Your browser is old and dusty. Try Google Chrome!

Details for slr1760

ORF slr1760
Accession NP_440377.1
Symbol
Category two-component response regulator
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -331 -345 8.84938 0.083
NP_440795.1_7 Forward -338 -331 14.6904 0.0123
NP_440795.1_7 Reverse -331 -338 14.6904 0.0123
NP_441418.1_6 Reverse -330 -349 -10.227 0.0328
NP_441418.1_6 Forward -48 -29 -20.2567 0.108
NP_441418.1_6 Forward -339 -320 -29.0082 0.215
NP_441418.1_6 Reverse -299 -318 -29.5982 0.23
NP_442291.1_5 Forward -340 -324 3.69678 0.107
NP_440897.1_6 Reverse -330 -349 9.04509 0.0705
NP_441453.1_4 Reverse -330 -338 16.539 0.00633
NP_441453.1_4 Forward -339 -331 16.539 0.00633
NP_441453.1_7 Forward -161 -154 14.1988 0.175
NP_442151.1_6 Reverse -330 -344 10.4227 0.123
NP_442151.1_6 Forward -339 -325 5.89945 0.256
NP_442151.1_6 Reverse -336 -350 5.1128 0.294
NP_441818.1_1 Forward -338 -327 9.59626 0.232
NP_441818.1_9 Forward -339 -320 -9.73531 0.291
NP_440226.1_1 Forward -339 -320 16.8141 0.0209
NP_442169.1_1 Reverse -167 -186 4.42435 0.26
NP_440259.1_4 Forward -143 -129 9.98557 0.278
NP_442287.1_1 Forward -382 -372 13.0576 0.288
NP_442655.1_10 Reverse -3 -22 -12.0953 0.261
NP_442173.1_1 Forward -338 -330 15.4574 0.00633
NP_442173.1_1 Reverse -331 -339 15.4574 0.00633
NP_442173.1_1 Reverse -297 -305 5.13263 0.226
NP_442173.1_5 Forward -149 -139 15.3426 0.287
NP_442752.1_4 Forward -339 -332 13.8055 0.0199
NP_442752.1_4 Reverse -330 -337 13.8055 0.0199
NP_442752.1_4 Reverse -1 -8 8.20058 0.127
NP_443027.1_4 Reverse -328 -338 16.2046 0.0437
NP_443027.1_4 Forward -341 -331 14.828 0.0437
NP_441812.1_3 Forward -340 -326 17.8958 0.0479
NP_442975.1_10 Forward -343 -329 14.0603 0.0459
NP_442975.1_10 Reverse -326 -340 12.8803 0.0459
NP_442975.1_10 Forward -149 -135 1.76896 0.291
NP_440784.1_7 Forward -338 -331 15.9687 0.0123
NP_440784.1_7 Reverse -331 -338 15.9687 0.0123
NP_439979.1_2 Forward -48 -29 7.66927 0.26
NP_442062.1_8 Reverse -330 -340 19.4496 0.000558
NP_442062.1_8 Forward -339 -329 10.3048 0.0493
NP_440761.1_4 Reverse -325 -344 -3.93378 0.132
NP_440304.1_4 Reverse -328 -338 19.9412 0.00364
NP_440304.1_4 Forward -341 -331 10.8948 0.051
NP_440304.1_4 Forward -322 -312 3.02829 0.299
NP_442242.1_4 Forward -338 -331 14.3954 0.0124
NP_442242.1_4 Reverse -331 -338 14.3954 0.0124
NP_440044.1_8 Forward -338 -319 -2.26216 0.261
NP_441781.1_7 Forward -339 -320 2.85105 0.199
NP_441781.1_7 Reverse -77 -96 -1.67217 0.278
NP_440011.1_1 Reverse -334 -353 11.3075 0.281
NP_441594.1_6 Reverse -18 -37 8.45592 0.153
NP_440370.1_10 Forward -348 -329 10.7175 0.198
NP_442110.1_7 Reverse -330 -344 12.3893 0.0586
NP_442110.1_7 Forward -339 -325 1.96621 0.222
NP_441925.1_4 Forward -352 -333 -17.6025 0.297
NP_441925.1_5 Forward -237 -223 14.4542 0.207
NP_440856.1_7 Forward -323 -304 -6.09707 0.235
NP_441083.1_5 Reverse -330 -340 11.3864 0.0159
NP_441083.1_5 Forward -339 -329 11.2881 0.0159
NP_442827.1_8 Forward -347 -328 3.73524 0.144
NP_441738.1_2 Forward -337 -330 15.28 0.0102
NP_441738.1_2 Reverse -332 -339 15.28 0.0102
NP_441558.1_5 Reverse -328 -347 6.29264 0.22
NP_440209.1_1 Reverse -330 -338 18.1123 0.00295
NP_440209.1_1 Forward -339 -331 18.1123 0.00295
NP_442889.1_8 Reverse -327 -341 7.96378 0.136
NP_441713.1_1 Forward -345 -326 -15.0452 0.26
NP_441770.1_4 Reverse -306 -325 -11.1119 0.29
NP_440178.1_7 Forward -340 -321 -5.01543 0.0596
NP_440178.1_7 Reverse -329 -348 -22.0267 0.249
NP_442445.1_1 Reverse -1 -20 21.5339 0.0679
NP_441716.1_1 Reverse -330 -344 3.73617 0.259
NP_442111.1_4 Reverse -329 -343 16.9125 0.0123
NP_441163.1_1 Forward -43 -26 3.87303 0.299
NP_441562.1_5 Reverse -299 -318 22.0256 0.0347
NP_440851.1_1 Reverse -210 -229 15.2399 0.257
NP_440906.1_5 Forward -338 -331 15.8704 0.0124
NP_440906.1_5 Reverse -331 -338 15.8704 0.0124
NP_440747.1_10 Forward -342 -330 7.70879 0.00236
NP_440747.1_10 Reverse -327 -339 -1.92764 0.0192
NP_441130.1_10 Forward -341 -327 9.83269 0.12
NP_441486.1_1 Reverse -327 -341 10.7177 0.0189
NP_441486.1_1 Forward -342 -328 2.85119 0.074
NP_441486.1_1 Forward -51 -37 -3.34366 0.178
NP_442634.1_4 Reverse -328 -342 7.57108 0.0479
NP_442634.1_4 Forward -341 -327 -1.96703 0.149
NP_441265.1_3 Forward -345 -331 2.94952 0.181
NP_440403.1_10 Reverse -30 -49 4.71934 0.254
NP_440403.1_10 Forward -348 -329 3.44104 0.273
NP_440403.1_10 Reverse -18 -37 2.3594 0.279
NP_441014.1_8 Forward -352 -333 -8.45701 0.283
NP_442848.1_1 Reverse -324 -338 -2.85201 0.263
NP_441012.1_4 Forward -343 -330 7.19745 0.272
NP_443018.1_3 Forward -338 -331 14.8871 0.0123
NP_443018.1_3 Reverse -331 -338 14.8871 0.0123
NP_441316.1_7 Forward -341 -326 -3.56002 0.282
NP_440376.1_1 Forward -339 -330 19.4693 0.000692
