Your browser is old and dusty. Try Google Chrome!

Details for slr1743

ORF slr1743
Accession NP_441103.1
Symbol ndbB
Category NADH dehydrogenase
Definition type 2 NADH dehydrogenase NdbB
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -220 -206 4.03116 0.157
NP_441061.1_2 Forward -82 -68 2.5562 0.174
NP_441061.1_2 Forward -22 -8 2.35953 0.177
NP_440795.1_7 Forward -220 -213 14.6904 0.0123
NP_440795.1_7 Reverse -213 -220 14.6904 0.0123
NP_440795.1_7 Forward -270 -263 8.8889 0.188
NP_440795.1_7 Forward -367 -360 8.39725 0.213
NP_441418.1_6 Reverse -244 -263 -14.5535 0.0819
NP_441418.1_6 Reverse -313 -332 -29.8932 0.245
NP_442291.1_5 Reverse -211 -227 0.746852 0.158
NP_442291.1_5 Forward -222 -206 -2.20308 0.212
NP_441453.1_4 Reverse -212 -220 16.539 0.00633
NP_441453.1_4 Forward -221 -213 16.539 0.00633
NP_441453.1_7 Forward -292 -285 12.9205 0.23
NP_441623.1_1 Forward -204 -186 -1.25915 0.24
NP_441960.1_3 Reverse -212 -231 14.1783 0.243
NP_442151.1_6 Forward -221 -207 17.3058 0.0111
NP_442151.1_6 Reverse -212 -226 15.0442 0.0276
NP_442151.1_6 Forward -344 -330 6.09611 0.248
NP_441818.1_1 Forward -220 -209 16.0861 0.0221
NP_441818.1_1 Reverse -213 -224 9.59626 0.232
NP_441818.1_9 Forward -256 -237 -7.17871 0.27
NP_441818.1_9 Reverse -254 -273 -7.4737 0.272
NP_440226.1_1 Reverse -212 -231 9.3409 0.0734
NP_440226.1_1 Forward -221 -202 4.52268 0.188
NP_441465.1_8 Forward -232 -214 9.85225 0.196
NP_441630.1_3 Reverse -204 -223 5.89931 0.135
NP_441630.1_3 Forward -229 -210 2.65439 0.218
NP_442287.1_1 Reverse -228 -238 13.7459 0.277
NP_442173.1_1 Forward -220 -212 15.4574 0.00633
NP_442173.1_1 Reverse -213 -221 15.4574 0.00633
NP_442752.1_4 Forward -221 -214 13.8055 0.0199
NP_442752.1_4 Reverse -212 -219 13.8055 0.0199
NP_442752.1_4 Reverse -14 -21 7.90559 0.144
NP_442752.1_4 Reverse -89 -96 5.25066 0.256
NP_443027.1_4 Forward -223 -213 16.2046 0.0437
NP_443027.1_4 Reverse -210 -220 13.1564 0.0521
NP_443027.1_4 Reverse -242 -252 10.1081 0.144
NP_441812.1_3 Reverse -211 -225 20.8458 0.00667
NP_442975.1_10 Forward -225 -211 21.3367 0.00107
NP_442975.1_10 Reverse -208 -222 12.192 0.0477
NP_440784.1_7 Forward -220 -213 15.9687 0.0123
NP_440784.1_7 Reverse -213 -220 15.9687 0.0123
NP_441250.1_5 Forward -204 -185 16.7149 0.163
NP_440061.1_9 Forward -223 -209 10.717 0.123
NP_440061.1_9 Forward -216 -202 5.21053 0.293
NP_440110.1_8 Reverse -210 -229 0.392778 0.211
NP_439979.1_2 Reverse -244 -263 5.89931 0.292
NP_439979.1_3 Forward -121 -102 19.0206 0.232
