Your browser is old and dusty. Try Google Chrome!

Details for slr1755

ORF slr1755
Accession NP_440373.1
Symbol
Category NAD+ dependent glycerol-3-phosphate dehydrogenase
Definition Fatty acid, phospholipid and sterol metabolism
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -215 -229 3.53951 0.163
NP_440795.1_7 Forward -222 -215 8.00392 0.218
NP_440795.1_7 Reverse -143 -150 7.51227 0.24
NP_441418.1_6 Reverse -290 -309 -21.3384 0.147
NP_442291.1_5 Forward -390 -374 -1.41643 0.199
NP_440897.1_6 Forward -299 -280 -4.62285 0.285
NP_441453.1_1 Forward -351 -333 2.77167 0.286
NP_441453.1_4 Forward -389 -381 6.80426 0.121
NP_441453.1_4 Reverse -380 -388 6.11594 0.121
NP_441453.1_7 Forward -228 -221 12.9205 0.23
NP_441623.1_1 Forward -162 -144 -3.81576 0.269
NP_442151.1_6 Reverse -214 -228 8.35772 0.175
NP_442182.1_3 Forward -20 -1 8.06259 0.259
NP_440226.1_1 Forward -389 -370 7.66927 0.102
NP_440226.1_1 Reverse -380 -399 3.6377 0.218
NP_441630.1_3 Reverse -372 -391 5.30933 0.143
NP_442287.1_3 Reverse -372 -389 13.5094 0.294
NP_442173.1_1 Reverse -381 -389 12.0158 0.0316
NP_442173.1_1 Forward -388 -380 4.83764 0.241
NP_442752.1_4 Forward -389 -382 13.8055 0.0199
NP_442752.1_4 Forward -223 -216 12.1338 0.0546
NP_443027.1_4 Reverse -140 -150 8.92815 0.181
NP_441812.1_3 Forward -329 -315 9.04604 0.245
NP_441812.1_3 Reverse -379 -393 8.55439 0.251
NP_442975.1_10 Forward -393 -379 3.04726 0.263
NP_440784.1_7 Forward -314 -307 6.43063 0.218
NP_440784.1_7 Forward -388 -381 6.23397 0.241
NP_440784.1_7 Reverse -381 -388 6.13563 0.241
NP_441054.1_2 Reverse -280 -299 10.1275 0.284
NP_442062.1_8 Forward -223 -213 4.40493 0.217
NP_441859.1_3 Reverse -379 -398 2.45694 0.258
NP_440044.1_8 Reverse -381 -400 0.58944 0.195
NP_441210.1_1 Forward -364 -345 7.66927 0.135
NP_441594.1_6 Forward -30 -11 4.12936 0.222
NP_441109.1_3 Forward -306 -287 9.63507 0.251
NP_441083.1_3 Reverse -17 -27 11.9759 0.296
NP_441083.1_5 Reverse -380 -390 8.82982 0.03
NP_441083.1_5 Forward -389 -379 8.04317 0.046
NP_441083.1_5 Reverse -214 -224 -1.10161 0.295
NP_441738.1_2 Reverse -382 -389 15.28 0.0102
NP_441645.1_1 Reverse -25 -44 8.75009 0.239
NP_440209.1_1 Forward -389 -381 8.57422 0.0425
NP_440209.1_1 Reverse -380 -388 5.52596 0.0821
NP_442889.1_8 Reverse -211 -225 7.86545 0.14
NP_440178.1_5 Reverse -386 -395 18.6826 0.137
NP_440659.1_9 Forward -398 -379 8.65258 0.291
NP_441327.1_5 Reverse -201 -210 12.7828 0.29
NP_441598.1_3 Forward -305 -286 11.8004 0.292
NP_440851.1_6 Forward -201 -184 -0.256152 0.291
NP_440906.1_5 Forward -388 -381 6.23397 0.234
NP_440906.1_5 Reverse -381 -388 6.13563 0.241
NP_440747.1_10 Reverse -377 -389 -2.81262 0.0713
NP_440747.1_10 Forward -226 -214 -4.48425 0.101
NP_441130.1_10 Reverse -378 -392 4.62115 0.275
NP_441486.1_1 Forward -392 -378 -4.4253 0.198
NP_442634.1_4 Reverse -288 -302 -5.21195 0.241
NP_440057.1_4 Forward -298 -279 17.5056 0.113
NP_441014.1_10 Forward -152 -133 -2.65624 0.283
NP_443018.1_3 Reverse -381 -388 11.7405 0.0655
NP_443018.1_3 Forward -388 -381 5.44732 0.193
NP_443018.1_3 Forward -222 -215 4.07068 0.299
