 15.9687 0.0124
NP_441895.1_10 Forward -82 -63 -17.7985 0.281
NP_442162.1_9 Forward -146 -139 16.2637 0.0124
NP_442162.1_9 Reverse -139 -146 16.2637 0.0124
NP_442162.1_9 Reverse -146 -153 5.93897 0.214
NP_442162.1_9 Reverse -264 -271 3.4807 0.246
NP_442162.1_9 Forward -271 -264 3.38237 0.276
NP_440671.1_4 Reverse -139 -153 5.40779 0.283
NP_441973.1_1 Reverse -209 -224 -7.78825 0.293
NP_442045.1_5 Forward -156 -137 0.196116 0.266
NP_442199.1_5 Forward -155 -136 -0.000545616 0.175
NP_442140.1_3 Forward -146 -136 16.2046 0.0255
NP_442140.1_3 Reverse -139 -149 16.2046 0.0255
NP_440875.1_9 Reverse -140 -150 8.46937 0.233
NP_441813.1_5 Reverse -136 -146 9.91146 0.021
NP_441813.1_5 Forward -149 -139 9.91146 0.021
NP_442089.1_1 Reverse -135 -154 8.84924 0.105
NP_440590.1_4 Forward -146 -133 12.3107 0.0148
NP_440590.1_4 Reverse -139 -152 10.049 0.0314
NP_440567.1_1 Reverse -139 -153 7.57108 0.0689
NP_440567.1_1 Forward -146 -132 3.24451 0.148
NP_442497.1_10 Forward -146 -137 10.4228 0.0087
NP_442497.1_10 Reverse -139 -148 10.4228 0.0087
NP_442497.1_10 Reverse -264 -273 0.688044 0.141
NP_440821.1_4 Reverse -136 -146 10.2065 0.0163
NP_440821.1_4 Forward -149 -139 10.2065 0.0163
NP_441239.1_9 Reverse -136 -148 14.887 0.0247
NP_441239.1_9 Forward -149 -137 14.887 0.0247
NP_441239.1_9 Reverse -53 -65 5.84051 0.206
NP_441239.1_9 Forward -274 -262 4.36554 0.253
NP_441239.1_9 Reverse -126 -138 3.18557 0.292
NP_441951.1_4 Reverse -24 -43 1.86774 0.283
NP_441892.1_1 Forward -222 -205 6.23369 0.0995
NP_441892.1_1 Forward -156 -139 -1.43612 0.205
NP_441892.1_1 Reverse -129 -146 -4.28772 0.258
NP_442270.1_9 Forward -127 -108 0.58944 0.14
NP_440354.1_7 Forward -92 -74 5.82068 0.297
NP_442138.1_1 Reverse -61 -80 2.9486 0.24
NP_442138.1_3 Forward -214 -195 17.699 0.137
NP_440546.1_4 Forward -147 -137 11.8882 0.0679
NP_440546.1_4 Reverse -138 -148 11.8882 0.0679
NP_443033.1_7 Forward -122 -103 10.7175 0.293
NP_440675.1_1 Reverse -203 -222 2.65439 0.262
NP_440462.1_4 Reverse -95 -109 8.84938 0.254
NP_440462.1_6 Forward -149 -139 9.02648 0.0498
NP_440462.1_6 Reverse -136 -146 9.02648 0.0498
NP_440868.1_4 Reverse -134 -146 18.3285 0.0124
NP_440868.1_4 Forward -151 -139 8.49544 0.0602
NP_440868.1_8 Forward -276 -257 -4.42544 0.263
NP_441582.1_5 Forward -149 -130 14.5516 0.115
NP_442402.1_10 Reverse -71 -81 16.4991 0.118
NP_442402.1_10 Reverse -248 -258 11.3859 0.257
NP_441848.1_4 Reverse -364 -380 14.5216 0.17
NP_441848.1_7 Reverse -242 -261 -1.8696 0.257
NP_441848.1_7 Reverse -243 -262 -3.14789 0.277
NP_440696.1_3 Forward -147 -129 5.03403 0.198
