Your browser is old and dusty. Try Google Chrome!

Details for slr1747

ORF slr1747
Accession NP_441106.1
Symbol
Category Cell killing
Definition cell death suppressor protein Lls1 homolog
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -137 -123 12.8809 0.0441
NP_441061.1_2 Reverse -130 -144 7.66941 0.1
NP_440557.1_1 Reverse -34 -53 1.0811 0.265
NP_440557.1_1 Reverse -130 -149 -1.18052 0.27
NP_440795.1_7 Forward -137 -130 14.6904 0.0123
NP_440795.1_7 Reverse -130 -137 14.6904 0.0123
NP_441418.1_6 Reverse -129 -148 -9.93197 0.0301
NP_441418.1_6 Forward -138 -119 -20.3551 0.111
NP_442291.1_5 Forward -139 -123 17.6598 0.0165
NP_442291.1_5 Reverse -128 -144 2.12349 0.133
NP_441453.1_4 Reverse -129 -137 16.539 0.00633
NP_441453.1_4 Forward -138 -130 16.539 0.00633
NP_441453.1_4 Reverse -169 -177 3.95266 0.275
NP_441818.1_1 Forward -137 -126 10.1862 0.232
NP_441818.1_1 Reverse -130 -141 9.69459 0.232
NP_440226.1_1 Reverse -129 -148 6.09597 0.137
NP_440226.1_1 Forward -138 -119 5.99764 0.139
NP_442173.1_1 Forward -137 -129 15.4574 0.00633
NP_442173.1_1 Reverse -130 -138 15.4574 0.00633
NP_442752.1_4 Forward -138 -131 13.8055 0.0199
NP_442752.1_4 Reverse -129 -136 13.8055 0.0199
NP_442752.1_4 Forward -108 -101 4.36568 0.273
NP_443027.1_4 Forward -140 -130 14.828 0.0437
NP_443027.1_4 Reverse -127 -137 14.0414 0.0452
NP_441812.1_3 Reverse -128 -142 17.3058 0.0613
NP_442975.1_10 Forward -142 -128 13.7653 0.0459
NP_442975.1_10 Reverse -95 -109 9.04542 0.0794
NP_442975.1_10 Reverse -369 -383 2.26061 0.28
NP_440784.1_7 Forward -137 -130 15.9687 0.0123
NP_440784.1_7 Reverse -130 -137 15.9687 0.0123
NP_442909.1_7 Forward -137 -123 9.24208 0.156
NP_440061.1_9 Forward -362 -348 13.5686 0.079
NP_440061.1_9 Forward -336 -322 10.422 0.124
NP_440061.1_9 Forward -140 -126 9.43874 0.145
NP_440061.1_9 Forward -303 -289 6.98048 0.223
NP_440110.1_8 Forward -290 -271 -3.44213 0.297
NP_442062.1_3 Reverse -53 -72 -3.14714 0.274
NP_442062.1_8 Reverse -129 -139 19.4496 0.000558
NP_442062.1_8 Forward -138 -128 17.3846 0.00193
NP_441859.1_3 Forward -139 -120 4.22689 0.228
NP_441043.1_1 Reverse -229 -248 17.5015 0.285
NP_440304.1_4 Forward -140 -130 10.8948 0.051
NP_440304.1_4 Reverse -127 -137 10.8948 0.051
NP_442242.1_4 Forward -137 -130 14.3954 0.0124
NP_442242.1_4 Reverse -130 -137 14.3954 0.0124
NP_441935.1_1 Reverse -293 -312 6.58763 0.27
NP_441208.1_9 Reverse -126 -140 5.80112 0.262
NP_441594.1_6 Reverse -348 -367 9.93088 0.134
NP_441594.1_6 Forward -341 -322 1.96607 0.259
NP_442110.1_7 Forward -138 -124 0.88457 0.245
NP_442110.1_7 Reverse -99 -113 0.491246 0.259
NP_441082.1_10 Reverse -222 -235 8.86907 0.258
NP_440769.1_8 Forward -281 -262 7.37428 0.272
NP_440856.1_4 Forward -317 -298 -1.08219 0.191
NP_440856.1_7 Forward -291 -272 1.47442 0.161
NP_440856.1_7 Reverse -126 -145 -5.50708 0.228
NP_441083.1_5 Forward -138 -128 20.3345 0.00053
NP_441083.1_5 Reverse -129 -139 11.3864 0.0159
NP_439957.1_9 Forward -158 -139 2.53011 0.3
NP_441434.1_6 Reverse -259 -269 17.5813 0.243
NP_441434.1_7 Reverse -131 -145 5.99778 0.225
NP_441738.1_2 Forward -136 -129 15.28 0.0102
NP_441738.1_2 Reverse -131 -138 15.28 0.0102
NP_441558.1_5 Forward -362 -343 6.4893 0.214
NP_440209.1_1 Reverse -129 -137 18.1123 0.00295
NP_440209.1_1 Forward -138 -130 18.1123 0.00295
NP_440209.1_1 Forward -108 -100 5.42762 0.105
NP_442136.1_1 Forward -71 -52 7.07928 0.265
NP_442889.1_8 Forward -141 -127 20.9434 0.00339
NP_442889.1_8 Reverse -103 -117 16.3219 0.0289
NP_441783.1_2 Reverse -101 -110 16.6177 0.154
NP_440178.1_7 Forward -109 -90 -22.8133 0.279
NP_441025.1_6 Reverse -54 -73 9.67211 0.15
NP_441716.1_1 Forward -138 -124 19.8624 0.00865
NP_441716.1_1 Forward -360 -346 5.80112 0.216
NP_441624.1_7 Forward -237 -223 6.6861 0.275
NP_440906.1_5 Forward -137 -130 15.8704 0.0124
NP_440906.1_5 Reverse -130 -137 15.8704 0.0124
NP_440438.2_8 Forward -70 -51 13.5691 0.0579
NP_440747.1_10 Reverse -126 -138 17.2469 0.000522
NP_440747.1_10 Forward -141 -129 -2.02597 0.0196
NP_441130.1_10 Reverse -127 -141 8.65272 0.133
NP_442973.1_5 Forward -147 -128 10.9142 0.259
NP_441486.1_1 Forward -141 -127 19.9608 0.00312
NP_441486.1_1 Reverse -126 -140 10.9143 0.018
NP_442850.1_8 Forward -178 -159 16.7939 0.243
NP_442634.1_4 Forward -140 -126 -1.5737 0.149
NP_442634.1_4 Forward -110 -96 -3.63866 0.161
NP_440403.1_4 Forward -147 -128 10.7175 0.068
NP_440403.1_10 Reverse -120 -139 1.17943 0.291
NP_440842.1_4 Forward -70 -51 3.15929 0.207
NP_443017.1_1 Forward -69 -50 17.2885 0.177
NP_441014.1_10 Reverse -128 -147 21.6314 0.0349
NP_442848.1_1 Forward -144 -130 6.48943 0.0791
NP_442848.1_1 Reverse -123 -137 6.29277 0.0791
NP_443018.1_3 Forward -137 -130 14.8871 0.0123
NP_443018.1_3 Reverse -130 -137 14.8871 0.0123
NP_443018.1_3 Forward -177 -170 10.6589 0.0967
NP_443018.1_3 Reverse -170 -177 4.16902 0.278
NP_441316.1_7 Forward -140 -125 -3.16669 0.273
NP_441634.1_8 Reverse -127 -141 11.8976 0.0529
NP_441634.1_8 Forward -340 -326 -2.45868 0.295