NP_440376.1_1 Reverse -330 -339 19.4693 0.000692
NP_440376.1_1 Reverse -179 -188 0.196389 0.283
NP_441857.1_6 Forward -93 -83 15.6147 0.215
NP_441588.1_4 Forward -337 -327 6.66654 0.185
NP_442687.1_7 Forward -340 -330 15.8113 0.0125
NP_442687.1_7 Reverse -329 -339 9.02648 0.0994
NP_442687.1_7 Forward -69 -59 4.50326 0.245
NP_442191.1_4 Reverse -331 -345 17.5862 0.0182
NP_442191.1_4 Forward -166 -152 12.6414 0.198
NP_442485.1_3 Forward -350 -331 4.03102 0.192
NP_442485.1_3 Reverse -28 -47 -2.55715 0.262
NP_441846.1_10 Reverse -179 -198 -13.5702 0.206
NP_441846.1_10 Forward -234 -215 -23.5016 0.289
NP_440667.1_10 Forward -41 -22 14.7491 0.233
NP_440360.1_10 Reverse -23 -37 2.16287 0.27
NP_442658.1_1 Forward -341 -331 15.9091 0.00966
NP_442658.1_1 Reverse -328 -338 13.0576 0.04
NP_440141.1_4 Forward -45 -26 -5.99873 0.296
NP_440141.1_8 Reverse -336 -355 9.93088 0.211
NP_442782.1_2 Reverse -330 -344 7.57108 0.202
NP_442782.1_2 Forward -320 -306 0.786239 0.284
NP_440656.1_8 Reverse -319 -338 -7.27704 0.252
NP_441414.1_9 Reverse -330 -349 -2.0655 0.11
NP_441487.1_9 Forward -306 -287 1.27776 0.205
NP_441256.1_8 Reverse -172 -191 4.62101 0.272
NP_442937.1_5 Forward -41 -22 7.66927 0.244
NP_441958.1_5 Reverse -329 -339 21.2195 0.000805
NP_441958.1_5 Forward -340 -330 12.2714 0.00183
NP_440203.1_5 Forward -45 -35 9.51767 0.254
NP_439905.1_1 Reverse -297 -310 6.21414 0.295
NP_440984.1_7 Forward -350 -336 5.50613 0.252
NP_442911.1_2 Forward -349 -330 6.68596 0.0279
NP_441580.1_6 Reverse -319 -338 -6.88371 0.235
NP_440153.1_5 Reverse -331 -345 1.76955 0.245
NP_440153.1_8 Reverse -299 -312 -3.4223 0.295
NP_440993.1_2 Reverse -325 -341 7.63002 0.168
NP_440993.1_2 Forward -344 -328 1.43517 0.279
NP_440993.1_3 Forward -318 -299 -0.984623 0.273
NP_440602.1_8 Forward -339 -325 13.3726 0.174
NP_441348.1_3 Reverse -174 -193 7.17762 0.265
NP_441099.1_5 Forward -349 -330 -8.85033 0.206
NP_441099.1_5 Reverse -320 -339 -11.6036 0.287
NP_442002.1_9 Forward -340 -333 10.7572 0.185
NP_442438.1_10 Forward -344 -330 19.0758 0.0137
NP_442438.1_10 Reverse -306 -320 16.0275 0.0244
NP_440377.1_1 Forward -148 -131 18.9077 0.0762
NP_440377.1_1 Reverse -132 -149 11.1771 0.291
NP_440377.1_2 Forward -182 -165 27.4734 0.000126
NP_441000.1_6 Forward -340 -326 3.44117 0.111
NP_442771.1_1 Reverse -328 -346 0.609134 0.0936
NP_442771.1_1 Forward -322 -304 -8.63398 0.2
NP_440147.1_4 Forward -341 -328 2.77255 0.202
NP_440147.1_4 Reverse -328 -341 2.37923 0.208
NP_441295.1_4 Forward -352 -333 -0.39387 0.29
NP_441550.1_8 Reverse -328 -338 13.0576 0.0273
NP_441550.1_8 Reverse -193 -203 6.27276 0.214
NP_441550.1_8 Forward -341 -331 6.0761 0.214
NP_441916.1_7 Forward -339 -329 18.9579 0.00144
NP_441916.1_7 Reverse -330 -340 18.4663 0.00144
NP_441916.1_7 Forward -68 -58 1.84832 0.272
NP_441916.1_7 Reverse -53 -63 1.35667 0.286
NP_440206.1_4 Reverse -304 -323 4.91521 0.255
NP_440465.1_10 Reverse -293 -312 10.3242 0.173
NP_441041.1_1 Forward -291 -272 5.50599 0.296
NP_441041.1_4 Reverse -330 -349 12.7825 0.0234
NP_441041.1_4 Forward -339 -320 -4.72043 0.141
NP_441041.1_4 Reverse -179 -198 -12.6852 0.272
NP_441041.1_7 Reverse -327 -339 9.65268 0.108
NP_441041.1_7 Forward -342 -330 7.61196 0.162
NP_440509.1_6 Reverse -22 -41 17.3057 0.0153
NP_442004.1_3 Reverse -295 -314 12.6841 0.3
NP_441725.1_5 Reverse -331 -341 11.2881 0.0247
NP_441725.1_5 Forward -338 -328 11.1898 0.0247
NP_441725.1_5 Forward -29 -19 3.12662 0.115
NP_439966.1_7 Forward -341 -331 18.4657 0.00473
NP_439966.1_7 Reverse -328 -338 14.8275 0.0177
NP_439966.1_9 Forward -341 -332 0.983037 0.253
NP_442941.1_3 Forward -338 -328 19.9412 0.00262
NP_442941.1_3 Reverse -331 -341 11.4848 0.0116
NP_440289.1_2 Reverse -327 -340 6.70579 0.0591
NP_440289.1_2 Forward -342 -329 5.03416 0.0636
NP_440289.1_2 Reverse -16 -29 -0.0790467 0.182
NP_440983.1_5 Forward -21 -2 -9.24366 0.3
NP_442281.1_1 Forward -344 -330 19.7634 0.00247
NP_442281.1_1 Reverse -325 -339 17.8952 0.00513
NP_442281.1_1 Forward -53 -39 4.42388 0.195
NP_442281.1_1 Reverse -34 -48 2.65393 0.26
NP_441334.1_7 Reverse -328 -347 -11.8003 0.126
NP_442847.1_5 Reverse -237 -256 13.4708 0.214
NP_440437.1_1 Forward -345 -326 13.2741 0.0314
NP_440498.1_1 Reverse -321 -339 9.36059 0.0786
NP_440498.1_1 Forward -348 -330 -0.865831 0.22
NP_442982.1_5 Reverse -16 -35 -0.983855 0.263
NP_442982.1_5 Reverse -320 -339 -2.75381 0.289
NP_440375.1_8 Reverse -331 -350 2.16274 0.231
NP_441644.1_6 Forward -339 -329 19.0557 0.000803
NP_441644.1_6 Reverse -330 -340 10.1076 0.0628
NP_441644.1_6 Forward -188 -178 3.42118 0.282
NP_442215.1_2 Reverse -328 -344 -1.41643 0.185
NP_442215.1_2 Forward -57 -41 -7.11963 0.286
NP_442215.1_2 Forward -38 -22 -7.41462 0.294