NP_441634.1_8 Reverse -378 -392 -4.4253 0.295
NP_440376.1_1 Forward -389 -380 5.99792 0.111
NP_440376.1_1 Reverse -290 -299 4.52295 0.156
NP_440376.1_1 Forward -223 -214 3.93297 0.188
NP_440376.1_1 Reverse -380 -389 -0.196935 0.285
NP_442798.2_7 Reverse -288 -307 26.2538 0.00795
NP_441588.1_4 Reverse -382 -392 6.96153 0.178
NP_442730.1_8 Reverse -281 -300 3.63691 0.275
NP_442687.1_7 Forward -390 -380 4.50326 0.245
NP_440066.1_5 Forward -128 -109 8.65176 0.256
NP_442485.1_3 Forward -400 -381 -0.885524 0.254
NP_442485.1_3 Forward -310 -291 -2.0655 0.261
NP_442658.1_1 Reverse -70 -80 9.71433 0.147
NP_442658.1_1 Forward -391 -381 6.17443 0.235
NP_442198.1_3 Forward -196 -177 2.75272 0.297
NP_440656.1_8 Forward -400 -381 0.884433 0.124
NP_441414.1_9 Forward -389 -370 1.17943 0.0759
NP_442937.1_5 Reverse -291 -310 6.78429 0.27
NP_441958.1_5 Forward -390 -380 0.865012 0.12
NP_440373.1_4 Forward -310 -291 24.0905 0.0346
NP_440373.1_5 Forward -110 -96 20.3541 0.181
NP_440203.1_5 Reverse -217 -227 14.0409 0.103
NP_440203.1_5 Forward -325 -315 8.53436 0.294
NP_439990.1_5 Forward -228 -215 8.86907 0.158
NP_442911.1_2 Reverse -204 -223 -4.52377 0.136
NP_442911.1_2 Forward -399 -380 -9.83364 0.264
NP_442064.1_1 Forward -333 -314 -7.4737 0.241
NP_442064.1_4 Forward -37 -18 6.29183 0.254
NP_443055.1_6 Reverse -372 -390 7.49153 0.156
NP_441099.1_5 Reverse -370 -389 5.211 0.0469
NP_442002.1_9 Forward -390 -383 10.7572 0.185
NP_441000.1_5 Reverse -241 -260 3.04693 0.3
NP_441000.1_6 Reverse -379 -393 4.32615 0.0957
NP_441000.1_6 Forward -390 -376 -4.52363 0.245
NP_442771.1_1 Forward -43 -25 -11.0923 0.297
NP_440484.1_3 Reverse -22 -36 9.14437 0.27
NP_440147.1_4 Forward -391 -378 -0.0790467 0.271
NP_441550.1_8 Reverse -378 -388 10.501 0.066
NP_441550.1_8 Forward -391 -381 4.7978 0.283
NP_440206.1_4 Forward -303 -284 -1.18128 0.29
NP_441041.1_7 Forward -260 -248 6.73736 0.195
NP_441041.1_7 Forward -392 -380 6.34865 0.211
NP_440703.1_9 Forward -298 -285 10.4418 0.2
NP_441725.1_5 Forward -80 -70 2.83163 0.115
NP_441725.1_5 Reverse -381 -391 1.455 0.135
NP_441725.1_5 Forward -298 -288 -0.216628 0.241
NP_439966.1_7 Reverse -378 -388 15.0242 0.0177
NP_439966.1_7 Forward -391 -381 8.73102 0.13
NP_439966.1_9 Forward -391 -382 0.983037 0.253
NP_442941.1_3 Reverse -381 -391 1.65166 0.147
NP_442941.1_3 Forward -388 -378 0.0783647 0.231
NP_440289.1_2 Forward -392 -379 10.344 0.027
NP_440289.1_2 Reverse -377 -390 -4.30728 0.286
NP_442281.1_1 Reverse -375 -389 7.47213 0.0993
NP_442281.1_1 Forward -304 -290 2.06395 0.278
NP_442281.1_1 Forward -394 -380 1.86729 0.285
NP_442256.1_2 Reverse -378 -396 -0.0791831 0.136
NP_441644.1_6 Reverse -380 -390 7.15773 0.133
NP_441644.1_6 Reverse -290 -300 6.27276 0.163
NP_441644.1_6 Forward -389 -379 4.01116 0.253
NP_443049.1_6 Forward -390 -380 11.6409 0.24
NP_443049.1_6 Forward -224 -214 11.0554 0.282
NP_442215.1_2 Reverse -94 -110 -2.98973 0.207
NP_442215.1_2 Forward -317 -301 -5.54633 0.251
NP_442215.1_2 Reverse -212 -228 -5.64466 0.254
NP_442215.1_6 Forward -296 -278 19.6845 0.162
NP_442029.1_1 Reverse -294 -313 -2.26216 0.171