NP_441634.1_8 Reverse -318 -332 -3.93365 0.295
NP_440376.1_1 Forward -138 -129 19.4693 0.000692
NP_440376.1_1 Reverse -129 -138 19.4693 0.000692
NP_440376.1_1 Reverse -323 -332 3.63797 0.2
NP_440376.1_1 Reverse -27 -36 2.94966 0.213
NP_441588.1_4 Reverse -131 -141 6.96153 0.178
NP_442687.1_7 Forward -139 -129 15.8113 0.0125
NP_442687.1_7 Reverse -128 -138 8.92815 0.0994
NP_442946.1_7 Reverse -379 -394 15.2145 0.284
NP_441846.1_10 Reverse -340 -359 -23.1083 0.277
NP_442530.1_2 Forward -274 -264 11.6814 0.282
NP_441422.1_7 Forward -140 -123 -3.79607 0.235
NP_442658.1_1 Forward -140 -130 15.9091 0.00966
NP_442658.1_1 Reverse -127 -137 6.76441 0.214
NP_442782.1_2 Forward -42 -28 9.2427 0.198
NP_442782.1_2 Reverse -223 -237 2.06454 0.278
NP_442782.1_7 Reverse -121 -140 4.71934 0.193
NP_442496.1_4 Reverse -281 -295 19.2734 0.27
NP_440656.1_8 Forward -149 -130 -6.58872 0.245
NP_442544.1_6 Reverse -122 -141 -6.78538 0.298
NP_441414.1_9 Forward -138 -119 -0.4922 0.0917
NP_441487.1_6 Reverse -121 -140 0.982764 0.254
NP_441256.1_1 Forward -141 -122 -4.91709 0.233
NP_441958.1_5 Forward -139 -129 12.2714 0.00183
NP_441958.1_5 Reverse -128 -138 12.2714 0.00183
NP_441958.1_5 Forward -109 -99 0.963343 0.12
NP_440203.1_5 Forward -135 -125 12.0743 0.166
NP_440203.1_5 Forward -357 -347 9.02601 0.275
NP_440984.1_7 Reverse -318 -332 4.52282 0.299
NP_442376.1_2 Forward -183 -164 -12.5869 0.286
NP_442911.1_2 Reverse -119 -138 13.0775 0.0118
NP_441580.1_6 Forward -149 -130 -7.37537 0.241
NP_440153.1_5 Forward -137 -123 5.80112 0.191
NP_441129.1_3 Reverse -288 -307 -8.16202 0.184
NP_442002.1_9 Reverse -235 -242 11.1505 0.185
NP_442002.1_9 Forward -139 -132 10.7572 0.185
NP_441294.1_7 Forward -142 -128 9.4426 0.244
NP_441424.1_2 Reverse -53 -72 12.1748 0.186
NP_441646.1_1 Reverse -122 -141 -1.7705 0.294
NP_442438.1_10 Reverse -124 -138 11.7993 0.0436
NP_442438.1_10 Forward -143 -129 1.67122 0.19
NP_442438.1_10 Reverse -28 -42 0.88457 0.213
NP_442438.1_10 Reverse -346 -360 -0.688726 0.274
NP_442438.1_10 Forward -113 -99 -0.983719 0.287
NP_441000.1_6 Reverse -128 -142 -3.44199 0.221
NP_441000.1_6 Forward -139 -125 -5.01529 0.257
NP_442771.1_1 Forward -140 -122 -7.25734 0.17
NP_440147.1_4 Forward -140 -127 3.36254 0.188
NP_440147.1_4 Reverse -127 -140 0.805932 0.244
NP_441550.1_8 Reverse -127 -137 12.3692 0.0336
NP_441550.1_8 Reverse -167 -177 8.92768 0.112
NP_441550.1_8 Forward -140 -130 6.0761 0.214
NP_441916.1_7 Reverse -129 -139 18.4663 0.00144
NP_441916.1_7 Forward -138 -128 10.3048 0.0261
NP_441916.1_7 Reverse -99 -109 8.63316 0.0437
NP_440206.1_9 Reverse -107 -126 6.98095 0.294
NP_441041.1_4 Forward -108 -89 -8.45701 0.203
NP_441041.1_7 Forward -141 -129 10.916 0.0864
NP_442396.1_5 Reverse -125 -138 8.08242 0.164
NP_442396.1_5 Forward -142 -129 6.90245 0.215
NP_442004.1_6 Forward -138 -124 8.06273 0.149
NP_441725.1_5 Forward -137 -127 11.2881 0.0247
NP_441725.1_5 Reverse -130 -140 11.2881 0.0247
NP_439966.1_7 Forward -140 -130 18.4657 0.00473
NP_439966.1_7 Reverse -127 -137 15.8108 0.0124
NP_439966.1_9 Forward -140 -131 0.983037 0.253
NP_440202.1_8 Forward -146 -127 9.80632 0.297
NP_442941.1_3 Forward -137 -127 19.9412 0.00262
NP_442941.1_3 Reverse -130 -140 11.4848 0.0116
NP_440289.1_2 Forward -141 -128 21.3571 0.00262
NP_440289.1_2 Reverse -126 -139 -2.93064 0.262
NP_440260.1_8 Forward -195 -177 -6.86402 0.295
NP_441514.1_6 Reverse -254 -261 12.7238 0.29
NP_442281.1_1 Forward -143 -129 19.7634 0.00247
NP_442281.1_1 Reverse -124 -138 9.6354 0.0684
NP_001035871.2_7 Reverse -224 -234 13.8447 0.219
NP_440437.1_1 Reverse -123 -142 1.27776 0.153
NP_441644.1_6 Forward -138 -128 17.3841 0.00127
NP_441644.1_6 Reverse -129 -139 10.1076 0.0628
NP_443049.1_2 Forward -44 -25 15.5357 0.11
NP_441071.1_3 Reverse -99 -118 5.40686 0.276
NP_442215.1_2 Forward -140 -124 1.63183 0.13
NP_442215.1_2 Forward -240 -224 -1.12144 0.179
NP_442215.1_2 Reverse -127 -143 -5.05468 0.244
NP_442215.1_2 Reverse -31 -47 -6.62797 0.277
NP_442215.1_2 Reverse -120 -136 -7.61128 0.3
NP_440253.1_2 Reverse -129 -147 6.70565 0.0778
NP_440929.1_8 Forward -138 -129 19.2726 0.000701
NP_440929.1_8 Reverse -129 -138 19.2726 0.000701
NP_440929.1_8 Reverse -106 -115 3.53964 0.225
NP_441346.1_4 Reverse -168 -187 15.1424 0.223
NP_442933.1_10 Forward -138 -129 17.601 0.00325
NP_442933.1_10 Reverse -129 -138 17.601 0.00325
NP_442933.1_10 Forward -108 -99 4.81794 0.212
NP_441751.2_8 Forward -137 -123 27.1389 0.00296
NP_441751.2_8 Reverse -130 -144 4.62115 0.0481
NP_441751.2_8 Reverse -100 -114 -4.22864 0.166
NP_442554.1_8 Forward -137 -127 15.9097 0.00747
NP_442554.1_8 Reverse -130 -140 13.8447 0.0145
NP_441762.1_7 Reverse -128 -140 2.89058 0.0676
NP_441762.1_7 Forward -139 -127 2.30059 0.0676
NP_441762.1_7 Reverse -168 -180 -6.84419 0.284
NP_442142.1_4 Reverse -126 -139 18.0132 0.0255
NP_442142.1_4 Forward -141 -128 15.85 0.0264
NP_442292.1_1 Forward -137 -128 18.486 0.00229
NP_442292.1_1 Reverse -130 -139 9.63616 0.0183