NP_442062.1_8 Forward -221 -211 17.3846 0.00193
NP_442062.1_8 Reverse -212 -222 10.3048 0.0493
NP_440761.1_4 Reverse -207 -226 -3.24547 0.132
NP_441859.1_3 Forward -222 -203 4.03023 0.228
NP_441859.1_3 Forward -215 -196 3.14526 0.249
NP_441802.1_1 Forward -145 -126 9.14423 0.22
NP_440304.1_4 Forward -223 -213 19.9412 0.00364
NP_440304.1_4 Reverse -210 -220 9.91146 0.051
NP_440304.1_4 Forward -240 -230 2.14332 0.299
NP_442242.1_4 Forward -220 -213 14.3954 0.0124
NP_442242.1_4 Reverse -213 -220 14.3954 0.0124
NP_440853.1_8 Reverse -105 -124 16.6174 0.291
NP_440011.1_1 Forward -157 -138 13.4708 0.258
NP_439918.1_3 Reverse -289 -308 14.3558 0.172
NP_441200.1_4 Reverse -197 -216 5.80098 0.294
NP_441208.1_9 Reverse -209 -223 13.3726 0.109
NP_441594.1_6 Forward -365 -346 8.84924 0.153
NP_441594.1_6 Reverse -316 -335 2.0644 0.256
NP_441594.1_6 Forward -322 -303 1.47442 0.268
NP_442742.1_9 Forward -194 -175 -11.8003 0.269
NP_442110.1_7 Reverse -212 -226 10.9143 0.0644
NP_442110.1_7 Forward -23 -9 0.589577 0.256
NP_442726.1_1 Reverse -257 -276 8.65258 0.271
NP_441083.1_5 Forward -221 -211 20.3345 0.00053
NP_441083.1_5 Reverse -212 -222 11.2881 0.0159
NP_442827.1_8 Reverse -204 -223 4.22689 0.138
NP_442827.1_8 Forward -229 -210 1.76863 0.172
NP_441434.1_6 Reverse -174 -184 14.533 0.278
NP_441738.1_2 Forward -219 -212 15.28 0.0102
NP_441738.1_2 Reverse -214 -221 15.28 0.0102
NP_441558.1_5 Forward -223 -204 12.8808 0.0651
NP_440209.1_1 Reverse -212 -220 18.1123 0.00295
NP_440209.1_1 Forward -221 -213 18.1123 0.00295
NP_442889.1_8 Forward -224 -210 9.93039 0.0933
NP_442889.1_8 Forward -274 -260 4.42388 0.267
NP_441713.1_1 Reverse -206 -225 -12.8819 0.25
NP_441770.1_4 Reverse -320 -339 -9.34199 0.25
NP_440178.1_7 Reverse -211 -230 12.7825 0.00536
NP_440178.1_7 Forward -222 -203 -3.93378 0.0516
NP_442570.1_3 Reverse -254 -273 -8.55534 0.288
NP_442570.1_3 Reverse -210 -229 -8.94866 0.294
NP_441716.1_1 Forward -221 -207 11.2093 0.0936
NP_442111.1_4 Reverse -211 -225 1.96621 0.292
NP_441163.1_1 Forward -363 -346 6.82295 0.254
NP_440906.1_5 Forward -220 -213 15.8704 0.0124
NP_440906.1_5 Reverse -213 -220 15.8704 0.0124
NP_440438.2_8 Reverse -23 -42 2.75272 0.262
NP_440747.1_1 Forward -358 -340 6.11567 0.264
NP_440747.1_10 Reverse -209 -221 7.51213 0.00286
NP_440747.1_10 Forward -224 -212 -1.92764 0.0192
NP_440747.1_10 Forward -325 -313 -11.4657 0.122
NP_440747.1_10 Reverse -356 -368 -12.3507 0.27
NP_441130.1_10 Forward -223 -209 10.1277 0.117
NP_441130.1_10 Reverse -210 -224 6.29277 0.194