NP_440253.1_2 Reverse -380 -398 22.0453 0.00326
NP_440253.1_2 Forward -389 -371 -0.472507 0.212
NP_440929.1_8 Reverse -380 -389 7.07956 0.0713
NP_442933.1_6 Forward -334 -315 12.5568 0.287
NP_442933.1_10 Reverse -306 -315 8.75118 0.0688
NP_442554.1_8 Reverse -291 -301 5.28991 0.153
NP_442554.1_8 Reverse -215 -225 4.40493 0.188
NP_442554.1_8 Forward -388 -378 4.3066 0.189
NP_442554.1_8 Reverse -381 -391 4.0116 0.2
NP_442554.1_8 Forward -298 -288 3.22496 0.235
NP_441762.1_7 Forward -390 -378 -5.27089 0.195
NP_442142.1_4 Reverse -377 -390 8.86849 0.106
NP_442142.1_4 Forward -392 -379 2.96866 0.269
NP_442292.1_1 Reverse -215 -224 5.70292 0.135
NP_442292.1_1 Forward -388 -379 -0.0986038 0.239
NP_442292.1_1 Reverse -381 -390 -0.196935 0.239
NP_440895.1_6 Forward -229 -216 8.37742 0.276
NP_442381.1_8 Forward -392 -373 -3.54046 0.126
NP_441711.1_4 Reverse -371 -390 6.29264 0.154
NP_442301.1_2 Reverse -117 -136 6.58682 0.263
NP_441715.1_4 Reverse -381 -391 6.46988 0.143
NP_441198.1_8 Reverse -212 -222 10.3415 0.28
NP_440464.1_10 Reverse -215 -225 13.1991 0.169
NP_441468.1_1 Forward -222 -215 10.2655 0.0906
NP_441468.1_1 Forward -388 -381 6.13563 0.209
NP_441468.1_1 Reverse -381 -388 6.0373 0.223
NP_441673.1_1 Forward -389 -380 1.37636 0.114
NP_441673.1_1 Reverse -380 -389 1.1797 0.163
NP_441826.1_5 Forward -26 -7 1.0811 0.297
NP_441330.1_8 Reverse -233 -252 17.994 0.0927
NP_442811.1_2 Reverse -294 -313 -1.96717 0.276
NP_442490.1_9 Forward -33 -14 -6.29373 0.273
NP_442868.1_6 Reverse -378 -388 9.12481 0.0539
NP_442361.1_3 Forward -395 -382 7.88576 0.285
NP_442427.1_3 Reverse -224 -242 0.117479 0.275
NP_442808.1_1 Reverse -379 -389 9.616 0.0481
NP_442542.1_2 Forward -391 -378 7.29578 0.187
NP_442050.1_5 Reverse -378 -388 11.1893 0.105
NP_440558.1_2 Reverse -99 -118 -2.85214 0.231
NP_440558.1_2 Reverse -286 -305 -5.9004 0.267
NP_440558.1_2 Forward -115 -96 -6.58872 0.277
NP_442593.1_9 Reverse -144 -163 16.6593 0.257
NP_441518.1_3 Forward -399 -380 -13.2752 0.264
NP_441518.1_3 Reverse -370 -389 -13.4719 0.264
NP_441878.1_6 Reverse -289 -299 11.2881 0.0176
NP_441878.1_6 Forward -300 -290 1.06167 0.116
NP_441878.1_6 Reverse -305 -315 0.865012 0.132
NP_441878.1_6 Reverse -213 -223 -0.41329 0.177
NP_441036.1_8 Forward -390 -380 6.8632 0.213
NP_441557.1_5 Forward -389 -380 1.08137 0.0794
NP_441557.1_5 Reverse -380 -389 0.589713 0.134
NP_441445.1_1 Forward -398 -379 7.37428 0.135
NP_441445.1_1 Reverse -297 -316 3.24438 0.218
NP_442066.2_4 Reverse -299 -318 -7.86702 0.289
NP_441433.1_8 Forward -111 -92 -0.197208 0.244
NP_441914.1_10 Forward -78 -59 18.1898 0.0539
NP_441308.1_8 Forward -391 -381 8.4365 0.254
NP_441116.1_6 Forward -259 -240 8.55425 0.285
NP_442170.1_5 Forward -389 -370 1.76941 0.192
NP_442347.1_2 Reverse -381 -390 8.94785 0.0718
NP_442347.1_2 Reverse -215 -224 5.89959 0.21
NP_442645.1_2 Reverse -347 -366 -8.85033 0.133
NP_441633.1_3 Reverse -378 -391 -6.56889 0.259
NP_440136.1_2 Forward -388 -381 6.23397 0.171
NP_440136.1_2 Reverse -381 -388 6.13563 0.193
NP_440136.1_2 Forward -222 -215 4.26735 0.218