NP_440919.1_1 Reverse -345 -364 -3.24547 0.221
NP_440039.1_9 Forward -149 -130 12.1925 0.284
NP_442476.1_6 Reverse -130 -144 2.06454 0.195
NP_443009.1_5 Reverse -128 -139 18.3477 0.00265
NP_442406.1_3 Forward -69 -50 20.5134 0.0316
NP_441715.1_4 Reverse -130 -140 16.303 0.0117
NP_441715.1_4 Forward -137 -127 14.828 0.0268
NP_441448.1_1 Forward -281 -262 8.84924 0.199
NP_441468.1_1 Forward -137 -130 15.8704 0.0124
NP_441468.1_1 Reverse -130 -137 15.8704 0.0124
NP_441468.1_1 Forward -177 -170 3.97235 0.277
NP_441020.2_6 Reverse -127 -144 14.6902 0.0501
NP_441673.1_1 Forward -138 -129 20.8459 0.000698
NP_441673.1_1 Reverse -129 -138 20.8459 0.000698
NP_441876.1_9 Forward -240 -230 13.4509 0.267
NP_441876.1_9 Forward -286 -276 12.5659 0.267
NP_441826.1_2 Reverse -123 -137 20.3541 0.00755
NP_441826.1_2 Forward -144 -130 8.75105 0.0691
NP_441826.1_2 Forward -48 -34 2.94952 0.117
NP_441826.1_2 Forward -114 -100 -4.22864 0.293
NP_441764.1_4 Reverse -51 -68 17.239 0.0671
NP_442868.1_6 Reverse -127 -137 9.91146 0.038
NP_442868.1_6 Forward -140 -130 0.963343 0.205
NP_441612.1_2 Forward -138 -128 8.54929 0.21
NP_440789.1_1 Forward -70 -51 18.2882 0.0732
NP_442808.1_1 Forward -139 -129 18.4657 0.00201
NP_442808.1_1 Reverse -128 -138 8.63269 0.0481
NP_442808.1_1 Forward -237 -227 3.22451 0.247
NP_440145.1_3 Reverse -159 -178 -1.86883 0.156
NP_440145.1_3 Forward -397 -378 -6.09707 0.288
NP_442542.1_2 Forward -140 -127 11.4257 0.114
NP_442050.1_5 Reverse -127 -137 16.4991 0.00812
NP_442050.1_5 Forward -140 -130 9.12434 0.193
NP_441114.1_3 Forward -131 -122 6.5879 0.262
NP_440558.1_2 Reverse -120 -139 6.4893 0.136
NP_440558.1_2 Reverse -326 -345 0.0977854 0.194
NP_440558.1_2 Reverse -348 -367 -6.49039 0.275
NP_440923.1_1 Forward -71 -53 16.3413 0.0836
NP_441518.1_3 Forward -148 -129 -6.1954 0.132
NP_441518.1_3 Forward -370 -351 -15.8318 0.299
NP_441878.1_4 Forward -374 -355 4.81767 0.271
NP_441878.1_6 Forward -139 -129 10.4031 0.0176
NP_441878.1_6 Reverse -128 -138 10.4031 0.0176
NP_441878.1_6 Reverse -350 -360 -7.49312 0.231
NP_441036.1_8 Forward -139 -129 17.7779 0.000554
NP_441036.1_8 Reverse -128 -138 8.33817 0.174
NP_441557.1_5 Forward -138 -129 19.9609 0.000699
NP_441557.1_5 Reverse -129 -138 19.9609 0.000699
NP_441557.1_5 Forward -108 -99 -0.590259 0.219
NP_441445.1_1 Reverse -120 -139 12.4875 0.068
NP_441445.1_1 Forward -147 -128 -0.000545616 0.283
NP_441590.1_4 Reverse -165 -184 2.16195 0.297
NP_442066.2_4 Reverse -99 -118 -0.983855 0.182
NP_442066.2_9 Forward -142 -129 9.36073 0.175
NP_442066.2_9 Forward -316 -303 7.00078 0.253
NP_441739.1_2 Forward -245 -229 13.6275 0.108
NP_441739.1_2 Reverse -303 -319 9.69426 0.174
NP_441308.1_8 Forward -140 -130 10.1081 0.22
NP_441458.1_10 Forward -147 -128 11.0125 0.119
NP_442183.1_1 Reverse -129 -143 22.714 0.00203
NP_442183.1_1 Forward -138 -124 8.75105 0.109
NP_442183.1_1 Forward -310 -296 5.1128 0.231
NP_440276.1_8 Forward -188 -169 12.3892 0.198
NP_441549.1_9 Forward -142 -124 -4.50408 0.198
NP_441238.1_10 Reverse -225 -239 10.6193 0.292
NP_442347.1_2 Forward -137 -128 12.4878 0.056
NP_442347.1_2 Reverse -130 -139 11.1111 0.056
NP_442645.1_2 Reverse -121 -140 -7.4737 0.108
NP_442645.1_2 Reverse -349 -368 -11.2103 0.144
NP_442645.1_2 Forward -176 -157 -18.0934 0.269
NP_442965.1_2 Forward -396 -377 7.07928 0.159
NP_442965.1_2 Reverse -160 -179 -8.752 0.294
NP_441037.1_4 Forward -140 -130 7.02532 0.237
NP_441037.1_4 Forward -110 -100 6.05075 0.283
NP_441633.1_3 Reverse -127 -140 1.29759 0.109
NP_441633.1_3 Forward -140 -127 -3.81562 0.177
NP_440136.1_2 Forward -137 -130 15.9687 0.0123
NP_440136.1_2 Reverse -130 -137 15.9687 0.0123
NP_441728.2_4 Reverse -49 -68 13.2252 0.25
NP_442998.1_5 Reverse -234 -244 16.2046 0.149
NP_442998.1_5 Reverse -280 -290 12.1731 0.176
NP_442998.1_5 Forward -274 -264 9.91146 0.232
NP_442998.1_10 Forward -136 -129 15.5754 0.0102
NP_442998.1_10 Reverse -131 -138 15.5754 0.0102
NP_442998.1_10 Reverse -101 -108 6.0373 0.205
NP_440899.1_2 Forward -149 -130 9.53674 0.176
NP_440299.1_1 Reverse -125 -138 18.6032 0.00369
NP_440299.1_1 Forward -142 -129 2.18201 0.294
NP_441799.1_1 Reverse -125 -139 15.7319 0.0167
NP_441799.1_1 Forward -142 -128 11.012 0.0629
NP_441007.1_10 Forward -113 -100 9.2624 0.104
NP_441007.1_10 Forward -143 -130 2.96921 0.183
NP_441007.1_10 Reverse -124 -137 -0.767364 0.293
NP_441449.1_10 Forward -184 -166 11.5239 0.295
NP_442333.2_5 Reverse -29 -48 -10.9153 0.246
NP_440256.1_1 Reverse -126 -145 17.699 0.00518
NP_440456.1_8 Reverse -248 -262 13.8643 0.264
NP_440915.1_2 Reverse -225 -244 17.699 0.107
NP_440915.1_6 Reverse -165 -179 6.98109 0.0772
NP_440915.1_6 Reverse -125 -139 1.08123 0.147
NP_440915.1_6 Forward -142 -128 -3.24533 0.292
NP_442993.1_1 Reverse -129 -145 0.0585348 0.0668
NP_442993.1_1 Forward -108 -92 -8.69292 0.173
NP_442993.1_1 Reverse -351 -367 -10.6595 0.224
NP_442993.1_1 Forward -297 -281 -13.5111 0.292
NP_442386.1_9 Forward -139 -130 15.7322 0.0144