NP_442029.1_6 Reverse -248 -267 3.24438 0.282
NP_440253.1_2 Reverse -330 -348 7.00065 0.0752
NP_440253.1_2 Forward -339 -321 -2.53746 0.268
NP_440929.1_8 Forward -339 -330 19.2726 0.000701
NP_440929.1_8 Reverse -330 -339 19.2726 0.000701
NP_442933.1_10 Forward -339 -330 17.601 0.00325
NP_442933.1_10 Reverse -330 -339 17.601 0.00325
NP_441751.2_8 Forward -338 -324 5.60446 0.0419
NP_442926.1_3 Forward -41 -22 3.44104 0.281
NP_442926.1_5 Forward -344 -325 9.59069 0.275
NP_442554.1_8 Forward -338 -328 16.9913 0.0065
NP_442554.1_8 Reverse -331 -341 13.8447 0.0145
NP_441762.1_7 Reverse -329 -341 2.98891 0.0676
NP_441762.1_7 Forward -340 -328 2.20226 0.0676
NP_442313.1_4 Reverse -248 -267 12.4875 0.286
NP_442142.1_4 Forward -342 -329 17.7182 0.0255
NP_442142.1_4 Reverse -327 -340 16.1449 0.0264
NP_442142.1_4 Forward -18 -5 2.28034 0.295
NP_442292.1_1 Forward -338 -329 17.5026 0.00435
NP_442292.1_1 Reverse -331 -340 9.63616 0.0183
NP_442476.1_6 Forward -156 -142 4.03116 0.151
NP_441711.1_4 Reverse -321 -340 4.22769 0.219
NP_443009.1_5 Reverse -329 -340 19.626 0.00102
NP_443009.1_5 Forward -340 -329 7.82632 0.118
NP_442301.1_2 Forward -198 -179 4.22689 0.281
NP_442408.2_1 Forward -339 -320 -0.197208 0.205
NP_441371.1_1 Forward -250 -231 16.8141 0.283
NP_441715.1_4 Reverse -331 -341 16.303 0.0117
NP_441715.1_4 Forward -338 -328 14.238 0.0295
NP_440015.1_9 Forward -339 -321 -2.0458 0.299
NP_441448.1_1 Forward -41 -22 9.63589 0.191
NP_441448.1_2 Forward -193 -174 -0.984623 0.266
NP_440183.1_9 Forward -28 -9 -18.1918 0.276
NP_441198.1_8 Reverse -328 -338 13.2713 0.108
NP_441468.1_1 Forward -338 -331 15.8704 0.0124
NP_441468.1_1 Reverse -331 -338 15.8704 0.0124
NP_441020.2_6 Reverse -328 -345 18.5251 0.0115
NP_441020.2_6 Reverse -57 -74 8.10198 0.209
NP_441020.2_6 Forward -341 -324 6.33202 0.267
NP_441015.1_10 Reverse -325 -344 -5.21209 0.219
NP_441015.1_10 Reverse -1 -20 -8.65367 0.276
NP_441015.1_10 Reverse -331 -350 -10.227 0.283
NP_441673.1_1 Forward -339 -330 20.8459 0.000698
NP_441673.1_1 Reverse -330 -339 20.8459 0.000698
NP_441826.1_2 Forward -345 -331 13.5693 0.0214
NP_441330.1_1 Reverse -325 -344 -12.6852 0.183
NP_442745.1_6 Forward -394 -375 11.6025 0.258
NP_442490.1_9 Reverse -27 -46 -2.75381 0.217
NP_442868.1_6 Reverse -328 -338 1.06167 0.205
NP_442868.1_6 Forward -341 -331 0.963343 0.205
NP_441056.1_1 Reverse -330 -349 -3.73712 0.242
NP_442361.1_3 Forward -345 -332 18.9972 0.0363
NP_442361.1_3 Reverse -305 -318 15.7522 0.0825
NP_442808.1_1 Forward -340 -330 18.4657 0.00201
NP_442808.1_1 Forward -264 -254 12.1726 0.0481
NP_442808.1_1 Reverse -329 -339 8.73102 0.0481
NP_442808.1_1 Forward -189 -179 4.60114 0.195
NP_440145.1_3 Forward -397 -378 2.75272 0.114
NP_440145.1_3 Reverse -320 -339 -2.0655 0.161
NP_440145.1_3 Forward -349 -330 -5.80207 0.279
NP_442113.1_10 Reverse -269 -288 -3.73712 0.217
NP_442050.1_5 Reverse -328 -338 18.0724 0.00365
NP_442050.1_5 Forward -341 -331 9.12434 0.193
NP_440558.1_2 Forward -33 -14 0.884433 0.185
NP_442789.1_4 Forward -322 -303 5.60432 0.145
NP_441518.1_3 Reverse -320 -339 -14.6519 0.279
NP_441878.1_6 Reverse -329 -339 10.5014 0.0176
NP_441878.1_6 Forward -340 -330 10.4031 0.0176
NP_441036.1_8 Forward -340 -330 17.7779 0.000554
NP_441036.1_8 Reverse -329 -339 15.713 0.00724
NP_441036.1_8 Reverse -310 -320 5.68323 0.265
NP_442650.1_2 Reverse -15 -29 3.44117 0.202
NP_441557.1_5 Forward -339 -330 19.9609 0.000699
NP_441557.1_5 Reverse -330 -339 19.9609 0.000699
NP_441590.1_6 Forward -198 -179 23.303 0.0354
NP_442066.2_4 Reverse -330 -349 1.86774 0.147
NP_441224.1_2 Reverse -169 -187 16.8337 0.109
NP_441308.1_8 Reverse -328 -338 13.353 0.218
NP_441308.1_8 Forward -341 -331 10.1081 0.22
NP_441458.1_10 Reverse -30 -49 1.17943 0.297
NP_442183.1_1 Forward -339 -325 18.5841 0.00743
NP_442183.1_1 Reverse -330 -344 9.93102 0.0903
NP_440086.1_4 Forward -136 -122 15.2889 0.268
NP_441459.1_6 Forward -373 -355 9.85225 0.259
NP_441574.1_1 Forward -219 -200 -4.81876 0.254
NP_442347.1_2 Reverse -331 -340 11.1111 0.056
NP_442347.1_2 Forward -338 -329 3.34298 0.284
NP_442645.1_2 Reverse -4 -23 -16.2252 0.227
NP_441037.1_4 Reverse -77 -87 9.26684 0.225
NP_441037.1_4 Reverse -328 -338 7.31769 0.237
NP_441037.1_4 Forward -341 -331 7.02532 0.237
NP_442594.1_8 Reverse -3 -22 3.14605 0.288
NP_442594.1_8 Reverse -4 -23 1.96607 0.295
NP_441633.1_3 Forward -341 -328 -3.91395 0.177
NP_441633.1_3 Reverse -328 -341 -5.88057 0.236
NP_440136.1_2 Forward -338 -331 15.9687 0.0123
NP_440136.1_2 Reverse -331 -338 15.9687 0.0123
NP_441728.2_2 Reverse -55 -74 13.5691 0.218
NP_442998.1_10 Forward -337 -330 15.5754 0.0102
NP_442998.1_10 Reverse -332 -339 15.5754 0.0102