NP_442590.1_10 Reverse -283 -302 7.66927 0.221
NP_442998.1_10 Reverse -382 -389 15.5754 0.0102
NP_440899.1_1 Forward -310 -291 5.96765 0.291
NP_440899.1_2 Forward -310 -291 18.4848 0.0452
NP_441799.1_1 Reverse -376 -390 6.88214 0.158
NP_442334.1_10 Forward -27 -8 -16.5201 0.234
NP_442299.1_8 Reverse -211 -225 18.0925 0.289
NP_442333.2_5 Forward -310 -291 -15.1435 0.289
NP_440256.1_1 Reverse -377 -396 1.96607 0.0697
NP_441090.1_2 Reverse -109 -128 13.3725 0.0791
NP_441559.1_8 Reverse -102 -116 -6.58858 0.279
NP_440915.1_6 Forward -227 -213 -1.27871 0.229
NP_442158.1_4 Forward -209 -199 12.5664 0.245
NP_440748.1_5 Reverse -346 -365 -0.000545616 0.252
NP_442957.1_8 Reverse -287 -306 9.83255 0.287
NP_442386.1_9 Reverse -379 -388 11.9957 0.0754
NP_442386.1_9 Forward -224 -215 10.2257 0.136
NP_442386.1_9 Forward -390 -381 5.9975 0.23
NP_440570.1_5 Reverse -280 -299 1.37609 0.239
NP_440570.1_5 Forward -233 -214 -1.18052 0.266
NP_440570.1_5 Forward -297 -278 -1.37718 0.272
NP_441340.1_5 Forward -388 -381 13.5105 0.0314
NP_441340.1_5 Reverse -381 -388 5.84064 0.208
NP_441340.1_9 Reverse -201 -211 8.15881 0.256
NP_443028.1_4 Reverse -317 -336 8.34704 0.293
NP_442791.1_5 Reverse -298 -317 -10.3253 0.279
NP_440168.1_9 Reverse -288 -307 1.0811 0.251
NP_440211.1_4 Forward -201 -191 13.8447 0.29
NP_440586.1_8 Reverse -381 -388 9.47853 0.146
NP_440586.1_8 Forward -363 -356 8.88855 0.205
NP_440586.1_8 Forward -307 -300 7.02027 0.279
NP_440586.1_8 Forward -388 -381 5.74197 0.283
NP_441262.1_3 Forward -389 -382 14.7888 0.0223
NP_443051.1_1 Forward -390 -381 7.47288 0.0571
NP_440372.1_2 Forward -388 -381 13.8055 0.0214
NP_440372.1_2 Reverse -381 -388 6.52896 0.188
NP_441789.1_7 Reverse -98 -117 -0.984623 0.251
NP_440316.1_10 Forward -390 -380 11.1898 0.214
NP_440139.1_1 Forward -395 -376 0.981987 0.275
NP_442384.1_10 Forward -299 -286 3.36254 0.193
NP_442384.1_10 Reverse -122 -135 1.69091 0.249
NP_441018.1_7 Reverse -292 -311 9.93088 0.218
NP_442262.1_10 Reverse -381 -388 13.2155 0.0213
NP_441689.1_5 Forward -391 -381 5.97777 0.197
NP_440163.1_10 Forward -392 -382 15.2213 0.0762
NP_440344.1_10 Forward -396 -379 -0.747806 0.0454
NP_440282.1_10 Forward -309 -290 2.0644 0.165
NP_440531.1_6 Reverse -298 -317 4.32602 0.127
NP_440531.1_6 Forward -307 -288 -0.4922 0.214
NP_441965.1_10 Reverse -287 -303 4.58176 0.237
NP_442556.1_10 Forward -195 -176 8.06688 0.299
NP_440297.1_9 Forward -298 -288 15.9097 0.0917
NP_440297.1_9 Forward -222 -212 -0.118297 0.282
NP_440297.1_9 Reverse -291 -301 -0.314959 0.282
NP_440297.1_9 Reverse -381 -391 -0.511621 0.289
NP_440888.1_2 Reverse -380 -394 10.6187 0.0893
NP_440888.1_4 Reverse -296 -310 14.5838 0.279
NP_442077.1_9 Forward -219 -200 -4.91709 0.24
NP_441543.1_2 Reverse -381 -390 8.65285 0.0968
NP_441543.1_2 Reverse -215 -224 5.01461 0.209
NP_442845.1_2 Forward -229 -215 12.9793 0.1
NP_441918.1_7 Forward -53 -34 -0.787193 0.297
NP_441469.1_8 Reverse -213 -222 12.2911 0.117
NP_441469.1_8 Forward -390 -381 6.39124 0.227
NP_442578.1_7 Forward -388 -381 6.0373 0.18
NP_440710.1_1 Forward -307 -289 -7.25734 0.237