NP_442386.1_9 Reverse -128 -137 13.8639 0.0289
NP_442386.1_9 Reverse -158 -167 8.65242 0.188
NP_442386.1_9 Forward -237 -228 7.57079 0.219
NP_442386.1_9 Forward -302 -293 7.07914 0.219
NP_440570.1_5 Reverse -165 -184 -3.54046 0.29
NP_441750.1_1 Forward -396 -377 -6.58872 0.24
NP_441340.1_5 Forward -137 -130 15.6737 0.0124
NP_441340.1_5 Reverse -130 -137 15.6737 0.0124
NP_441340.1_5 Reverse -170 -177 11.3472 0.0526
NP_441947.1_4 Forward -149 -130 20.649 0.0238
NP_441947.1_10 Forward -140 -122 -0.0791831 0.276
NP_440161.1_3 Reverse -127 -146 12.4875 0.177
NP_440586.1_8 Forward -137 -130 13.2151 0.026
NP_440586.1_8 Reverse -130 -137 13.2151 0.026
NP_440586.1_8 Forward -177 -170 5.74197 0.283
NP_442251.1_6 Forward -137 -130 15.2804 0.0124
NP_442251.1_6 Reverse -130 -137 15.2804 0.0124
NP_440192.1_5 Forward -43 -24 6.58763 0.224
NP_440684.1_9 Reverse -123 -137 13.6676 0.155
NP_440684.1_9 Forward -144 -130 9.83269 0.216
NP_441262.1_3 Reverse -129 -136 14.7888 0.0223
NP_441262.1_3 Forward -138 -131 14.7888 0.0223
NP_441262.1_3 Forward -108 -101 5.34899 0.181
NP_440027.1_3 Forward -148 -130 12.3097 0.159
NP_440027.1_8 Forward -141 -122 9.14342 0.243
NP_443051.1_1 Reverse -128 -137 10.4228 0.00754
NP_443051.1_1 Forward -139 -130 10.4228 0.00754
NP_443051.1_1 Forward -109 -100 0.491382 0.151
NP_439937.1_9 Forward -313 -296 -10.4832 0.229
NP_439937.1_9 Reverse -300 -317 -16.383 0.287
NP_439937.1_9 Forward -139 -122 -16.5797 0.287
NP_441167.1_1 Reverse -50 -69 12.9791 0.109
NP_441167.1_6 Forward -319 -300 17.4032 0.158
NP_441740.2_10 Forward -37 -18 9.93088 0.286
NP_440408.1_7 Reverse -27 -46 9.14423 0.264
NP_440439.1_1 Reverse -126 -139 7.29578 0.0664
NP_440439.1_1 Forward -141 -128 1.19926 0.159
NP_439943.1_2 Reverse -169 -188 9.53756 0.276
NP_440372.1_2 Forward -137 -130 16.3621 0.0124
NP_440372.1_2 Reverse -130 -137 16.3621 0.0124
NP_441789.1_7 Forward -343 -324 3.53858 0.196
NP_441933.1_1 Forward -179 -160 18.4857 0.195
NP_441803.1_2 Reverse -318 -337 4.52268 0.177
NP_440139.1_1 Reverse -123 -142 5.01354 0.168
NP_440139.1_1 Forward -144 -125 2.26028 0.235
NP_440139.1_1 Reverse -27 -46 0.392004 0.292
NP_441572.1_7 Forward -144 -125 0.392778 0.168
NP_440267.1_2 Reverse -124 -138 8.3571 0.166
NP_440267.1_2 Forward -270 -256 7.66879 0.194
NP_442384.1_10 Forward -138 -125 16.4406 0.00838
NP_442384.1_10 Reverse -129 -142 6.50913 0.0995
NP_440364.1_6 Forward -139 -126 14.375 0.275
NP_442790.1_4 Reverse -120 -139 -8.94866 0.176
NP_442262.1_10 Forward -137 -130 14.1988 0.0123
NP_442262.1_10 Reverse -130 -137 14.1988 0.0123
NP_442262.1_10 Forward -177 -170 12.0355 0.062
NP_441689.1_5 Reverse -127 -137 15.3192 0.0403
NP_441689.1_5 Forward -140 -130 8.53436 0.132
NP_440163.1_10 Forward -141 -131 15.2213 0.0762
NP_440163.1_10 Reverse -126 -136 12.4681 0.159
NP_440344.1_10 Forward -145 -128 9.47861 0.00838
NP_440344.1_10 Reverse -122 -139 -9.49926 0.147
NP_440282.1_3 Reverse -158 -177 -4.72043 0.298
NP_440531.1_6 Forward -146 -127 8.35759 0.0859
NP_440189.1_2 Reverse -322 -341 -0.688862 0.292
NP_440562.1_10 Forward -188 -170 5.42735 0.289
NP_441965.1_10 Forward -141 -125 9.10498 0.123
NP_440297.1_9 Forward -137 -127 9.32148 0.0917
NP_440297.1_9 Reverse -130 -140 9.32148 0.0917
NP_440297.1_9 Forward -386 -376 -0.511621 0.289
NP_440350.1_1 Reverse -263 -282 -4.22878 0.24
NP_440350.1_5 Forward -200 -181 -6.78538 0.297
NP_440700.1_6 Forward -326 -308 22.9303 0.0171
NP_440937.1_5 Reverse -132 -151 10.5209 0.275
NP_442078.1_3 Forward -235 -216 -0.591301 0.274
NP_442067.1_4 Forward -149 -130 2.55606 0.294
NP_440999.1_9 Forward -142 -128 11.111 0.0474
NP_440888.1_2 Forward -138 -124 15.0436 0.013
NP_440888.1_2 Reverse -129 -143 13.5686 0.027
NP_440888.1_2 Forward -360 -346 8.45543 0.16
NP_440888.1_2 Reverse -99 -113 5.1122 0.293
NP_440600.1_4 Forward -146 -128 -7.35568 0.291
NP_442277.1_4 Forward -117 -98 11.0117 0.0854
NP_441543.1_2 Reverse -130 -139 18.486 0.00236
NP_441543.1_2 Forward -137 -128 16.9127 0.00359
NP_441543.1_2 Reverse -34 -43 8.55452 0.0988
NP_442845.1_2 Reverse -123 -137 15.7325 0.0694
NP_442845.1_2 Forward -138 -124 5.21113 0.24
NP_441551.1_5 Reverse -125 -141 6.2527 0.275
NP_441918.1_7 Forward -361 -342 -2.65548 0.297
NP_441469.1_8 Forward -139 -130 16.126 0.00797
NP_441469.1_8 Reverse -372 -381 10.9145 0.191
NP_441469.1_8 Reverse -128 -137 6.48957 0.227
NP_443064.1_6 Forward -138 -128 12.5669 0.0796
NP_442337.1_8 Forward -265 -246 -1.18052 0.28
NP_442578.1_7 Forward -137 -130 14.5921 0.026
NP_442578.1_7 Reverse -130 -137 14.5921 0.026
NP_440710.1_1 Reverse -19 -37 10.7372 0.067
NP_440710.1_1 Forward -146 -128 -4.20908 0.208
NP_441462.1_2 Forward -138 -128 11.5831 0.00406
NP_441462.1_2 Reverse -129 -139 11.5831 0.00406
NP_441462.1_2 Forward -108 -98 0.373358 0.154
NP_441462.1_2 Reverse -99 -109 -0.708283 0.245
NP_441621.1_7 Forward -140 -126 -3.24533 0.188
NP_441929.1_4 Reverse -92 -111 6.09517 0.222
NP_443062.1_1 Forward -138 -120 14.5914 0.0454
NP_443062.1_1 Forward -178 -160 6.01073 0.211