NP_440899.1_1 Reverse -1 -20 7.33393 0.261
NP_440299.1_1 Forward -343 -330 20.1765 0.00128
NP_441799.1_1 Reverse -326 -340 13.7653 0.03
NP_441799.1_1 Forward -52 -38 9.24208 0.0966
NP_441799.1_1 Forward -343 -329 5.01387 0.227
NP_441007.1_10 Reverse -325 -338 2.47756 0.186
NP_441435.1_4 Reverse -23 -42 12.7825 0.255
NP_440256.1_1 Reverse -327 -346 9.3409 0.0206
NP_440256.1_1 Forward -342 -323 3.83436 0.049
NP_440256.1_1 Forward -51 -32 -8.752 0.266
NP_441559.1_8 Forward -344 -330 2.45787 0.143
NP_441559.1_8 Reverse -272 -286 -4.22864 0.219
NP_441559.1_8 Reverse -153 -167 -5.90027 0.271
NP_440915.1_6 Forward -343 -329 14.7492 0.0183
NP_440215.1_7 Forward -293 -275 14.7688 0.289
NP_442866.1_1 Forward -344 -325 -7.76869 0.268
NP_441464.1_8 Forward -305 -291 16.6175 0.0836
NP_441464.1_8 Reverse -263 -277 4.03116 0.283
NP_440026.1_2 Reverse -141 -160 12.1925 0.297
NP_440026.1_7 Reverse -336 -351 16.8928 0.159
NP_440695.1_5 Reverse -330 -349 7.17762 0.15
NP_441199.1_6 Forward -343 -324 0.0977854 0.254
NP_441494.1_6 Forward -35 -22 8.27909 0.23
NP_442993.1_1 Forward -339 -323 9.59664 0.0182
NP_442993.1_1 Reverse -53 -69 -8.98791 0.178
NP_440677.1_6 Reverse -30 -49 11.5042 0.229
NP_442386.1_9 Forward -340 -331 15.7322 0.0144
NP_442386.1_9 Reverse -329 -338 6.39082 0.219
NP_442386.1_9 Forward -263 -254 4.52254 0.297
NP_441750.1_4 Forward -343 -324 5.50599 0.186
NP_441340.1_5 Forward -338 -331 15.6737 0.0124
NP_441340.1_5 Reverse -331 -338 15.6737 0.0124
NP_442791.1_9 Forward -23 -4 15.8299 0.15
NP_440168.1_2 Reverse -25 -44 -3.24547 0.276
NP_440168.1_4 Forward -46 -27 -4.13045 0.255
NP_442240.1_2 Reverse -331 -350 -4.52377 0.0843
NP_440161.1_3 Forward -341 -322 13.2741 0.148
NP_440586.1_1 Forward -220 -201 -4.32711 0.278
NP_440586.1_8 Forward -338 -331 13.2151 0.026
NP_440586.1_8 Reverse -331 -338 13.2151 0.026
NP_442251.1_6 Forward -338 -331 15.2804 0.0124
NP_442251.1_6 Reverse -331 -338 15.2804 0.0124
NP_441912.1_3 Forward -233 -214 7.07928 0.27
NP_441262.1_3 Reverse -330 -337 14.7888 0.0223
NP_441262.1_3 Forward -339 -332 14.7888 0.0223
NP_443051.1_1 Reverse -329 -338 19.5676 0.00335
NP_443051.1_1 Forward -340 -331 10.4228 0.00754
NP_441232.1_10 Reverse -319 -338 5.60432 0.173
NP_439937.1_8 Forward -268 -249 -5.40875 0.295
NP_439937.1_9 Reverse -275 -292 -5.37003 0.157
NP_440439.1_1 Forward -342 -329 15.2606 0.0137
NP_440439.1_1 Reverse -327 -340 9.06573 0.0475
NP_440439.1_1 Reverse -155 -168 -0.37404 0.215
NP_439943.1_1 Reverse -372 -391 4.71934 0.0987
NP_439943.1_4 Reverse -132 -151 4.81767 0.287
NP_440372.1_2 Forward -338 -331 16.3621 0.0124
NP_440372.1_2 Reverse -331 -338 16.3621 0.0124
NP_441181.1_6 Forward -47 -29 6.214 0.219
NP_441789.1_7 Forward -205 -186 3.24359 0.205
NP_440378.1_3 Forward -322 -303 19.5673 0.0426
NP_439977.1_5 Forward -163 -144 -1.7705 0.26
NP_440139.1_1 Reverse -324 -343 11.995 0.0797
NP_441572.1_7 Forward -345 -326 -3.24547 0.208
NP_441572.1_7 Forward -356 -337 -4.22878 0.229
NP_440267.1_2 Reverse -325 -339 18.7801 0.0237
NP_440267.1_2 Forward -15 -1 13.8636 0.123
NP_442384.1_10 Reverse -330 -343 15.7522 0.00946
NP_440364.1_6 Reverse -32 -45 13.195 0.29
NP_441604.1_4 Forward -347 -328 -6.68705 0.293
NP_441877.1_7 Forward -319 -300 2.75194 0.218
NP_441018.1_7 Reverse -175 -194 10.3242 0.209
NP_441018.1_7 Reverse -368 -387 6.78429 0.282
NP_442262.1_10 Forward -338 -331 14.1988 0.0123
NP_442262.1_10 Reverse -331 -338 14.1988 0.0123
NP_442262.1_10 Forward -47 -40 7.11894 0.287
NP_441689.1_5 Reverse -328 -338 17.8758 0.0158
NP_441689.1_5 Forward -341 -331 8.53436 0.132
NP_440163.1_10 Forward -342 -332 16.303 0.0762
NP_440163.1_10 Reverse -36 -46 8.53483 0.271
NP_440344.1_10 Reverse -323 -340 0.137172 0.0369
NP_440344.1_10 Forward -346 -329 -6.746 0.114
NP_440344.1_10 Forward -270 -253 -11.0726 0.2
NP_440282.1_10 Forward -40 -21 -0.983855 0.216
NP_441965.1_10 Reverse -327 -343 6.74504 0.165
NP_440297.1_9 Reverse -331 -341 9.32148 0.0917
NP_440297.1_9 Forward -338 -328 9.22315 0.0917
NP_441592.1_10 Reverse -204 -218 14.7486 0.279
NP_440894.1_10 Forward -356 -337 6.58763 0.215
NP_440894.1_10 Forward -344 -325 3.44104 0.272
NP_440999.1_9 Forward -343 -329 10.6193 0.0502
NP_440888.1_2 Reverse -330 -344 17.6002 0.00354
NP_440888.1_2 Forward -339 -325 13.5686 0.027
NP_440888.1_2 Forward -85 -71 9.24208 0.134
NP_440888.1_2 Forward -188 -174 8.65209 0.152
NP_440888.1_2 Forward -48 -34 6.68548 0.223
NP_440888.1_2 Reverse -299 -313 5.99717 0.254
NP_440888.1_2 Forward -21 -7 5.40719 0.28
NP_442557.1_2 Reverse -3 -21 16.1454 0.156
NP_440792.1_5 Forward -338 -319 8.35759 0.237
NP_440822.1_1 Reverse -301 -320 17.7273 0.13
NP_440491.1_1 Reverse -327 -346 9.25599 0.218
NP_441345.1_8 Forward -46 -27 11.0125 0.266