NP_441486.1_1 Forward -224 -210 5.21113 0.0384
NP_441486.1_1 Reverse -209 -223 4.32615 0.0462
NP_441880.2_10 Forward -220 -202 13.1955 0.111
NP_441880.2_10 Forward -327 -309 7.88563 0.288
NP_442634.1_4 Reverse -210 -224 5.80112 0.051
NP_442634.1_4 Forward -223 -209 -3.54032 0.161
NP_442634.1_4 Forward -255 -241 -4.32697 0.195
NP_440403.1_10 Forward -322 -303 1.96607 0.282
NP_440842.1_6 Forward -93 -74 10.4217 0.284
NP_441014.1_10 Reverse -211 -230 4.03023 0.205
NP_442848.1_1 Forward -328 -314 -1.27871 0.263
NP_442848.1_1 Reverse -206 -220 -2.95034 0.263
NP_441012.1_4 Forward -326 -313 9.2624 0.272
NP_441012.1_4 Reverse -246 -259 7.6891 0.272
NP_443018.1_3 Forward -220 -213 14.8871 0.0123
NP_443018.1_3 Reverse -213 -220 14.8871 0.0123
NP_443018.1_3 Forward -204 -197 9.38056 0.128
NP_443018.1_3 Reverse -263 -270 4.56234 0.241
NP_443018.1_3 Forward -270 -263 4.46401 0.244
NP_441634.1_8 Forward -223 -209 2.5562 0.167
NP_441634.1_8 Forward -324 -310 1.67122 0.185
NP_441634.1_8 Reverse -69 -83 -0.492064 0.259
NP_441634.1_8 Reverse -210 -224 -4.62196 0.295
NP_440376.1_1 Forward -221 -212 19.4693 0.000692
NP_440376.1_1 Reverse -212 -221 19.4693 0.000692
NP_440376.1_1 Reverse -385 -394 1.57302 0.246
NP_441588.1_4 Forward -219 -209 8.63316 0.14
NP_441588.1_4 Reverse -214 -224 6.66654 0.185
NP_442687.1_7 Reverse -358 -368 10.2065 0.0994
NP_442687.1_7 Forward -222 -212 9.02648 0.0994
NP_442687.1_7 Reverse -211 -221 8.92815 0.0994
NP_442946.1_7 Forward -19 -4 17.0462 0.213
NP_441846.1_10 Forward -254 -235 -22.0267 0.257
NP_441846.1_10 Reverse -195 -214 -22.9117 0.271
NP_441422.1_7 Forward -273 -256 -8.51595 0.273
NP_440667.1_2 Reverse -71 -90 -9.14533 0.297
NP_441950.1_7 Reverse -82 -101 -8.55534 0.287
NP_442296.1_5 Forward -230 -211 4.32602 0.251
NP_442296.1_5 Reverse -9 -28 0.491109 0.289
NP_442296.1_9 Forward -319 -300 -0.0988766 0.197
NP_442658.1_1 Forward -223 -213 13.0576 0.04
NP_442658.1_1 Reverse -210 -220 9.616 0.147
NP_442658.1_1 Forward -273 -263 6.86274 0.214
NP_442658.1_1 Reverse -72 -82 6.27276 0.234
NP_442658.1_1 Forward -255 -245 4.7978 0.297
NP_442658.1_9 Reverse -178 -197 11.7992 0.286
NP_440141.1_3 Forward -271 -252 0.884433 0.275
NP_441855.2_4 Forward -321 -302 11.5476 0.211
NP_442205.1_9 Reverse -206 -222 -0.236458 0.264
NP_442205.1_9 Forward -227 -211 -3.08806 0.278
NP_441414.1_9 Reverse -212 -231 -0.197208 0.0875
NP_441414.1_9 Forward -221 -202 -4.42544 0.153
NP_441414.1_9 Forward -271 -252 -10.1286 0.277
NP_441487.1_9 Forward -222 -203 2.45773 0.18