NP_443062.1_1 Forward -108 -90 5.91323 0.215
NP_443062.1_6 Reverse -121 -140 15.4374 0.0746
NP_443062.1_6 Forward -146 -127 2.75272 0.25
NP_441410.1_3 Reverse -120 -139 6.19431 0.23
NP_442204.1_1 Reverse -125 -136 -0.0396598 0.285
NP_442780.1_1 Reverse -55 -74 15.9291 0.115
NP_440516.1_8 Forward -138 -129 16.9127 0.00442
NP_440516.1_8 Reverse -129 -138 16.9127 0.00442
NP_440516.1_8 Reverse -169 -178 -0.590259 0.283
NP_442428.1_5 Forward -137 -130 15.8704 0.0124
NP_442428.1_5 Reverse -130 -137 15.8704 0.0124
NP_442428.1_5 Forward -177 -170 4.36568 0.271
NP_441443.1_1 Reverse -233 -252 -3.14714 0.282
NP_442120.1_10 Forward -366 -347 -11.7019 0.264
NP_440673.1_2 Forward -148 -129 12.8284 0.134
NP_440673.1_3 Forward -136 -129 12.4288 0.0426
NP_440673.1_3 Reverse -131 -138 12.4288 0.0426
NP_440673.1_3 Forward -358 -351 8.98723 0.203
NP_441714.1_9 Forward -236 -217 18.1898 0.0792
NP_441052.1_2 Forward -138 -128 19.9412 0.00106
NP_441052.1_2 Reverse -129 -139 10.5014 0.0285
NP_441052.1_2 Reverse -351 -361 4.0116 0.168
NP_441052.1_2 Forward -132 -122 2.83163 0.19
NP_442219.1_8 Reverse -347 -366 6.62097 0.292
NP_442219.1_9 Forward -137 -128 17.7976 0.00718
NP_442219.1_9 Reverse -130 -139 8.35786 0.0681
NP_440436.1_4 Reverse -130 -139 18.1905 0.00233
NP_440436.1_4 Forward -137 -128 17.2072 0.00233
NP_441884.1_9 Forward -141 -122 -24.19 0.284
NP_442705.1_1 Reverse -170 -189 11.2092 0.262
NP_441719.1_4 Forward -137 -130 16.3621 0.0124
NP_441719.1_4 Reverse -130 -137 16.3621 0.0124
NP_441733.1_10 Reverse -126 -139 7.49244 0.153
NP_441004.1_1 Forward -184 -165 -14.0619 0.263
NP_441004.1_4 Forward -181 -171 9.91146 0.259
NP_442813.1_2 Reverse -257 -276 -3.93378 0.281
NP_442366.1_3 Forward -139 -121 16.2438 0.0198
NP_442873.1_2 Forward -336 -317 15.2399 0.193
NP_442206.1_10 Reverse -129 -144 4.20813 0.179
NP_443054.1_2 Reverse -127 -141 12.4876 0.0722
NP_441851.1_10 Forward -139 -129 16.008 0.00552
NP_441851.1_10 Reverse -128 -138 15.8113 0.00552
NP_441851.1_10 Reverse -300 -310 4.3066 0.277
NP_442011.1_1 Forward -139 -120 -1.47551 0.268
NP_441668.1_4 Reverse -119 -138 3.34271 0.187
NP_442515.1_1 Reverse -128 -142 4.03116 0.109
NP_441683.1_5 Forward -343 -324 8.16093 0.248
NP_440593.1_1 Reverse -136 -155 12.7825 0.298
NP_441982.1_6 Forward -277 -268 13.0583 0.274
NP_440463.1_7 Forward -239 -225 15.6342 0.248
NP_440165.1_5 Forward -139 -120 -1.67217 0.197
NP_441046.1_2 Reverse -312 -331 -2.36049 0.299
NP_441349.1_10 Reverse -119 -138 19.6656 0.00739
NP_441349.1_10 Forward -148 -129 -9.14533 0.284
NP_441409.1_6 Forward -144 -125 -15.0452 0.275
NP_440432.1_9 Reverse -130 -145 -2.08505 0.167
NP_442843.1_1 Reverse -130 -149 -9.24366 0.264
NP_439960.1_4 Forward -139 -120 14.0599 0.225
NP_440474.1_8 Reverse -130 -144 7.07881 0.21
NP_440474.1_8 Reverse -100 -114 5.89884 0.237
NP_440474.1_8 Forward -337 -323 3.93223 0.296
NP_441477.1_4 Reverse -233 -252 13.5691 0.28
NP_442450.1_5 Reverse -127 -137 9.32148 0.115
NP_442450.1_5 Forward -140 -130 9.32148 0.115
NP_440588.1_2 Reverse -120 -139 16.9124 0.0108
NP_441031.1_1 Forward -74 -55 24.9471 0.00589
NP_439950.1_1 Reverse -2 -11 14.5527 0.212
NP_442006.1_2 Reverse -342 -359 -16.2841 0.247
NP_441003.1_5 Forward -389 -370 24.0905 0.0289
NP_440483.1_1 Reverse -222 -241 -1.67217 0.208
NP_442243.1_1 Reverse -345 -363 2.47668 0.204
NP_441570.1_1 Reverse -129 -147 4.05072 0.021
NP_441570.1_1 Forward -138 -120 0.707465 0.0372
NP_441078.1_4 Forward -138 -129 19.6659 0.0007
NP_441078.1_4 Reverse -129 -138 19.6659 0.0007
NP_441078.1_4 Forward -36 -27 3.83464 0.13
NP_441078.1_4 Reverse -351 -360 -1.57357 0.266
NP_442729.1_8 Forward -142 -129 9.45906 0.125
NP_440526.1_3 Forward -137 -126 7.92465 0.126
NP_440526.1_3 Reverse -130 -141 1.92649 0.267
NP_441432.1_8 Reverse -128 -137 16.8143 0.00595
NP_441432.1_8 Forward -139 -130 8.25953 0.0755
NP_441432.1_8 Reverse -350 -359 5.50626 0.151
NP_441432.1_8 Forward -43 -34 2.94966 0.28
NP_442320.1_8 Forward -144 -130 4.42448 0.0504
NP_442320.1_8 Reverse -123 -137 -5.31028 0.217
NP_441732.1_2 Forward -142 -126 -16.6577 0.186
NP_441732.1_2 Reverse -125 -141 -17.346 0.253
NP_440629.1_6 Reverse -123 -142 13.1886 0.265
NP_442003.1_4 Reverse -160 -179 15.8307 0.19
NP_440199.1_10 Forward -141 -131 14.533 0.0861
NP_440199.1_10 Forward -45 -35 13.4514 0.108
NP_440199.1_10 Reverse -126 -136 7.64985 0.231
NP_440578.1_8 Reverse -129 -148 10.2259 0.285
NP_442353.1_4 Forward -338 -319 -0.886293 0.293
NP_440913.1_1 Reverse -349 -367 4.6407 0.26
NP_442968.1_1 Forward -184 -165 19.174 0.181
NP_440713.1_4 Reverse -119 -138 14.2574 0.0896
NP_442489.1_7 Forward -138 -129 20.1576 0.000695
NP_442489.1_7 Reverse -129 -138 20.1576 0.000695
NP_442489.1_7 Forward -360 -351 4.91628 0.0892
NP_442489.1_7 Reverse -351 -360 -1.57357 0.213
NP_440565.1_7 Forward -184 -165 -1.67217 0.284
NP_440559.1_1 Forward -137 -128 17.4043 0.00658
NP_440559.1_1 Reverse -130 -139 8.75118 0.0586
NP_441659.2_8 Forward -138 -128 18.1713 0.00133