NP_440696.1_3 Reverse -92 -110 -3.52077 0.287
NP_441843.2_9 Reverse -140 -158 10.6866 0.23
NP_442882.1_7 Forward -154 -140 10.5204 0.289
NP_442923.1_4 Forward -95 -76 3.53937 0.134
NP_442039.1_4 Forward -146 -139 15.1821 0.0124
NP_442039.1_4 Reverse -139 -146 15.1821 0.0124
NP_441811.1_4 Forward -142 -123 -0.39387 0.295
NP_441811.1_8 Reverse -132 -146 5.60446 0.294
NP_440825.1_7 Reverse -139 -149 12.4217 0.155
NP_440825.1_7 Forward -146 -136 12.4217 0.155
NP_442696.1_6 Forward -234 -215 -12.7836 0.253
NP_442837.1_3 Forward -146 -139 15.7721 0.0124
NP_442837.1_3 Reverse -139 -146 15.7721 0.0124
NP_440160.1_9 Forward -123 -104 8.45592 0.264
NP_442053.1_1 Forward -147 -138 18.3876 0.0007
NP_442053.1_1 Reverse -138 -147 18.3876 0.0007
NP_440505.1_3 Forward -149 -139 6.76487 0.169
NP_440505.1_3 Reverse -136 -146 6.76487 0.169
NP_440505.1_7 Reverse -200 -219 1.96607 0.24
NP_440505.1_7 Forward -283 -264 -1.86883 0.284
NP_441252.1_6 Forward -81 -74 11.6422 0.288
NP_441408.2_7 Forward -41 -22 -3.3438 0.272
NP_440914.1_1 Forward -147 -137 8.6151 0.186
NP_440914.1_1 Reverse -138 -148 8.6151 0.186
NP_441699.1_8 Reverse -45 -64 16.2241 0.259
NP_441011.1_8 Forward -146 -137 16.9127 0.00602
NP_441011.1_8 Reverse -139 -148 16.9127 0.00602
NP_441011.1_8 Forward -314 -305 8.06287 0.16
NP_442101.1_10 Forward -287 -268 -7.57203 0.214
NP_442533.1_1 Forward -75 -56 -14.9469 0.248
NP_442533.1_6 Forward -147 -138 17.2076 0.00137
NP_442533.1_6 Reverse -138 -147 17.2076 0.00137
NP_442533.1_6 Forward -213 -204 7.07956 0.0964
NP_442533.1_6 Forward -272 -263 2.85133 0.236
NP_442533.1_6 Forward -111 -102 2.458 0.255
NP_442533.1_6 Forward -338 -329 2.26134 0.266
NP_442541.1_10 Forward -137 -123 2.65393 0.254
NP_442322.1_9 Reverse -63 -81 12.703 0.251
NP_442229.1_1 Reverse -136 -150 20.3534 0.0686
NP_442229.1_1 Forward -149 -135 11.307 0.18
NP_441028.1_6 Reverse -72 -82 7.74772 0.218
NP_440116.1_8 Reverse -139 -158 2.26107 0.0891
NP_440115.1_6 Reverse -260 -270 8.4365 0.13
NP_439965.1_1 Reverse -129 -148 -5.80207 0.211
NP_442492.1_1 Forward -127 -109 15.0638 0.215
NP_441602.1_3 Reverse -90 -109 -2.55715 0.233
NP_441170.1_4 Forward -120 -102 9.45892 0.193
NP_441972.1_5 Reverse -205 -224 -3.93378 0.201
NP_441106.1_1 Reverse -137 -146 18.191 0.0028
NP_441106.1_1 Forward -148 -139 18.191 0.0028
NP_441106.1_1 Forward -336 -327 2.458 0.283
NP_440429.1_2 Forward -146 -127 7.96426 0.277
NP_439903.1_6 Reverse -77 -96 -1.27961 0.295
NP_439903.1_7 Forward -88 -69 5.11266 0.281
NP_440302.1_4 Reverse -102 -121 23.0089 0.0473