NP_440220.1_4 Reverse -184 -203 9.24175 0.16
NP_441462.1_2 Forward -389 -379 7.55152 0.0543
NP_443062.1_1 Reverse -380 -398 11.1786 0.103
NP_443062.1_1 Reverse -214 -232 8.35091 0.155
NP_443062.1_1 Forward -389 -371 3.96308 0.279
NP_442204.1_1 Forward -227 -216 0.550326 0.281
NP_442204.1_6 Reverse -290 -309 8.94757 0.224
NP_440516.1_6 Reverse -290 -304 8.94708 0.246
NP_440516.1_8 Forward -389 -380 18.9776 0.00442
NP_440516.1_8 Reverse -380 -389 5.01461 0.118
NP_441785.1_1 Forward -151 -137 13.1262 0.231
NP_442428.1_5 Forward -388 -381 6.13563 0.209
NP_442428.1_5 Reverse -381 -388 6.0373 0.212
NP_442428.1_5 Forward -222 -215 4.66067 0.244
NP_442859.1_2 Reverse -286 -305 4.71934 0.212
NP_441867.1_2 Forward -30 -11 -20.0601 0.291
NP_440673.1_3 Reverse -382 -389 12.4288 0.0426
NP_440673.1_3 Reverse -357 -364 10.9539 0.106
NP_440077.1_7 Reverse -305 -324 13.0775 0.268
NP_441052.1_2 Reverse -214 -224 6.46988 0.088
NP_441052.1_2 Reverse -380 -390 1.25834 0.249
NP_441052.1_2 Forward -389 -379 0.668351 0.256
NP_442219.1_9 Forward -388 -379 8.65285 0.0681
NP_442219.1_9 Reverse -215 -224 5.01461 0.193
NP_442219.1_9 Forward -150 -141 2.458 0.27
NP_440436.1_4 Reverse -215 -224 11.3073 0.0574
NP_440436.1_4 Reverse -381 -390 8.55409 0.0997
NP_441884.1_9 Forward -392 -373 -23.2067 0.284
NP_441893.1_8 Reverse -297 -316 20.059 0.117
NP_440314.1_9 Reverse -33 -52 -7.08038 0.237
NP_440041.1_2 Reverse -288 -307 0.491109 0.187
NP_441719.1_4 Forward -388 -381 6.82395 0.0855
NP_441719.1_4 Reverse -381 -388 6.52896 0.188
NP_441004.1_4 Reverse -69 -79 9.22315 0.259
NP_442366.1_3 Reverse -213 -231 7.09898 0.0766
NP_442366.1_3 Forward -113 -95 -1.65248 0.216
NP_440129.1_10 Forward -396 -382 13.2743 0.0557
NP_440129.1_10 Reverse -337 -351 1.86788 0.293
NP_442854.1_6 Reverse -278 -297 1.37609 0.279
NP_443054.1_2 Reverse -378 -392 -0.295402 0.293
NP_441851.1_10 Forward -224 -214 12.8614 0.0416
NP_441851.1_10 Reverse -213 -223 4.20827 0.282
NP_441501.1_9 Reverse -10 -29 15.4366 0.214
NP_442856.1_5 Reverse -97 -116 18.3164 0.201
NP_442515.1_1 Forward -224 -210 -4.03198 0.298
NP_441396.1_1 Forward -140 -121 0.0977854 0.27
NP_441396.1_5 Reverse -300 -309 8.35786 0.224
NP_440593.1_3 Reverse -13 -32 -2.16383 0.223
NP_441661.1_3 Forward -367 -350 -4.97604 0.251
NP_440432.1_9 Forward -388 -373 -3.56002 0.183
NP_442843.1_1 Forward -32 -13 -9.93197 0.272
NP_442843.1_1 Reverse -291 -310 -11.1119 0.286
NP_442944.1_9 Reverse -9 -28 18.1907 0.228
NP_440474.1_8 Reverse -381 -395 5.21053 0.254
NP_442450.1_5 Reverse -353 -363 12.3697 0.115
NP_442006.1_2 Reverse -306 -323 -17.1691 0.27
NP_441003.1_9 Reverse -380 -399 9.93088 0.213
NP_441003.1_9 Forward -308 -289 8.45592 0.224
NP_442243.1_1 Forward -251 -233 -2.24319 0.288
NP_441570.1_1 Forward -389 -371 0.0191479 0.0424
NP_441570.1_1 Forward -238 -220 -10.4039 0.17
NP_441570.1_1 Reverse -290 -308 -17.6804 0.287
NP_440078.1_10 Reverse -214 -233 11.8975 0.162
NP_441078.1_4 Forward -389 -380 0.196389 0.205
NP_441078.1_4 Reverse -380 -389 -0.000272808 0.205
NP_441078.1_4 Forward -299 -290 -1.37691 0.254