NP_441659.2_8 Reverse -129 -139 11.9764 0.0147
NP_441659.2_8 Reverse -99 -109 6.17489 0.084
NP_442749.1_5 Forward -321 -304 8.70573 0.231
NP_441022.1_1 Reverse -114 -123 10.8747 0.284
NP_442913.1_10 Reverse -342 -361 -2.55715 0.187
NP_442913.1_10 Reverse -314 -333 -2.55715 0.187
NP_441040.1_5 Reverse -154 -173 6.29264 0.229
NP_442346.1_5 Reverse -128 -138 16.6963 0.00248
NP_442346.1_5 Forward -139 -129 9.02648 0.118
NP_442346.1_5 Forward -43 -33 7.25653 0.176
NP_442346.1_5 Forward -109 -99 4.99491 0.267
NP_440352.1_5 Reverse -35 -54 9.63828 0.294
NP_440545.1_3 Reverse -125 -142 3.67709 0.0804
NP_440486.1_6 Forward -139 -120 6.78429 0.278
NP_440459.1_2 Reverse -167 -184 7.217 0.299
NP_440010.1_4 Reverse -119 -138 1.86696 0.227
NP_442603.1_7 Forward -138 -124 7.86545 0.193
NP_441888.1_7 Forward -143 -129 2.2612 0.225
NP_441047.1_1 Forward -352 -333 -0.590531 0.283
NP_442070.1_1 Reverse -309 -328 15.6341 0.13
NP_441833.1_4 Forward -137 -130 15.9687 0.0124
NP_441833.1_4 Reverse -130 -137 15.9687 0.0124
NP_441833.1_4 Reverse -100 -107 4.56234 0.248
NP_441895.1_2 Reverse -107 -126 -17.7985 0.234
NP_442699.1_8 Reverse -227 -246 -12.2919 0.247
NP_442162.1_9 Forward -137 -130 16.2637 0.0124
NP_442162.1_9 Reverse -130 -137 16.2637 0.0124
NP_443015.1_2 Forward -188 -169 12.2908 0.182
NP_440671.1_1 Reverse -51 -70 8.23655 0.204
NP_440671.1_4 Reverse -123 -137 19.1741 0.00997
NP_440671.1_4 Forward -144 -130 9.14437 0.184
NP_440772.1_10 Reverse -57 -76 12.7098 0.253
NP_442140.1_3 Forward -281 -271 9.61647 0.104
NP_442140.1_3 Reverse -130 -140 8.33817 0.119
NP_442140.1_3 Forward -177 -167 8.23984 0.122
NP_442140.1_3 Forward -137 -127 4.40493 0.243
NP_440875.1_9 Reverse -131 -141 8.37203 0.233
NP_440875.1_9 Reverse -101 -111 7.69067 0.255
NP_441813.1_5 Forward -140 -130 17.188 0.00979
NP_441813.1_5 Reverse -127 -137 15.9097 0.01
NP_440590.1_4 Reverse -130 -143 -3.71729 0.255
NP_440567.1_1 Forward -137 -123 13.2743 0.0213
NP_440567.1_1 Reverse -130 -144 4.62115 0.116
NP_442497.1_10 Forward -137 -128 10.4228 0.0087
NP_442497.1_10 Reverse -130 -139 10.4228 0.0087
NP_440821.1_4 Forward -140 -130 19.0562 0.00399
NP_440821.1_4 Reverse -127 -137 18.2696 0.00448
NP_440927.1_4 Reverse -258 -277 17.6007 0.213
NP_441239.1_9 Forward -140 -128 13.3137 0.037
NP_441239.1_9 Forward -303 -291 8.39711 0.134
NP_441239.1_9 Forward -180 -168 8.10212 0.142
NP_441239.1_9 Reverse -127 -139 6.92215 0.173
NP_441009.1_7 Reverse -128 -147 13.0775 0.191
NP_440542.1_2 Reverse -54 -71 17.8367 0.195
NP_441892.1_1 Forward -147 -130 -5.56602 0.283
NP_440665.1_1 Forward -288 -269 -13.5702 0.257
NP_442193.1_8 Forward -141 -122 16.3215 0.211
NP_442643.1_3 Reverse -307 -326 3.73603 0.141
NP_442772.1_1 Reverse -50 -69 19.3566 0.106
NP_441541.1_1 Reverse -52 -70 4.96757 0.165
NP_440833.1_6 Forward -272 -258 10.422 0.247
NP_440949.1_7 Forward -146 -127 19.9598 0.108
NP_442138.1_10 Forward -138 -119 -1.08219 0.169
NP_442138.1_10 Reverse -129 -148 -8.16202 0.299
NP_440500.1_1 Reverse -31 -50 8.06259 0.266
NP_440546.1_4 Reverse -169 -179 14.1182 0.0459
NP_440546.1_4 Reverse -129 -139 11.8882 0.0679
NP_440546.1_4 Forward -138 -128 10.046 0.109
NP_440546.1_4 Forward -178 -168 8.59164 0.181
NP_440462.1_6 Forward -140 -130 15.418 0.0142
NP_440462.1_6 Reverse -127 -137 7.74818 0.0699
NP_440868.1_4 Reverse -125 -137 13.2153 0.022
NP_440868.1_4 Forward -142 -130 10.7571 0.0364
NP_442479.1_2 Reverse -235 -254 14.3558 0.179
NP_442402.1_2 Forward -293 -279 10.1271 0.298
NP_442402.1_4 Forward -317 -298 4.03023 0.147
NP_441848.1_4 Forward -73 -57 8.12362 0.288
NP_441848.1_4 Forward -85 -69 7.1687 0.295
NP_441848.1_7 Forward -270 -251 -4.42619 0.292
NP_441843.2_2 Reverse -327 -346 12.6833 0.254
NP_440579.1_3 Reverse -288 -307 11.8975 0.296
NP_442039.1_4 Forward -137 -130 15.1821 0.0124
NP_442039.1_4 Reverse -130 -137 15.1821 0.0124
NP_442837.1_3 Forward -137 -130 15.7721 0.0124
NP_442837.1_3 Reverse -130 -137 15.7721 0.0124
NP_440160.1_1 Reverse -49 -68 20.7738 0.015
NP_442053.1_1 Forward -138 -129 18.3876 0.0007
NP_442053.1_1 Reverse -129 -138 18.3876 0.0007
NP_440505.1_3 Reverse -127 -137 16.303 0.00696
NP_440505.1_3 Forward -140 -130 13.8447 0.0247
NP_440505.1_3 Forward -110 -100 11.0914 0.0877
NP_441959.1_8 Reverse -50 -63 9.38413 0.286
NP_440207.2_7 Reverse -313 -332 22.9106 0.0446
NP_440914.1_1 Forward -138 -128 17.5935 0.000537
NP_440914.1_1 Reverse -129 -139 8.6151 0.186
NP_440914.1_1 Reverse -159 -169 8.32233 0.197
NP_441011.1_8 Reverse -130 -139 16.9127 0.00602
NP_441011.1_8 Forward -41 -32 9.14451 0.135
NP_441011.1_8 Forward -137 -128 8.25953 0.144
NP_440724.1_6 Forward -294 -275 8.65258 0.249
NP_442533.1_1 Forward -390 -371 -17.1101 0.281
NP_442533.1_6 Forward -138 -129 17.2076 0.00137
NP_442533.1_6 Reverse -129 -138 17.2076 0.00137
NP_442533.1_6 Forward -36 -27 4.22796 0.186
NP_442533.1_6 Forward -108 -99 2.65466 0.246
NP_442533.1_6 Forward -178 -169 1.37636 0.3
NP_442541.1_10 Forward -360 -346 11.5037 0.182