NP_441487.1_9 Forward -323 -304 -1.47551 0.28
NP_442937.1_5 Reverse -207 -226 8.94757 0.205
NP_441958.1_5 Forward -222 -212 21.2195 0.000805
NP_441958.1_5 Reverse -211 -221 12.2714 0.00183
NP_440180.1_1 Reverse -72 -91 17.2074 0.179
NP_442836.1_5 Reverse -206 -225 20.649 0.0181
NP_440203.1_5 Forward -391 -381 8.43603 0.299
NP_440984.1_7 Forward -226 -212 7.9644 0.16
NP_440984.1_7 Reverse -207 -221 6.48943 0.214
NP_439990.1_5 Reverse -207 -220 11.7207 0.128
NP_442690.1_1 Reverse -15 -34 -12.8819 0.25
NP_442911.1_2 Reverse -202 -221 0.491109 0.0665
NP_442911.1_2 Reverse -252 -271 -10.6203 0.284
NP_440153.1_5 Reverse -213 -227 2.65453 0.219
NP_440153.1_5 Forward -220 -206 1.37622 0.257
NP_442064.1_1 Reverse -135 -154 3.73603 0.146
NP_442064.1_1 Reverse -207 -226 -10.817 0.259
NP_443055.1_3 Reverse -203 -222 18.1889 0.0481
NP_443055.1_6 Reverse -341 -359 2.57501 0.206
NP_443055.1_6 Reverse -254 -272 -1.55487 0.28
NP_440993.1_2 Forward -226 -210 17.6598 0.0447
NP_440602.1_8 Reverse -212 -226 15.2409 0.126
NP_441099.1_5 Reverse -142 -161 5.60432 0.0469
NP_441099.1_5 Reverse -202 -221 -2.36049 0.12
NP_440475.1_1 Reverse -203 -222 11.0707 0.262
NP_440475.1_2 Forward -270 -251 21.708 0.0464
NP_441294.1_7 Forward -225 -211 14.914 0.033
NP_441294.1_7 Reverse -208 -222 12.0343 0.117
NP_442438.1_10 Reverse -207 -221 0.88457 0.213
NP_442438.1_10 Reverse -89 -103 0.786239 0.213
NP_442438.1_10 Forward -226 -212 0.589577 0.221
NP_442438.1_10 Forward -79 -65 -0.197071 0.253
NP_442431.1_10 Forward -259 -241 -0.865831 0.296
NP_441000.1_6 Reverse -261 -275 -4.03198 0.225
NP_441000.1_6 Forward -222 -208 -4.62196 0.248
NP_441000.1_6 Reverse -211 -225 -4.81863 0.252
NP_440147.1_4 Forward -223 -210 13.0973 0.0326
NP_440147.1_4 Forward -25 -12 2.77255 0.202
NP_440147.1_4 Forward -370 -357 2.2809 0.209
NP_440147.1_4 Reverse -210 -223 1.49425 0.226
NP_441550.1_8 Reverse -210 -220 16.7941 0.00906
NP_441550.1_8 Forward -223 -213 13.0576 0.0273
NP_441916.1_7 Reverse -212 -222 18.9579 0.00144
NP_441916.1_7 Forward -221 -211 10.3048 0.0261
NP_441916.1_10 Forward -229 -210 6.88262 0.201
NP_441041.1_4 Reverse -212 -231 6.88262 0.0415
NP_441041.1_4 Reverse -313 -332 -5.80207 0.159
NP_441041.1_4 Forward -349 -330 -10.227 0.228
NP_441041.1_4 Forward -259 -240 -13.3736 0.285
NP_441041.1_7 Reverse -209 -221 12.4708 0.0611
NP_441041.1_7 Forward -224 -212 9.65268 0.108
NP_441041.1_7 Reverse -310 -322 8.2922 0.139
NP_441041.1_7 Reverse -345 -357 6.15429 0.221
NP_441725.1_5 Reverse -213 -223 11.1898 0.0247