NP_441078.1_4 Reverse -290 -299 -1.47524 0.266
NP_441078.1_4 Reverse -214 -223 -2.06522 0.295
NP_441078.1_4 Forward -223 -214 -2.06522 0.295
NP_440539.1_9 Forward -297 -278 -6.09707 0.286
NP_442348.1_2 Reverse -289 -298 9.4395 0.28
NP_441091.1_5 Forward -309 -290 10.5209 0.176
NP_440526.1_3 Reverse -215 -226 7.62965 0.139
NP_441432.1_5 Reverse -2 -16 8.84938 0.271
NP_441432.1_8 Forward -390 -381 5.50626 0.151
NP_441432.1_8 Forward -224 -215 4.32629 0.223
NP_442320.1_8 Forward -395 -381 3.14618 0.0674
NP_442815.1_2 Forward -116 -98 5.03403 0.237
NP_440760.1_1 Reverse -214 -233 -18.9784 0.218
NP_440199.1_10 Forward -392 -382 14.533 0.0861
NP_441945.1_10 Reverse -289 -308 10.9142 0.238
NP_442353.1_4 Forward -20 -1 -0.591301 0.29
NP_442510.1_5 Reverse -281 -300 12.9791 0.248
NP_439935.1_1 Forward -184 -165 7.57094 0.25
NP_442489.1_7 Forward -389 -380 0.688044 0.152
NP_442489.1_7 Reverse -380 -389 0.688044 0.152
NP_442489.1_7 Forward -299 -290 -1.37691 0.195
NP_442489.1_7 Reverse -290 -299 -1.47524 0.203
NP_442489.1_7 Forward -223 -214 -1.57357 0.213
NP_440941.1_1 Forward -382 -372 15.418 0.278
NP_440565.1_7 Forward -205 -186 -0.4922 0.27
NP_440559.1_1 Forward -388 -379 6.48957 0.134
NP_442913.1_7 Forward -186 -170 16.5774 0.279
NP_442346.1_5 Reverse -289 -299 6.46988 0.201
NP_442346.1_5 Forward -300 -290 4.99491 0.267
NP_442346.1_5 Forward -224 -214 4.99491 0.267
NP_440025.1_1 Reverse -376 -395 15.3391 0.147
NP_440459.1_2 Reverse -55 -72 7.31533 0.296
NP_440010.1_10 Reverse -110 -129 2.55606 0.276
NP_441948.1_4 Forward -396 -378 -5.19239 0.256
NP_441833.1_4 Reverse -381 -388 6.52896 0.0924
NP_441833.1_4 Forward -388 -381 6.23397 0.163
NP_442162.1_9 Forward -388 -381 12.9205 0.0282
NP_442162.1_9 Reverse -381 -388 12.9205 0.0282
NP_440671.1_4 Forward -395 -381 8.16106 0.202
NP_442140.1_3 Reverse -381 -391 6.27322 0.176
NP_442140.1_3 Forward -222 -212 3.81494 0.278
NP_440875.1_9 Reverse -382 -392 8.37203 0.233
NP_441813.1_5 Reverse -378 -388 15.0247 0.0147
NP_441813.1_5 Forward -391 -381 7.45319 0.0746
NP_440590.1_4 Forward -388 -375 -5.97891 0.296
NP_442497.1_10 Reverse -381 -390 0.589713 0.153
NP_440821.1_4 Forward -391 -381 9.32148 0.03
NP_441239.1_9 Forward -301 -289 6.33216 0.193
NP_441239.1_9 Reverse -378 -390 6.23383 0.197
NP_441892.1_1 Forward -308 -291 -2.61609 0.224
NP_440796.1_3 Forward -396 -378 12.4081 0.204
NP_442105.1_9 Forward -308 -294 16.5845 0.263
NP_441017.1_6 Forward -31 -17 13.9619 0.164
NP_442138.1_10 Forward -389 -370 -7.17871 0.286
NP_440546.1_4 Forward -389 -379 12.1791 0.0679
NP_440546.1_4 Reverse -380 -390 6.55553 0.291
NP_440462.1_6 Forward -391 -381 5.87989 0.135
NP_440462.1_6 Reverse -378 -388 5.68323 0.145
NP_440868.1_4 Forward -393 -381 5.93884 0.0879
NP_440868.1_4 Reverse -376 -388 -0.256015 0.255
NP_440868.1_4 Reverse -295 -307 -0.846001 0.282
NP_440696.1_6 Reverse -278 -297 3.6377 0.288
NP_442923.1_4 Reverse -290 -309 3.14605 0.134
NP_442039.1_4 Forward -388 -381 11.6422 0.0747
NP_441926.1_3 Forward -389 -373 3.00846 0.247
NP_440825.1_6 Forward -258 -239 6.78429 0.3
NP_442837.1_3 Forward -388 -381 6.0373 0.25