NP_442232.1_3 Reverse -121 -140 -4.32711 0.163
NP_442232.1_3 Reverse -321 -340 -7.37537 0.199
NP_443016.1_1 Forward -320 -301 -3.83545 0.225
NP_441482.1_7 Forward -144 -130 -1.47537 0.0721
NP_441482.1_7 Reverse -123 -137 -1.47537 0.0721
NP_441482.1_7 Reverse -163 -177 -11.0135 0.229
NP_439944.1_9 Forward -137 -127 19.0562 0.00329
NP_439944.1_9 Reverse -130 -140 10.3048 0.0887
NP_439944.1_9 Forward -107 -97 4.79825 0.296
NP_441697.1_5 Reverse -57 -76 -6.8281 0.237
NP_440816.1_7 Forward -142 -123 15.2408 0.181
NP_441028.1_6 Forward -287 -277 17.1874 0.132
NP_441028.1_6 Reverse -268 -278 9.71433 0.21
NP_441028.1_6 Forward -355 -345 3.8145 0.281
NP_440115.1_6 Reverse -126 -136 9.41981 0.115
NP_440115.1_6 Reverse -348 -358 6.17489 0.197
NP_440115.1_6 Reverse -166 -176 5.5849 0.236
NP_440007.1_9 Forward -142 -128 0.786239 0.29
NP_439965.1_1 Reverse -120 -139 15.6341 0.0142
NP_441972.1_1 Forward -291 -272 17.699 0.0985
NP_441106.1_1 Forward -139 -130 18.191 0.0028
NP_441106.1_1 Reverse -98 -107 11.5045 0.0311
NP_441106.1_1 Reverse -128 -137 9.63616 0.0311
NP_441106.1_3 Forward -72 -53 26.5488 0.00003
NP_441106.1_3 Reverse -60 -79 19.174 0.0559
NP_441106.1_9 Forward -124 -114 15.6147 0.286
NP_439903.1_6 Reverse -126 -145 4.91521 0.188
NP_439903.1_6 Forward -141 -122 0.981987 0.255
NP_439903.1_7 Forward -177 -158 6.68596 0.281
NP_001035870.1_3 Reverse -118 -137 -3.73712 0.278
NP_442306.1_10 Reverse -75 -94 -21.6334 0.282
NP_440797.1_2 Forward -149 -130 13.1542 0.234
NP_441286.1_1 Reverse -128 -140 14.4936 0.00418
NP_441286.1_1 Forward -139 -127 11.8387 0.0114
NP_442674.1_3 Forward -146 -127 12.1917 0.174
NP_440670.1_8 Forward -138 -129 18.3876 0.000699
NP_440670.1_8 Reverse -129 -138 18.3876 0.000699
NP_440886.1_7 Forward -139 -129 17.7774 0.0011
NP_440886.1_7 Reverse -128 -138 7.94438 0.0805
NP_440828.1_1 Forward -358 -339 -1.18128 0.284
NP_442614.1_2 Forward -138 -124 8.06273 0.255
NP_442072.1_9 Forward -116 -98 -7.06068 0.0789
NP_442072.1_9 Reverse -98 -116 -21.6137 0.211
NP_442072.1_9 Forward -361 -343 -22.4003 0.234
NP_442072.1_9 Reverse -128 -146 -23.482 0.297
NP_439899.1_1 Forward -82 -64 3.40863 0.299
NP_440907.2_8 Reverse -130 -140 7.84605 0.117
NP_440907.2_8 Forward -309 -299 3.8145 0.297
NP_442264.1_2 Forward -142 -125 9.87194 0.193
NP_441021.1_8 Reverse -124 -142 1.88744 0.256
NP_441463.1_3 Reverse -119 -138 -1.7705 0.146
NP_441463.1_3 Forward -148 -129 -10.4236 0.294
NP_441463.1_6 Forward -362 -348 17.6254 0.114
NP_441463.1_6 Forward -140 -126 8.44524 0.25
NP_441463.1_6 Reverse -127 -141 5.64286 0.287
NP_441626.1_2 Forward -137 -130 15.7721 0.0124
NP_441626.1_2 Reverse -130 -137 15.7721 0.0124
NP_441626.1_2 Forward -114 -107 7.6106 0.119
NP_442365.1_7 Forward -142 -123 -0.295539 0.177
NP_442365.1_7 Reverse -125 -144 -5.80207 0.279
NP_440107.1_5 Reverse -122 -141 -4.22878 0.186
NP_442794.1_1 Reverse -125 -137 9.97041 0.0742
NP_442794.1_1 Forward -182 -170 6.1355 0.192
NP_442794.1_1 Forward -46 -34 2.79224 0.286
NP_442615.1_1 Reverse -120 -138 10.3439 0.0214
NP_442615.1_1 Forward -117 -99 0.314141 0.105
NP_441962.1_4 Reverse -124 -143 -1.37718 0.123
NP_440387.1_1 Forward -138 -122 14.3165 0.00649
NP_440387.1_1 Reverse -129 -145 4.3851 0.0426
NP_441431.1_2 Reverse -166 -180 14.3553 0.0681
NP_441488.1_3 Forward -399 -381 18.0802 0.239
NP_441488.1_8 Reverse -164 -178 7.66879 0.231
NP_441193.1_6 Reverse -352 -371 0.491109 0.293
NP_441993.1_1 Forward -184 -165 4.48058 0.22
NP_441174.1_4 Reverse -277 -287 10.2065 0.288
NP_440114.1_10 Reverse -129 -143 15.1426 0.0294
NP_441510.2_7 Forward -144 -130 14.0603 0.28
NP_440766.1_4 Reverse -125 -139 7.76774 0.0871
NP_439988.1_3 Reverse -165 -179 5.21113 0.288
NP_441237.1_9 Reverse -170 -180 13.7464 0.0687
NP_441531.1_6 Forward -285 -272 11.819 0.254
NP_442930.1_1 Forward -271 -261 14.0409 0.239
NP_442930.1_1 Forward -57 -47 11.6809 0.258
NP_439910.1_2 Reverse -91 -108 -3.50107 0.054
NP_439910.1_2 Forward -146 -129 -13.4325 0.162
NP_440457.1_1 Reverse -125 -137 10.8554 0.092
NP_440457.1_1 Reverse -165 -177 0.333971 0.25
NP_440457.1_1 Forward -142 -130 -0.0593532 0.25
NP_440987.1_6 Reverse -2 -21 14.1702 0.199
NP_441332.1_6 Reverse -372 -382 11.1627 0.269
NP_442509.1_9 Reverse -129 -139 16.2041 0.00739
NP_442509.1_9 Forward -138 -128 8.14104 0.192
NP_442582.1_6 Forward -72 -53 16.6603 0.226
NP_442514.1_5 Reverse -163 -182 -6.88445 0.275
NP_440554.1_4 Reverse -130 -140 14.6313 0.02
NP_440554.1_4 Forward -137 -127 7.05986 0.106
NP_440554.1_4 Reverse -379 -389 1.84832 0.287
NP_442862.1_3 Reverse -69 -86 11.1502 0.202
NP_441885.1_5 Forward -138 -128 20.9245 0.000538
NP_441885.1_5 Reverse -129 -139 11.4848 0.00668
NP_441885.1_5 Forward -332 -322 -1.59326 0.273
NP_441275.1_1 Forward -71 -53 2.47742 0.192
NP_441466.1_4 Forward -179 -160 6.19431 0.295
NP_442341.1_7 Reverse -128 -142 16.0275 0.0189
NP_442341.1_7 Forward -139 -125 6.3911 0.127
NP_442341.1_7 Reverse -32 -46 3.44117 0.224
NP_442341.1_7 Forward -361 -347 1.86788 0.278