NP_440052.1_5 Forward -350 -331 -1.08219 0.194
NP_442277.1_4 Reverse -50 -69 2.06362 0.256
NP_442033.1_10 Forward -190 -171 -6.09707 0.183
NP_442033.1_10 Reverse -274 -293 -8.35868 0.196
NP_442033.1_10 Forward -169 -150 -11.6036 0.255
NP_441543.1_2 Reverse -331 -340 18.486 0.00236
NP_441543.1_2 Forward -338 -329 15.9293 0.00518
NP_441543.1_2 Forward -61 -52 4.0313 0.293
NP_442845.1_2 Reverse -324 -338 9.34103 0.177
NP_442845.1_2 Reverse -330 -344 7.47274 0.195
NP_442845.1_2 Forward -36 -22 4.81781 0.251
NP_441551.1_5 Forward -343 -327 8.31764 0.238
NP_441319.1_8 Forward -345 -327 8.7706 0.231
NP_441469.1_8 Forward -340 -331 16.126 0.00797
NP_441469.1_8 Reverse -329 -338 6.5879 0.227
NP_443064.1_6 Forward -339 -329 10.8217 0.13
NP_442578.1_7 Forward -338 -331 14.5921 0.026
NP_442578.1_7 Reverse -331 -338 14.5921 0.026
NP_442578.1_7 Reverse -60 -67 9.97054 0.112
NP_441462.1_2 Forward -339 -329 20.2362 0.000805
NP_441462.1_2 Reverse -330 -340 11.5831 0.00406
NP_441621.1_7 Reverse -28 -42 5.50613 0.0807
NP_441621.1_7 Reverse -328 -342 -3.24533 0.188
NP_441621.1_7 Forward -341 -327 -5.60527 0.256
NP_443062.1_1 Forward -339 -321 13.2263 0.066
NP_443062.1_1 Reverse -330 -348 10.4961 0.116
NP_443062.1_6 Reverse -131 -150 6.39097 0.183
NP_441601.1_7 Reverse -22 -41 8.65258 0.269
NP_440939.1_5 Reverse -168 -184 10.9733 0.273
NP_442204.1_1 Forward -343 -332 9.69511 0.0736
NP_442204.1_1 Reverse -35 -46 0.845319 0.281
NP_442204.1_1 Reverse -326 -337 0.157002 0.283
NP_441560.1_10 Reverse -19 -38 6.58763 0.287
NP_440516.1_6 Reverse -276 -290 9.14375 0.238
NP_440516.1_8 Forward -339 -330 16.9127 0.00442
NP_440516.1_8 Reverse -330 -339 16.9127 0.00442
NP_442428.1_5 Forward -338 -331 15.8704 0.0124
NP_442428.1_5 Reverse -331 -338 15.8704 0.0124
NP_441790.1_3 Reverse -331 -350 2.0644 0.181
NP_442120.1_10 Reverse -21 -40 -7.67036 0.222
NP_440673.1_2 Forward -217 -198 7.75569 0.292
NP_440673.1_3 Forward -337 -330 12.4288 0.0426
NP_440673.1_3 Reverse -332 -339 12.4288 0.0426
NP_440865.1_9 Reverse -324 -343 7.96426 0.0657
NP_441052.1_2 Reverse -330 -340 10.5014 0.0285
NP_441052.1_2 Forward -339 -329 10.4031 0.0285
NP_441052.1_2 Forward -62 -52 4.50326 0.157
NP_442219.1_8 Forward -66 -47 10.5829 0.202
NP_442219.1_9 Reverse -331 -340 8.35786 0.0681
NP_442219.1_9 Forward -338 -329 8.25953 0.0681
NP_440436.1_4 Reverse -331 -340 18.1905 0.00233
NP_440436.1_4 Forward -338 -329 9.24241 0.0871
NP_441884.1_9 Reverse -327 -346 -22.5183 0.281
NP_440648.1_1 Reverse -330 -349 4.81767 0.219
NP_441719.1_4 Forward -338 -331 16.3621 0.0124
NP_441719.1_4 Reverse -331 -338 16.3621 0.0124
NP_441733.1_10 Reverse -327 -340 8.37742 0.14
NP_441004.1_1 Forward -291 -272 -9.63698 0.21
NP_441004.1_2 Forward -296 -277 -0.590531 0.259
NP_441004.1_2 Reverse -334 -353 -4.13045 0.288
NP_441004.1_5 Reverse -175 -189 9.73436 0.248
NP_442366.1_3 Reverse -329 -347 5.13236 0.0891
NP_442366.1_3 Forward -340 -322 2.47742 0.129
NP_442366.1_3 Reverse -103 -121 -4.60241 0.274
NP_440129.1_10 Forward -346 -332 6.58777 0.177
NP_442873.1_3 Forward -349 -330 8.65176 0.201
NP_442873.1_3 Reverse -301 -320 4.62021 0.262
NP_442873.1_9 Forward -318 -299 3.44025 0.289
NP_440296.1_10 Reverse -3 -22 -15.3402 0.294
NP_441115.1_4 Reverse -329 -347 7.58986 0.279
NP_442206.1_1 Forward -354 -335 -9.63698 0.219
NP_442206.1_10 Reverse -330 -345 4.69978 0.178
NP_443054.1_2 Forward -258 -244 4.81781 0.24
NP_443054.1_2 Forward -341 -327 3.24451 0.24
NP_443054.1_2 Reverse -328 -342 3.04785 0.24
NP_441851.1_10 Forward -340 -330 16.008 0.00552
NP_441851.1_10 Reverse -329 -339 8.53483 0.114
NP_442208.1_5 Forward -310 -291 -2.65548 0.252
NP_442622.1_8 Forward -339 -321 -19.2537 0.296
NP_441501.1_9 Forward -29 -10 16.4199 0.214
NP_442515.1_1 Forward -131 -117 -3.147 0.287
NP_442515.1_1 Reverse -262 -276 -3.34366 0.29
NP_440593.1_3 Reverse -297 -316 -6.98204 0.285
NP_440463.1_8 Forward -318 -299 13.115 0.199
NP_440463.1_8 Forward -31 -12 5.46683 0.279
NP_440165.1_5 Forward -340 -321 -7.27704 0.259
NP_441349.1_10 Reverse -320 -339 14.1591 0.0159
NP_441349.1_10 Forward -72 -53 -9.34199 0.289
NP_441409.1_6 Forward -345 -326 1.67108 0.0586
NP_441409.1_6 Reverse -324 -343 -14.5535 0.259
NP_440389.1_2 Reverse -77 -96 13.2741 0.262
NP_440432.1_9 Forward -338 -323 5.97809 0.0486
NP_442843.1_1 Reverse -288 -307 -6.88371 0.245
NP_442843.1_1 Forward -221 -202 -8.94866 0.264
NP_439960.1_10 Forward -318 -300 6.50899 0.138
NP_439960.1_10 Forward -355 -337 -0.7675 0.237
NP_440474.1_8 Forward -338 -324 11.602 0.103
NP_442450.1_5 Reverse -328 -338 9.41981 0.115
NP_442450.1_5 Forward -341 -331 9.32148 0.115
NP_440588.1_2 Reverse -321 -340 -1.86883 0.157
NP_442006.1_2 Reverse -336 -353 -17.7591 0.282