NP_442837.1_3 Reverse -381 -388 6.0373 0.25
NP_442053.1_1 Reverse -380 -389 14.4544 0.0114
NP_442053.1_1 Forward -389 -380 7.86621 0.0863
NP_440505.1_3 Forward -391 -381 12.2714 0.0543
NP_441584.1_1 Forward -361 -342 10.8159 0.119
NP_440914.1_1 Forward -389 -379 12.1284 0.0654
NP_441011.1_8 Reverse -381 -390 7.07956 0.179
NP_442533.1_6 Forward -299 -290 7.27622 0.0928
NP_442533.1_6 Reverse -290 -299 7.17789 0.0948
NP_442533.1_6 Reverse -214 -223 6.98123 0.0992
NP_442533.1_6 Reverse -380 -389 4.42462 0.179
NP_442533.1_6 Forward -315 -306 2.55633 0.25
NP_442533.1_6 Forward -116 -107 2.35967 0.259
NP_442533.1_6 Forward -298 -289 1.37636 0.3
NP_442541.1_10 Reverse -102 -116 1.86729 0.273
NP_443016.1_1 Forward -229 -210 -8.16202 0.291
NP_442351.1_1 Forward -284 -265 18.0924 0.0542
NP_441527.1_4 Reverse -316 -335 -0.525629 0.146
NP_442492.1_2 Forward -389 -370 7.17762 0.169
NP_441170.1_4 Forward -125 -107 4.14905 0.253
NP_441972.1_5 Forward -310 -291 -6.49039 0.231
NP_441106.1_1 Forward -390 -381 8.45619 0.0548
NP_439903.1_6 Reverse -287 -306 -0.886293 0.287
NP_441186.1_3 Forward -309 -290 16.8132 0.182
NP_441286.1_1 Reverse -379 -391 -4.58258 0.165
NP_441286.1_1 Forward -390 -378 -7.04085 0.3
NP_440670.1_8 Forward -389 -380 8.75118 0.0606
NP_440670.1_8 Reverse -380 -389 6.19458 0.124
NP_440886.1_7 Forward -390 -380 6.86274 0.113
NP_440886.1_7 Reverse -379 -389 6.66608 0.115
NP_442213.1_5 Reverse -295 -314 -0.787193 0.293
NP_442800.1_7 Reverse -294 -313 2.85105 0.279
NP_441753.1_10 Forward -398 -379 2.55606 0.232
NP_440907.2_8 Reverse -381 -391 6.0761 0.179
NP_440841.1_4 Reverse -70 -89 -6.88371 0.215
NP_441463.1_3 Reverse -370 -389 -10.1286 0.289
NP_441463.1_6 Forward -301 -287 5.35296 0.291
NP_442056.1_3 Forward -71 -52 9.93088 0.288
NP_441626.1_2 Forward -388 -381 12.2322 0.0511
NP_441626.1_2 Reverse -381 -388 5.93897 0.231
NP_442794.1_1 Forward -227 -215 10.4621 0.0721
NP_441962.1_4 Reverse -122 -141 -6.78538 0.181
NP_441431.1_2 Forward -115 -101 11.602 0.136
NP_441836.1_2 Forward -39 -20 4.916 0.132
NP_441993.1_1 Reverse -296 -315 3.89583 0.227
NP_440358.1_8 Forward -218 -199 2.94938 0.231
NP_440114.1_10 Reverse -380 -394 11.111 0.125
NP_440114.1_10 Forward -389 -375 7.57108 0.231
NP_440114.1_10 Forward -223 -209 7.07942 0.246
NP_440114.1_10 Reverse -72 -86 5.89945 0.292
NP_441510.2_7 Forward -395 -381 16.4202 0.238
NP_440293.1_3 Reverse -288 -307 -4.91709 0.268
NP_440632.1_7 Forward -295 -276 3.24438 0.284
NP_440766.1_4 Forward -393 -379 2.94952 0.163
NP_440766.1_5 Forward -218 -206 9.47014 0.275
NP_441237.1_9 Forward -80 -70 9.7148 0.272
NP_440457.1_1 Forward -393 -381 2.30059 0.214
NP_441436.1_8 Forward -117 -98 7.7676 0.293
NP_440473.1_1 Forward -302 -283 13.282 0.196
NP_440473.1_9 Reverse -369 -388 -12.5869 0.3
NP_442509.1_9 Reverse -380 -390 9.71433 0.192
NP_441489.1_3 Forward -220 -206 8.98786 0.232
NP_440554.1_4 Reverse -381 -391 11.6814 0.0377
NP_442737.1_7 Forward -131 -112 16.3224 0.256
NP_441885.1_5 Forward -389 -379 9.51814 0.0206
NP_441885.1_5 Reverse -214 -224 -0.41329 0.197
NP_442341.1_9 Forward -391 -377 6.39049 0.228