NP_442341.1_9 Forward -140 -126 16.1252 0.0386
NP_442395.2_4 Forward -139 -120 11.11 0.092
NP_442534.1_7 Forward -139 -120 6.09597 0.283
NP_440423.1_6 Forward -146 -127 -8.55534 0.138
NP_443000.1_7 Reverse -127 -137 17.0896 0.00865
NP_443000.1_7 Forward -140 -130 8.73149 0.0437
NP_440507.2_3 Reverse -120 -139 6.78348 0.299
NP_440275.1_3 Forward -140 -130 8.4365 0.0602
NP_440275.1_3 Reverse -127 -137 8.1415 0.0602
NP_442932.1_9 Reverse -299 -318 4.52268 0.285
NP_440091.1_1 Forward -142 -130 10.7571 0.0429
NP_440091.1_1 Reverse -125 -137 8.9871 0.0567
NP_440091.1_1 Reverse -95 -107 -0.157684 0.273
NP_441662.1_4 Reverse -2 -20 27.3552 0.000306
NP_443010.1_10 Forward -141 -124 14.9466 0.0582
NP_442451.1_2 Forward -146 -127 -10.0303 0.264
NP_440149.1_8 Reverse -129 -148 5.40766 0.0746
NP_440149.1_8 Forward -48 -29 1.37609 0.126
NP_441105.1_3 Reverse -118 -137 3.83436 0.086
NP_441105.1_3 Reverse -346 -365 -4.6221 0.203
NP_440216.1_1 Forward -138 -124 -1.27871 0.0303
NP_440216.1_1 Reverse -129 -143 -1.5737 0.034
NP_440216.1_1 Forward -115 -101 -11.5051 0.192
NP_440216.1_1 Reverse -99 -113 -11.6035 0.203
NP_440216.1_9 Forward -230 -221 10.1278 0.286
NP_440172.1_1 Forward -138 -128 15.0247 0.00945
NP_440172.1_1 Reverse -129 -139 8.73149 0.0586
NP_440172.1_1 Forward -178 -168 3.02829 0.251
NP_442371.1_1 Forward -80 -70 13.9425 0.191
NP_442015.1_10 Reverse -125 -138 9.16406 0.053
NP_442015.1_10 Forward -142 -129 0.805932 0.218
NP_441226.1_7 Forward -137 -130 14.4934 0.0123
NP_441226.1_7 Reverse -130 -137 14.4934 0.0123
NP_441226.1_7 Reverse -170 -177 12.4284 0.0404
NP_441226.1_7 Forward -235 -228 5.34865 0.289
NP_440198.1_10 Forward -398 -379 6.98095 0.296
NP_440305.1_1 Forward -85 -71 16.3407 0.133
NP_441111.1_7 Forward -137 -129 18.7023 0.00294
NP_441111.1_7 Reverse -130 -138 18.7023 0.00294
NP_441111.1_7 Reverse -100 -108 -0.570565 0.233
NP_442379.1_10 Reverse -122 -139 8.20031 0.102
NP_442379.1_10 Forward -115 -98 -3.8944 0.272
NP_441766.1_2 Forward -138 -129 17.5026 0.00297
NP_441766.1_2 Reverse -129 -138 17.5026 0.00297
NP_441766.1_2 Forward -178 -169 5.40793 0.122
NP_441766.1_2 Forward -108 -99 4.81794 0.158
NP_440416.1_1 Forward -108 -89 -6.58872 0.174
NP_440416.1_9 Reverse -122 -141 -8.16202 0.111
NP_440416.1_9 Reverse -371 -390 -17.8968 0.248
NP_440416.1_9 Forward -361 -342 -19.9617 0.281
NP_440261.1_5 Forward -177 -164 -6.56889 0.201
NP_440261.1_5 Reverse -130 -143 -10.5021 0.201
NP_440261.1_5 Forward -137 -124 -10.6005 0.201
NP_440988.1_10 Forward -362 -348 10.9012 0.187
NP_440988.1_10 Forward -134 -120 8.4809 0.205
NP_440988.1_10 Forward -334 -320 5.09245 0.246
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCAGGAATTGGAAGTGATGGGACTGCGGAATTCGGAAATGTCCATTGCCACCCGTTTCACTGTCAGTGGCTGCCCCCAACAGTTTGCGGAGCTTTCCCACCAATGGCTCGGTTTTACCCCCATGGTGGAAAAAATTTCCTTGCCCTGCTTGAGTTCAATTTGCCCCCAACCCTTGGAAATACGAGAGTAGAATACTAGTCAGATTCCGGTATTCCTGCTTGCCCGATGGCTCGGGATTCCTGAACTAATAACTCCAATAACGGCGATCGCCATGCTCAACTTTTTGCGAGAGGCGGTCGTTTTTTAATGGAGCCAAAGACTGGAAATAATCGTTACAATTCTTAATAATTCACCAATGGTTATGGCTGTGCCCTGACTGAGAATCCACTAATTCTTCCT

CDS

ATGACCAGTTTGTTAACCTCCTCTGCCCAAGCTCCAGTTGCCAACGCTCCCTTTCCAGCAGGGGGACTAGACCAAAGCAAATTTGATTGTCGGGCCGTGTGGTATCCCCTGGCTTACGAGGAGGATTTGGACAAACGCAAACCAACTCGTTTTACCCTGCTGGGAGAAGATTTGGTGATCTGGTGGGAAGCGAATAGTCAACAATGGCGGGTTTACGCCGATCAATGTCCCCACCGTTTGGCCCCCCTTTCGGAAGGTAGGATTAACAAGGCTGGCCAGTTGGAATGTCCTTACCACGGTTGGACTTTTGCGGGATCAGGGCAATGTCAAGCGATTCCTCAACAACATACCGGAGGCCAAGCCCACACCAGTAAACGGGCCTGTGTGCGTTCCCTGCCAACCCAAGTGGCTCAAGGTTTGCTCTTTGCTTTTCCTGGGGAAACTGATCAAGCAGAAAAAGTTGCCCTCCCCTTGGTGGATGTGTTGGATGGGGATCAGTCTGAATGGGTTTGTCTCAATACTTTTCGGGATTTGCCCTACGACGCCTTTACCCTGATGGAAAATGTGTTGGATTCGAGCCATATTCCCTACACCCACCATAAAACCGTTGGTAAACGCAGTAACGTTAGTCCGGTGGATTTGGAGATTATCCATGGCGATCGTCAGGGATTTACCGGCATTTGGGAAGAGGGACCAAGAAAAGGTACGTTGGGCAAGCAAACCACCACTTTCATTGCGCCGGGGTTGATGTGGCATGATTTAACTTCAAAGCAATTTGGTCGAACTTTAACGGTGGTTTACGCTACTCCGATTCGCCCAGGGGAGTGTCGTTTATTCGCCCGTTTTCCTTTTAAATTTCCTAGTAAGTTTCCCCGGTTAGTAATTGGTTTCACGCCCCGTTGGTATTCCCATTTAGGACAAAACCGGGTGTTGGAAGATGACCAAATTTTTCTCCATTTCCAAGAAAGATTTGTGCAGGGCAAAGGCGGATCGCCCAATTATGAAAAAGATTGTTACTTACCCACTAAAGCAGATTTGTTTGTGGCGGAATTTCACCGTTGGATTGAGCAATATCAAGTCAAACCCTTTGGGGATAGTCCGTTACCTGATCGCCAATCGGTAGAGCAATTAATGGATCGTTACCATTCCCACACTGAACATTGCCACAGTTGCCGCAATGCCCTTGCTAACATTGAAAAAATTCAAACCGGGAGCCTCGCGATCGCCATTATCTGCTTGGTTTGCTTGCCAGTGGCTAGTTTAGGCTTAGCTCCTAATTTCGCTCTGGGATTGGGCTTGACAGTGTTGACTGGCTTAGGTTTTGCACTCTGGGCTGGTTTGGGCAAATTTAAACAATCTTTTTACCAAGGCAACCCCATTCCCCCAAGAAATATTCTTGATAAAGGCTAA

Protein

MTSLLTSSAQAPVANAPFPAGGLDQSKFDCRAVWYPLAYEEDLDKRKPTRFTLLGEDLVIWWEANSQQWRVYADQCPHRLAPLSEGRINKAGQLECPYHGWTFAGSGQCQAIPQQHTGGQAHTSKRACVRSLPTQVAQGLLFAFPGETDQAEKVALPLVDVLDGDQSEWVCLNTFRDLPYDAFTLMENVLDSSHIPYTHHKTVGKRSNVSPVDLEIIHGDRQGFTGIWEEGPRKGTLGKQTTTFIAPGLMWHDLTSKQFGRTLTVVYATPIRPGECRLFARFPFKFPSKFPRLVIGFTPRWYSHLGQNRVLEDDQIFLHFQERFVQGKGGSPNYEKDCYLPTKADLFVAEFHRWIEQYQVKPFGDSPLPDRQSVEQLMDRYHSHTEHCHSCRNALANIEKIQTGSLAIAIICLVCLPVASLGLAPNFALGLGLTVLTGLGFALWAGLGKFKQSFYQGNPIPPRNILDKG