NP_442006.1_2 Reverse -12 -29 -19.0374 0.297
NP_441570.1_1 Forward -339 -321 10.4422 0.00901
NP_441570.1_1 Reverse -330 -348 -9.51896 0.139
NP_441078.1_4 Forward -339 -330 19.6659 0.0007
NP_441078.1_4 Reverse -330 -339 19.6659 0.0007
NP_442729.1_5 Forward -43 -33 14.0414 0.22
NP_442729.1_5 Reverse -335 -345 11.3864 0.235
NP_442729.1_8 Reverse -144 -157 9.06573 0.125
NP_442729.1_8 Forward -343 -330 8.08242 0.125
NP_442443.1_1 Forward -293 -274 -4.03212 0.268
NP_442443.1_1 Forward -38 -19 -4.22878 0.268
NP_442443.1_1 Reverse -163 -182 -5.70374 0.284
NP_441094.1_6 Forward -35 -18 14.6894 0.166
NP_441094.1_9 Forward -398 -379 16.7157 0.26
NP_440526.1_3 Forward -338 -327 1.82816 0.267
NP_441432.1_8 Reverse -329 -338 16.8143 0.00595
NP_441432.1_8 Forward -340 -331 8.25953 0.0755
NP_441432.1_8 Reverse -178 -187 2.55633 0.298
NP_441432.1_9 Forward -145 -132 11.604 0.221
NP_442320.1_8 Reverse -324 -338 13.2743 0.0144
NP_442320.1_8 Forward -345 -331 4.91614 0.0442
NP_442344.1_7 Reverse -331 -350 -5.9004 0.168
NP_441732.1_2 Forward -343 -327 -7.70961 0.0885
NP_441732.1_2 Reverse -326 -342 -16.4611 0.167
NP_441732.1_5 Forward -386 -372 13.1759 0.192
NP_442003.1_9 Reverse -331 -350 5.60432 0.235
NP_442815.1_2 Reverse -187 -205 2.0841 0.298
NP_440199.1_10 Reverse -327 -337 14.238 0.0861
NP_442353.1_4 Forward -314 -295 -0.492971 0.29
NP_442751.1_2 Forward -190 -171 4.52188 0.261
NP_442751.1_2 Forward -181 -162 2.6536 0.285
NP_441072.1_2 Reverse -175 -194 12.3892 0.173
NP_442489.1_7 Forward -339 -330 20.1576 0.000695
NP_442489.1_7 Reverse -330 -339 20.1576 0.000695
NP_441830.1_2 Reverse -171 -190 2.0644 0.224
NP_441706.1_7 Reverse -192 -211 20.1685 0.0859
NP_442079.1_7 Reverse -331 -350 1.86774 0.24
NP_440559.1_1 Reverse -331 -340 8.75118 0.0586
NP_440559.1_1 Forward -338 -329 8.65285 0.0586
NP_441659.2_8 Forward -339 -329 20.9245 0.000805
NP_441659.2_8 Reverse -330 -340 11.9764 0.0147
NP_441040.1_2 Reverse -328 -347 -15.3402 0.286
NP_442346.1_5 Reverse -329 -339 16.303 0.00248
NP_442346.1_5 Forward -340 -330 9.02648 0.118
NP_440545.1_3 Reverse -326 -343 4.3654 0.0717
NP_440545.1_3 Reverse -292 -309 -7.04099 0.295
NP_441856.1_3 Reverse -327 -346 6.88262 0.11
NP_441786.1_10 Reverse -321 -340 6.39097 0.284
NP_440486.1_6 Reverse -26 -45 10.8159 0.216
NP_440010.1_4 Forward -46 -27 5.40686 0.201
NP_442311.1_5 Forward -268 -249 -0.39387 0.292
NP_442603.1_7 Reverse -330 -344 11.602 0.114
NP_441888.1_7 Forward -344 -330 3.8345 0.225
NP_441502.1_9 Forward -135 -121 15.6543 0.289
NP_441833.1_4 Forward -338 -331 15.9687 0.0124
NP_441833.1_4 Reverse -331 -338 15.9687 0.0124
NP_441895.1_10 Forward -292 -273 -18.1918 0.282
NP_442162.1_9 Forward -338 -331 16.2637 0.0124
NP_442162.1_9 Reverse -331 -338 16.2637 0.0124
NP_442796.1_9 Forward -269 -250 16.4207 0.0856
NP_442055.1_6 Reverse -177 -196 15.0441 0.221
NP_440671.1_4 Reverse -324 -338 13.7659 0.0748
NP_440671.1_4 Forward -345 -331 12.4876 0.107
NP_440224.1_1 Reverse -319 -338 0.491109 0.133
NP_442140.1_3 Reverse -331 -341 8.33817 0.119
NP_440875.1_9 Reverse -3 -13 9.44274 0.233
NP_440875.1_9 Reverse -332 -342 9.05339 0.233
NP_440875.1_9 Forward -337 -327 7.59334 0.255
NP_441813.1_5 Forward -341 -331 17.188 0.00979
NP_441813.1_5 Reverse -328 -338 15.9097 0.01
NP_440590.1_4 Reverse -331 -344 4.8375 0.0585
NP_440590.1_4 Reverse -180 -193 0.60927 0.148
NP_440567.1_1 Reverse -331 -345 14.2576 0.0187
NP_440567.1_1 Forward -338 -324 6.09611 0.0894
NP_442497.1_10 Forward -338 -329 17.601 0.00813
NP_442497.1_10 Reverse -331 -340 10.4228 0.0087
NP_440821.1_4 Forward -341 -331 19.0562 0.00399
NP_440821.1_4 Reverse -328 -338 11.0914 0.0146
NP_441239.1_9 Reverse -328 -340 14.6903 0.0258
NP_441239.1_9 Forward -341 -329 13.3137 0.037
NP_441239.1_9 Forward -305 -293 2.98891 0.3
NP_441951.1_4 Reverse -330 -349 7.66927 0.268
NP_441009.1_4 Reverse -330 -349 14.5524 0.167
NP_440156.1_4 Forward -214 -204 16.4991 0.176
NP_440156.1_4 Reverse -277 -287 16.4008 0.176
NP_441892.1_1 Reverse -321 -338 -1.92778 0.215
NP_440665.1_1 Reverse -299 -318 -13.0786 0.256
NP_440665.1_1 Forward -320 -301 -16.3235 0.287
NP_440604.1_6 Reverse -330 -349 1.76941 0.152
NP_442044.1_9 Reverse -330 -349 1.37609 0.293
NP_442216.1_2 Reverse -58 -77 10.0292 0.0102
NP_442138.1_10 Forward -339 -320 -1.08219 0.169
NP_440546.1_4 Forward -339 -329 13.5365 0.0459
NP_440546.1_4 Reverse -330 -340 11.8882 0.0679
NP_440546.1_4 Reverse -39 -49 8.49468 0.186
NP_440546.1_6 Reverse -301 -320 9.43923 0.247
NP_441230.1_5 Reverse -325 -344 0.786102 0.261
NP_440462.1_6 Reverse -328 -338 16.893 0.00853
NP_440462.1_6 Forward -341 -331 15.418 0.0142
NP_442340.1_3 Forward -169 -150 7.27595 0.11