NP_442306.1_10 Reverse -133 -152 -11.2103 0.121
NP_442306.1_10 Reverse -321 -340 -21.3384 0.263
NP_441286.1_1 Forward -148 -136 -3.50094 0.145
NP_441286.1_1 Reverse -137 -149 -3.50094 0.145
NP_441286.1_1 Reverse -203 -215 -5.07423 0.188
NP_442674.1_3 Forward -221 -202 11.0117 0.174
NP_440092.1_9 Reverse -199 -218 13.3725 0.292
NP_440670.1_8 Forward -147 -138 18.3876 0.000699
NP_440670.1_8 Reverse -138 -147 18.3876 0.000699
NP_440670.1_8 Reverse -145 -154 10.2261 0.0437
NP_440886.1_7 Forward -148 -138 17.7774 0.0011
NP_440886.1_7 Reverse -137 -147 17.7774 0.0011
NP_440886.1_7 Forward -141 -131 9.71433 0.0805
NP_440886.1_7 Reverse -62 -72 4.99446 0.205
NP_440886.1_7 Reverse -56 -66 4.10949 0.253
NP_440886.1_7 Reverse -76 -86 4.01116 0.255
NP_442072.1_9 Forward -148 -130 -14.2388 0.137
NP_442072.1_9 Reverse -137 -155 -21.6137 0.211
NP_442072.1_9 Forward -280 -262 -22.1053 0.22
NP_441427.1_6 Forward -276 -258 7.59063 0.297
NP_440907.2_8 Forward -146 -136 14.2375 0.0312
NP_440907.2_8 Reverse -139 -149 14.2375 0.0312
NP_441021.1_1 Forward -167 -148 -10.9153 0.252
NP_441021.1_8 Forward -152 -134 10.9339 0.122
NP_441021.1_8 Reverse -133 -151 10.2456 0.13
NP_441021.1_8 Forward -343 -325 3.3624 0.229
NP_441463.1_3 Forward -157 -138 -7.17871 0.255
NP_441463.1_3 Reverse -128 -147 -9.14533 0.277
NP_441463.1_3 Forward -193 -174 -10.4236 0.294
NP_441463.1_6 Reverse -202 -216 10.5712 0.242
NP_441626.1_2 Forward -146 -139 15.7721 0.0124
NP_441626.1_2 Reverse -139 -146 15.7721 0.0124
NP_441626.1_2 Reverse -264 -271 9.08556 0.1
NP_442365.1_7 Forward -238 -219 -6.39206 0.292
NP_442615.1_1 Reverse -129 -147 8.37728 0.0284
NP_442615.1_1 Forward -156 -138 6.41066 0.0348
NP_441962.1_4 Forward -69 -50 -11.1119 0.238
NP_440387.1_1 Forward -147 -131 5.36841 0.0325
NP_440387.1_1 Reverse -326 -342 -5.64466 0.243
NP_441431.1_2 Reverse -135 -149 17.3052 0.0296
NP_441431.1_2 Forward -150 -136 15.4369 0.0488
NP_441431.1_2 Forward -338 -324 7.57046 0.238
NP_441431.1_2 Forward -89 -75 5.70218 0.291
NP_440634.1_10 Forward -362 -343 5.50519 0.269
NP_442224.1_1 Forward -274 -255 -4.22878 0.233
NP_440358.1_8 Forward -257 -238 -0.197208 0.263
NP_440814.1_4 Reverse -129 -148 -13.5702 0.293
NP_440114.1_10 Reverse -138 -152 15.4376 0.0252
NP_440114.1_10 Forward -147 -133 10.4227 0.148
NP_442684.1_10 Forward -224 -206 16.9313 0.273
NP_442698.1_3 Forward -65 -51 17.2068 0.298
NP_440287.1_6 Reverse -129 -148 7.86593 0.151
NP_440766.1_4 Reverse -259 -273 0.982901 0.259
NP_440766.1_4 Forward -211 -197 0.294584 0.291
NP_439988.1_3 Reverse -19 -33 4.62115 0.295