NP_440423.1_6 Forward -397 -378 5.80098 0.059
NP_443000.1_7 Reverse -378 -388 1.06167 0.274
NP_441842.1_10 Forward -396 -382 15.0442 0.0474
NP_440275.1_3 Forward -391 -381 5.87989 0.13
NP_440091.1_1 Forward -393 -381 8.59377 0.0631
NP_441307.1_4 Reverse -297 -316 4.12936 0.214
NP_440679.1_10 Reverse -292 -311 -14.3569 0.23
NP_443010.1_10 Forward -392 -375 10.6948 0.119
NP_442451.1_2 Reverse -307 -326 -11.2103 0.287
NP_441105.1_3 Forward -234 -215 -9.14533 0.284
NP_442373.1_2 Reverse -303 -322 -10.6203 0.288
NP_440216.1_1 Reverse -380 -394 -5.80194 0.136
NP_440216.1_1 Forward -389 -375 -11.5051 0.192
NP_440216.1_9 Reverse -199 -208 6.39124 0.289
NP_440172.1_1 Forward -389 -379 6.27322 0.107
NP_441718.1_4 Forward -84 -65 11.7 0.299
NP_442015.1_10 Forward -227 -214 5.32916 0.145
NP_441226.1_7 Forward -388 -381 12.7234 0.0312
NP_441226.1_7 Reverse -381 -388 11.5435 0.0757
NP_441226.1_7 Reverse -215 -222 11.2485 0.0971
NP_441111.1_7 Reverse -381 -389 8.86921 0.0589
NP_440244.1_1 Reverse -161 -180 -7.86702 0.287
NP_441766.1_2 Reverse -380 -389 14.7494 0.00772
NP_442252.1_3 Forward -396 -378 17.3254 0.0602
NP_440416.1_1 Forward -389 -370 -4.91709 0.135
NP_443052.1_8 Forward -399 -380 -12.7836 0.263
NP_442154.1_1 Reverse -304 -322 -17.8771 0.272
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGAGTCAAAACGGCGATCGGGAGTTTGTGGTATGTCAGCGATGAAGCTACCTTTGCTCTGATGACTAGTTTTTATGATCGACTTCAGCCAGCACCCATCAAGGCCAAGGCCCTACAGCAGGCCCAACTAAGTCTGCTCAGAGGAGAAATTCGGGTTGTGGACGGTAATCTAGTCCTTGGGGATGGCACAAATATTTCCTTGGCGGATTTACCGGCTGATATTCGACAACGCTTAGCAACCCAAGATTTAAGTCATCCCTATTTTTGGAGTGGCTTCACCCTAGTGGGCAGCCCTTGGTAACGAGAAAGTAATTTAATCAAGCCATTGTGCCAATTCAGTTCACTTGTTGACCATAATGGGGCTTTCTTACTATGGCTAGGGTCACTGGAGGGACCAATCC

CDS

GTGGTCATAATGGAGGCGAAGTCAAATTACCCAAAAACCATGTCCTTTGCTAATGCCGATACTCCCCCCCAAGTCGTTGTGTTGGGGGCCGGAGCCTGGGGCTCTAGTCTTGCCTACGTGCTGAATAACAATGACATTCCTACCCAAGTTTGGTCTCGCCGATCGCCGCAGAGCCTAGAATCCATGGTGGCTGGAGCGGATGTAATTGTCTCGGCGGTTTCCATTAAGGGGGTACCATCGGTGGCGGCCCGGTTGGAGGCCATGGACCTCCAGCGGCGGACTATTTTGGTGACGGCCACTAAGGGTTTAGATCCAGAAACCATGACTACCCCTTCCCAAATTTGGCAAGCTGCCCTTCCTTCCCAGCCGATCGCCGTTTTGTCGGGGCCGAATTTATCGAAGGAAATTGACCAGGGTTTACCGGCGGCCACGGTGGTGGCCAGTAGCGACCAAGCCGCAGCGGAGGAAATTCAAACCATTTTTGCCGCGGATAACTTCCGGGTTTACACCAACAATGATCCCTTGGGTACGGAATTGGGTGGCACCCTGAAAAACGTCATGGCGATCGCCGTGGGAGTATGCGAAGGGTTGGGGCTAGGCACCAATGCTAAATCAGCGTTAATTACCAGAGCTTTACCAGAAATTACCAGGGTGGGGTTACATTTTGGGGCCCAACCGGATACCTTTTGGGGTTTAGCCGGACTAGGAGATTTATTGGCCACCTGCTCTAGCATGCTCAGCCGCAATTATCGAGTGGGTTATGGTTTATCCAAAGGTCAGTCCTTAGAAGAAATTTTGGCCAACCTGGGGGGCACCGCCGAAGGGGTCAACACCACCGACGTACTAATCAAAATTGCCAATCGAGAAAAAATTGCTGTGCCCATCACCCGGCAGGTTTACCGTTTGCTCCATGGAAAAATTACCCCTCCCCAGGCAGTGGAAGCATTAATGGAAAGGGAATTGAAAGCGGAATTTGAAGATTTTGATCTTTAA

Protein

MVIMEAKSNYPKTMSFANADTPPQVVVLGAGAWGSSLAYVLNNNDIPTQVWSRRSPQSLESMVAGADVIVSAVSIKGVPSVAARLEAMDLQRRTILVTATKGLDPETMTTPSQIWQAALPSQPIAVLSGPNLSKEIDQGLPAATVVASSDQAAAEEIQTIFAADNFRVYTNNDPLGTELGGTLKNVMAIAVGVCEGLGLGTNAKSALITRALPEITRVGLHFGAQPDTFWGLAGLGDLLATCSSMLSRNYRVGYGLSKGQSLEEILANLGGTAEGVNTTDVLIKIANREKIAVPITRQVYRLLHGKITPPQAVEALMERELKAEFEDFDL