NP_442340.1_3 Forward -46 -27 -5.50708 0.223
NP_442611.1_1 Reverse -330 -349 8.25926 0.138
NP_440868.1_4 Forward -343 -331 8.6921 0.0582
NP_440868.1_4 Reverse -326 -338 5.93884 0.0879
NP_440868.1_4 Forward -309 -297 -0.354346 0.263
NP_441249.1_8 Reverse -165 -184 0.982764 0.284
NP_441474.1_1 Forward -20 -1 -1.18128 0.26
NP_442402.1_10 Reverse -280 -290 11.6809 0.241
NP_441084.1_6 Forward -389 -375 18.9429 0.0523
NP_442039.1_4 Forward -338 -331 15.1821 0.0124
NP_442039.1_4 Reverse -331 -338 15.1821 0.0124
NP_442039.1_7 Forward -160 -150 11.9764 0.257
NP_441811.1_1 Forward -354 -335 6.58763 0.28
NP_442625.1_4 Reverse -27 -46 23.3039 0.0051
NP_441926.1_3 Forward -339 -323 16.2831 0.0428
NP_442837.1_3 Forward -338 -331 15.7721 0.0124
NP_442837.1_3 Reverse -331 -338 15.7721 0.0124
NP_442837.1_3 Reverse -149 -156 6.43063 0.212
NP_442053.1_1 Forward -339 -330 18.3876 0.0007
NP_442053.1_1 Reverse -330 -339 18.3876 0.0007
NP_440505.1_3 Reverse -328 -338 15.123 0.014
NP_440505.1_3 Forward -341 -331 13.8447 0.0247
NP_441701.1_3 Reverse -3 -20 8.98696 0.247
NP_441102.1_1 Reverse -331 -350 3.44104 0.286
NP_441203.1_1 Reverse -331 -350 -19.8634 0.297
NP_441203.1_6 Forward -341 -322 10.1275 0.15
NP_441408.2_7 Reverse -4 -23 -5.31042 0.292
NP_442174.1_9 Reverse -328 -347 6.98095 0.28
NP_440914.1_1 Forward -339 -329 16.3248 0.00196
NP_440914.1_1 Reverse -330 -340 8.6151 0.186
NP_441011.1_8 Reverse -331 -340 16.9127 0.00602
NP_441011.1_8 Forward -338 -329 16.6177 0.00602
NP_442101.1_10 Forward -347 -328 7.7676 0.0444
NP_442101.1_10 Reverse -322 -341 5.01433 0.0543
NP_442533.1_1 Reverse -327 -346 -7.17871 0.188
NP_442533.1_1 Reverse -9 -28 -15.1435 0.252
NP_442533.1_6 Forward -339 -330 17.2076 0.00137
NP_442533.1_6 Reverse -330 -339 17.2076 0.00137
NP_442533.1_6 Forward -188 -179 4.62128 0.179
NP_442533.1_6 Forward -21 -12 2.65466 0.246
NP_442533.1_6 Forward -308 -299 1.67135 0.293
NP_442322.1_4 Reverse -216 -233 -9.59824 0.295
NP_441482.1_7 Forward -345 -331 0.589577 0.0554
NP_441482.1_7 Reverse -324 -338 -3.34366 0.118
NP_439944.1_9 Forward -338 -328 17.6796 0.00347
NP_439944.1_9 Reverse -331 -341 10.3048 0.0887
NP_439944.1_9 Reverse -109 -119 7.84651 0.127
NP_442269.1_10 Forward -41 -22 2.0644 0.28
NP_442202.1_10 Reverse -20 -34 3.93283 0.278
NP_440116.1_8 Reverse -331 -350 -9.14533 0.268
NP_441527.1_4 Forward -253 -234 -11.8892 0.284
NP_440007.1_9 Forward -343 -329 4.32615 0.267
NP_442728.1_7 Forward -256 -242 12.586 0.289
NP_441106.1_1 Reverse -329 -338 18.486 0.0028
NP_441106.1_1 Forward -340 -331 18.191 0.0028
NP_439903.1_6 Reverse -327 -346 4.62021 0.193
NP_441286.1_1 Reverse -329 -341 5.05386 0.0259
NP_441286.1_1 Forward -340 -328 4.8572 0.0272
NP_440670.1_8 Forward -339 -330 18.3876 0.000699
NP_440670.1_8 Reverse -330 -339 18.3876 0.000699
NP_440670.1_8 Forward -305 -296 3.24465 0.29
NP_440886.1_7 Forward -340 -330 17.7774 0.0011
NP_440886.1_7 Reverse -329 -339 8.04271 0.0805
NP_440886.1_7 Forward -22 -12 6.0761 0.147
NP_440886.1_7 Forward -189 -179 3.71617 0.267
NP_440828.1_1 Reverse -298 -317 -0.492971 0.27
NP_442717.1_2 Reverse -133 -152 -6.68705 0.282
NP_440767.1_2 Reverse -4 -23 2.0644 0.262
NP_442072.1_9 Reverse -329 -347 -13.3539 0.11
NP_441753.1_10 Reverse -321 -340 11.4058 0.123
NP_440907.2_8 Forward -338 -328 9.51767 0.103
NP_440907.2_8 Reverse -331 -341 7.84605 0.117
NP_441463.1_3 Reverse -320 -339 14.0608 0.0298
NP_441463.1_6 Reverse -328 -342 14.05 0.165
NP_441626.1_2 Forward -338 -331 15.7721 0.0124
NP_441626.1_2 Reverse -331 -338 15.7721 0.0124
NP_442211.1_3 Reverse -303 -322 7.472 0.281
NP_442794.1_1 Forward -343 -331 10.1671 0.0721
NP_441962.1_5 Reverse -28 -47 14.5524 0.124
NP_441796.1_8 Forward -172 -154 8.57394 0.297
NP_440387.1_1 Reverse -330 -346 13.9232 0.00763
NP_440387.1_1 Forward -339 -323 0.55019 0.124
NP_440855.1_1 Forward -320 -301 -1.08219 0.271
NP_441431.1_2 Forward -33 -19 6.48882 0.269
NP_441431.1_2 Forward -308 -294 6.39049 0.272
NP_441836.1_2 Reverse -293 -312 8.75091 0.101
NP_440634.1_8 Forward -45 -26 0.686995 0.285
NP_441993.1_1 Reverse -330 -349 1.36194 0.28
NP_441993.1_1 Reverse -372 -391 0.972113 0.288
NP_440114.1_10 Forward -339 -325 19.0758 0.00367
NP_441510.2_7 Forward -345 -331 10.1271 0.281
NP_441510.2_9 Reverse -60 -79 5.50599 0.264
NP_441272.1_8 Forward -256 -238 11.1305 0.296
NP_440766.1_4 Forward -343 -329 8.16106 0.0871
NP_440766.1_4 Reverse -326 -340 7.07942 0.097
NP_439988.1_7 Forward -306 -292 11.7003 0.292
NP_442743.1_5 Forward -47 -28 4.71934 0.213
NP_439910.1_2 Reverse -322 -339 -12.5475 0.0894
NP_439910.1_2 Forward -347 -330 -21.3973 0.183
NP_440457.1_1 Forward -343 -331 8.29878 0.101
NP_440457.1_1 Reverse -337 -349 2.30059 0.214
NP_440457.1_1 Reverse -326 -338 0.137309 0.25