NP_439988.1_3 Reverse -92 -106 3.44117 0.299
NP_439910.1_2 Reverse -130 -147 -13.3342 0.162
NP_439910.1_2 Forward -155 -138 -21.3973 0.183
NP_442867.1_8 Forward -103 -84 8.75091 0.23
NP_442867.1_8 Reverse -250 -269 5.50599 0.276
NP_442867.1_8 Reverse -331 -350 4.52268 0.281
NP_440457.1_1 Reverse -134 -146 2.69391 0.205
NP_440798.1_6 Forward -146 -133 14.3756 0.0423
NP_440798.1_6 Reverse -139 -152 14.2773 0.0423
NP_440798.1_6 Forward -153 -140 3.16588 0.152
NP_440142.1_3 Forward -70 -51 17.109 0.121
NP_440142.1_7 Forward -38 -19 11.9958 0.2
NP_441984.1_3 Forward -43 -25 16.5388 0.0928
NP_441436.1_2 Forward -353 -334 -5.99873 0.296
NP_440473.1_1 Forward -237 -218 16.0777 0.109
NP_440473.1_9 Forward -158 -139 -11.4069 0.293
NP_442509.1_9 Forward -147 -137 16.2041 0.00739
NP_442509.1_9 Reverse -138 -148 16.2041 0.00739
NP_440734.1_9 Reverse -60 -79 15.1424 0.199
NP_440554.1_4 Forward -146 -136 7.35486 0.103
NP_440554.1_4 Reverse -139 -149 7.35486 0.103
NP_442862.1_3 Reverse -247 -264 4.46374 0.29
NP_442862.1_3 Reverse -190 -207 3.87375 0.299
NP_441885.1_5 Forward -147 -137 11.4848 0.00668
NP_441885.1_5 Reverse -138 -148 11.4848 0.00668
NP_441885.1_5 Forward -272 -262 0.275027 0.174
NP_441885.1_5 Forward -213 -203 -0.0199663 0.186
NP_442341.1_7 Reverse -137 -151 10.0294 0.0682
NP_442341.1_7 Forward -148 -134 9.63603 0.0726
NP_442341.1_7 Reverse -287 -301 1.96621 0.274
NP_442341.1_9 Reverse -136 -150 7.96378 0.182
NP_442341.1_9 Forward -149 -135 6.68548 0.217
NP_441173.1_9 Reverse -73 -81 12.507 0.206
NP_442534.1_7 Reverse -22 -41 6.29264 0.272
NP_443000.1_7 Forward -149 -139 1.94665 0.226
NP_443000.1_7 Reverse -136 -146 1.94665 0.226
NP_441842.1_1 Forward -145 -132 10.3434 0.3
NP_441842.1_10 Forward -154 -140 16.9125 0.0273
NP_441842.1_10 Forward -190 -176 7.37441 0.258
NP_440275.1_3 Forward -149 -139 8.33817 0.0602
NP_440275.1_3 Reverse -136 -146 8.33817 0.0602
NP_440275.1_3 Forward -337 -327 4.3066 0.199
NP_440091.1_1 Forward -151 -139 10.7571 0.0429
NP_440091.1_1 Reverse -134 -146 10.1671 0.0498
NP_441902.1_3 Forward -258 -248 11.524 0.298
NP_443010.1_7 Forward -114 -95 10.0284 0.278
NP_443010.1_10 Forward -186 -169 5.47654 0.204
NP_442451.1_2 Reverse -196 -215 -1.47551 0.172
NP_439962.1_4 Forward -94 -75 -8.16202 0.292
NP_440175.1_7 Forward -127 -109 10.9246 0.249
NP_440149.1_8 Forward -213 -194 -3.44213 0.19
NP_442373.1_2 Forward -275 -256 -9.047 0.256
NP_440216.1_1 Reverse -138 -152 16.2242 0.00307
NP_440216.1_1 Forward -147 -133 8.06273 0.0068
NP_440216.1_1 Forward -183 -169 -11.8985 0.228