NP_440798.1_6 Reverse -331 -344 3.85419 0.147
NP_442680.1_5 Reverse -124 -143 7.30132 0.198
NP_440142.1_3 Reverse -184 -203 13.1758 0.235
NP_442297.1_4 Forward -343 -324 13.5023 0.239
NP_440473.1_9 Reverse -319 -338 -8.26035 0.246
NP_442509.1_9 Reverse -330 -340 16.2041 0.00739
NP_442509.1_9 Forward -339 -329 8.04271 0.192
NP_440554.1_4 Forward -338 -328 16.1063 0.0189
NP_440554.1_4 Reverse -331 -341 14.6313 0.02
NP_440554.1_4 Forward -47 -37 5.48657 0.145
NP_441761.1_1 Forward -47 -28 4.916 0.252
NP_441885.1_1 Forward -262 -248 17.3242 0.282
NP_441885.1_5 Reverse -330 -340 11.4848 0.00668
NP_441885.1_5 Forward -339 -329 11.3864 0.00668
NP_442341.1_7 Reverse -329 -343 9.34103 0.0751
NP_442341.1_9 Forward -341 -327 11.9953 0.115
NP_442341.1_9 Reverse -328 -342 10.2254 0.136
NP_442395.2_4 Forward -340 -321 4.32522 0.184
NP_440423.1_6 Reverse -322 -341 -15.4385 0.229
NP_443000.1_7 Reverse -328 -338 17.4829 0.00719
NP_443000.1_7 Forward -341 -331 8.73149 0.0437
NP_440507.2_3 Reverse -321 -340 8.75009 0.244
NP_441842.1_10 Reverse -323 -337 9.83269 0.182
NP_441842.1_10 Forward -312 -298 8.94771 0.203
NP_440275.1_3 Reverse -328 -338 9.12481 0.055
NP_440275.1_3 Forward -341 -331 8.4365 0.0602
NP_440275.1_3 Forward -322 -312 5.87989 0.13
NP_440275.1_3 Forward -307 -297 4.60159 0.182
NP_440091.1_1 Reverse -326 -338 8.9871 0.0567
NP_440091.1_1 Forward -343 -331 1.41561 0.197
NP_442451.1_2 Reverse -303 -322 -7.96535 0.241
NP_442686.1_3 Forward -213 -194 18.0915 0.142
NP_439962.1_4 Reverse -303 -322 -6.58872 0.283
NP_440175.1_4 Reverse -342 -361 -14.1602 0.273
NP_440641.1_1 Reverse -302 -321 13.5691 0.0609
NP_440641.1_6 Forward -267 -248 8.35759 0.297
NP_442495.1_5 Reverse -22 -41 11.8975 0.23
NP_440149.1_8 Reverse -330 -349 0.58944 0.134
NP_440216.1_1 Reverse -330 -344 7.57108 0.00935
NP_440216.1_1 Forward -339 -325 5.99778 0.0166
NP_440216.1_9 Reverse -154 -163 10.1278 0.286
NP_440216.1_9 Forward -265 -256 8.45619 0.286
NP_440172.1_1 Forward -339 -329 17.5813 0.00421
NP_440172.1_1 Reverse -330 -340 8.73149 0.0586
NP_440172.1_1 Reverse -39 -49 2.92996 0.258
NP_441844.1_2 Reverse -23 -42 23.8939 0.0174
NP_442015.1_10 Forward -343 -330 19.1938 0.00444
NP_441226.1_7 Forward -338 -331 14.4934 0.0123
NP_441226.1_7 Reverse -331 -338 14.4934 0.0123
NP_441111.1_7 Forward -338 -330 18.7023 0.00294
NP_441111.1_7 Reverse -331 -339 18.7023 0.00294
NP_442379.1_10 Forward -346 -329 6.03703 0.12
NP_441766.1_2 Forward -339 -330 17.5026 0.00297
NP_441766.1_2 Reverse -330 -339 17.5026 0.00297
NP_442417.1_5 Reverse -330 -344 19.4691 0.0165
NP_442417.1_5 Forward -48 -34 6.78443 0.207
NP_440416.1_1 Forward -339 -320 13.6675 0.0275
NP_440416.1_9 Forward -346 -327 -4.52377 0.0776
NP_443052.1_8 Forward -349 -330 1.96607 0.0587
NP_443052.1_8 Reverse -320 -339 -7.57203 0.161
NP_440072.1_5 Reverse -180 -198 -2.63579 0.271
NP_442154.1_1 Forward -322 -304 -17.2871 0.251
NP_440261.1_5 Reverse -331 -344 -1.06236 0.0655
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGTGGAAGAACAAACCATGGTCAAACCCACTGATGTAACCGAGTCTCCCCTTGACCCCACGGCGATCGCCTTTTTACGGGACGACCTCTGTGGCGGCGACCTGACCCTATTCGGGGAAATGGTGGCGTGTTACTGCCAGGAAAGCCAAAAGCTCATAGAAGAATTAGTACAGGGCTTAGAGGTGGACGATTTTGCCGTGATCAGACGCACCGCCCATTCCCTCAAATCCAGCAGTGCTTCCCTGGGAGCCCAACAATTGTCCACTTTTTGTCAACAACTAGAAAAGAACGCTGGATCAGGTAACCTAGGATTAGGGTCTCCCCCTCAGTTGGTTGACCGCTGTCGACAATTACACATCGCCGTGGTGGAAGCCCTTGCGCCCTTCACCATTCCCTCGCC

CDS

ATGAATCTGCCTCAACCAATAGAAACCGCCGCCGCAAAAATTTTGGTGGTGGACGATGACGGTTTTATGAGGATGCAACTGCGGGTTTATTTGCAAAAGGAAGGACACCGGGTAGAACTGGCTACCAATGGGGAAGAAGCCCTAACCAAATTTGCCGAAATTAAACCAGAAGTGGTGCTACTGGATGCCGTGATGCCCGTCATGGATGGCTTTGCCTGTTGTCAGGCCCTGATGAAAATTTATCAAAATCCTTCCCCATTGGTATTAATGATCACAGGGCTAGATGATGAAGCCTCGGTGGATCGGGCCTTTGAAGCAGGGGCGATCGACTATGTGACCAAACCCATTCATTGGGCGGTGCTGCGGCAGAGGGTAAAACGTTTGCTCTATCAAAACCGCCTTCAACACCAATTGGAATCCGTCAACCAAATGTTGGAGCGCTTAGCTAAGGTGGATCAACTTACCCAGTTGGCCAACCGTCGTCAACTGGAGTTATTTCTCGACACGGAATGGTCCGAAGCAATCCGAGAACAGTATCCTTTTTCTATTCTGCTGTGTGACATAGATTATTTCAAAAACTATAACGACCATTATGGTCACCAGGGGGGCGACGACTGCTTACAACAGGTGGCTAAGGCTTTAACCAGGGTGGTGCACCGTCCTAAGGATTTGGCCGCTCGCTACGGTGGGGAAGAATTTTTGATTGTCCTACCCAACACAGACCTCCAAGGGGCCATCCACATCGGTGAAGACATCCAGGCGGAGATTACCCGTCTAGCTATTCCCCACGTCCAATCGGCGATCGCCGACCATGTCACCCTGAGCATTGGTTGTGCCAGCACCATTCCCCGCCTAGGCAGTGATTGGGGAAAGTTGGTGGGGGCAGCGGATCAATATTTGTATGAAGCTAAGGCCCAAGGGCGTAATCGTTTAGTCAGTGGTCGATGA

Protein

MNLPQPIETAAAKILVVDDDGFMRMQLRVYLQKEGHRVELATNGEEALTKFAEIKPEVVLLDAVMPVMDGFACCQALMKIYQNPSPLVLMITGLDDEASVDRAFEAGAIDYVTKPIHWAVLRQRVKRLLYQNRLQHQLESVNQMLERLAKVDQLTQLANRRQLELFLDTEWSEAIREQYPFSILLCDIDYFKNYNDHYGHQGGDDCLQQVAKALTRVVHRPKDLAARYGGEEFLIVLPNTDLQGAIHIGEDIQAEITRLAIPHVQSAIADHVTLSIGCASTIPRLGSDWGKLVGAADQYLYEAKAQGRNRLVSGR