NP_440216.1_6 Forward -220 -204 5.36841 0.189
NP_440172.1_1 Forward -147 -137 8.73149 0.0586
NP_440172.1_1 Reverse -138 -148 8.73149 0.0586
NP_440172.1_1 Forward -272 -262 4.79825 0.166
NP_440167.1_3 Reverse -92 -111 13.3725 0.185
NP_442015.1_10 Reverse -134 -147 10.8357 0.0391
NP_442015.1_10 Reverse -200 -213 4.8375 0.159
NP_442015.1_10 Forward -151 -138 1.88757 0.204
NP_441226.1_7 Forward -146 -139 14.4934 0.0123
NP_441226.1_7 Reverse -139 -146 14.4934 0.0123
NP_440198.1_3 Forward -120 -101 13.9616 0.277
NP_441111.1_7 Forward -146 -138 18.7023 0.00294
NP_441111.1_7 Reverse -139 -147 18.7023 0.00294
NP_441111.1_7 Reverse -264 -272 -0.472234 0.131
NP_442379.1_10 Reverse -256 -273 -2.91109 0.245
NP_441766.1_2 Forward -147 -138 17.5026 0.00297
NP_441766.1_2 Reverse -138 -147 17.5026 0.00297
NP_441766.1_2 Forward -272 -263 4.91628 0.154
NP_440416.1_9 Forward -154 -135 2.26107 0.0409
NP_440416.1_9 Forward -162 -143 -18.8801 0.266
NP_443052.1_8 Forward -157 -138 -5.50708 0.13
NP_443052.1_9 Reverse -53 -72 -4.13045 0.254
NP_442116.1_6 Reverse -364 -381 7.40502 0.258
NP_442154.1_1 Forward -74 -56 -13.6489 0.217
NP_442154.1_1 Forward -77 -59 -16.9921 0.247
NP_442564.1_4 Forward -110 -91 18.0083 0.216
NP_440261.1_5 Forward -146 -133 -4.50394 0.151
NP_440261.1_5 Reverse -139 -152 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTATTCTGCTGTGTGACATAGATTATTTCAAAAACTATAACGACCATTATGGTCACCAGGGGGGCGACGACTGCTTACAACAGGTGGCTAAGGCTTTAACCAGGGTGGTGCACCGTCCTAAGGATTTGGCCGCTCGCTACGGTGGGGAAGAATTTTTGATTGTCCTACCCAACACAGACCTCCAAGGGGCCATCCACATCGGTGAAGACATCCAGGCGGAGATTACCCGTCTAGCTATTCCCCACGTCCAATCGGCGATCGCCGACCATGTCACCCTGAGCATTGGTTGTGCCAGCACCATTCCCCGCCTAGGCAGTGATTGGGGAAAGTTGGTGGGGGCAGCGGATCAATATTTGTATGAAGCTAAGGCCCAAGGGCGTAATCGTTTAGTCAGTGGTCG

CDS

ATGAGGGGAAGAACCCATGGGATAATCAGGCCAACACTACTCCGACCTATTTTTTTGATGAAATTTTTTACCGCTATGCGCGACATTCTTATTAGTCTGACCGTTGTTACTTTTTTTAGCTTGGTGTTAATTTCCGTGGCCATTTTTGGTAAATCTTCTCCGTCGGCGATCGCCGCTCCCCAGGAAGTTAAACCAGTCCAAATTGCCCAAGCTTCTGCCCTACAAACCCCGGAACCATCTCCCATGACTGCCGAAAATTCCGCCAATATTGTCACCACCGAGTCTGGATTGCAATACATCGATGAAGTGGTAGGGGAAGGCCCCAGCCCCACTAAAGGCCAAAAAGTAGAAGTACACTACACTGGCCGCCTCACCGACGGCACTAAGTTTGATAGCTCCGTGGACCGCAATAAGCCTTTTACCTTCACCATTGGCGTCGGCCAGGTGATCAAAGGTTGGGACGAAGGGGTGGCCACCATGCAAGTGGGTGGTAAGCGTAAACTGATCATTCCACCGGACTTGGCCTATGGCTCCCGGGGAGCGGGTGGTGTAATTCCCCCCAATGCCACCTTGGAATTTGAAGTGGAATTGCTTGGTATTAAGTAG

Protein

MRGRTHGIIRPTLLRPIFLMKFFTAMRDILISLTVVTFFSLVLISVAIFGKSSPSAIAAPQEVKPVQIAQASALQTPEPSPMTAENSANIVTTESGLQYIDEVVGEGPSPTKGQKVEVHYTGRLTDGTKFDSSVDRNKPFTFTIGVGQVIKGWDEGVATMQVGGKRKLIIPPDLAYGSRGAGGVIPPNATLEFEVELLGIK