NP_441725.1_5 Forward -220 -210 9.02648 0.0553
NP_441725.1_5 Forward -204 -194 -0.609952 0.265
NP_439966.1_7 Reverse -210 -220 14.8275 0.0177
NP_439966.1_7 Forward -223 -213 14.8275 0.0177
NP_439966.1_9 Reverse -210 -219 0.884706 0.253
NP_440202.1_8 Forward -203 -184 14.5722 0.236
NP_442941.1_3 Reverse -213 -223 19.9412 0.00262
NP_442941.1_3 Forward -220 -210 10.9931 0.0116
NP_442941.1_3 Reverse -314 -324 0.963343 0.16
NP_440289.1_2 Forward -224 -211 13.3923 0.0132
NP_440289.1_2 Reverse -209 -222 4.8375 0.0644
NP_440983.1_5 Forward -268 -249 -8.16202 0.294
NP_440983.1_5 Forward -22 -3 -8.26035 0.294
NP_442281.1_1 Forward -226 -212 17.2068 0.00633
NP_442281.1_1 Reverse -207 -221 7.17714 0.106
NP_442281.1_1 Forward -276 -262 6.19383 0.133
NP_442281.1_1 Forward -318 -304 4.52221 0.192
NP_442281.1_1 Reverse -239 -253 3.04726 0.246
NP_442281.1_1 Forward -21 -7 2.16228 0.276
NP_441334.1_7 Reverse -210 -229 -19.6667 0.275
NP_442256.1_2 Reverse -210 -228 9.16393 0.0965
NP_440437.1_1 Forward -227 -208 15.9291 0.0204
NP_441457.1_7 Forward -223 -204 3.73603 0.232
NP_441457.1_9 Reverse -246 -265 21.1406 0.0464
NP_441556.1_10 Reverse -135 -149 10.7085 0.262
NP_440498.1_1 Forward -230 -212 0.609134 0.214
NP_442982.1_5 Forward -231 -212 -2.75381 0.289
NP_441644.1_6 Reverse -212 -222 19.0557 0.000803
NP_441644.1_6 Forward -221 -211 17.3841 0.00127
NP_441644.1_6 Forward -271 -261 3.8145 0.261
NP_443049.1_1 Reverse -136 -155 20.4523 0.271
NP_443049.1_6 Forward -150 -140 10.9578 0.292
NP_442215.1_2 Reverse -275 -291 5.27008 0.0796
NP_442215.1_2 Reverse -210 -226 4.77842 0.0823
NP_442215.1_2 Forward -119 -103 -6.7263 0.278
NP_442177.1_5 Reverse -85 -99 14.2576 0.22
NP_440253.1_2 Forward -221 -203 7.09898 0.0749
NP_440929.1_8 Forward -221 -212 19.2726 0.000701
NP_440929.1_8 Reverse -212 -221 19.2726 0.000701
NP_440929.1_8 Forward -156 -147 0.884706 0.293
NP_442933.1_10 Forward -221 -212 17.601 0.00325
NP_442933.1_10 Reverse -212 -221 17.601 0.00325
NP_441751.2_8 Forward -220 -206 12.3893 0.0193
NP_441751.2_8 Reverse -213 -227 -3.147 0.134
NP_442554.1_8 Forward -220 -210 18.0729 0.00543
NP_442554.1_8 Reverse -213 -223 16.9913 0.0065
NP_442554.1_8 Reverse -197 -207 5.97822 0.13
NP_442554.1_8 Forward -270 -260 4.40493 0.188
NP_442554.1_8 Reverse -263 -273 3.91327 0.203
NP_442554.1_8 Forward -204 -194 2.83163 0.253
NP_441762.1_7 Forward -222 -210 2.79224 0.0676
NP_441762.1_7 Reverse -211 -223 -6.94252 0.284
NP_442313.1_5 Reverse -257 -276 5.50599 0.256
NP_442142.1_4 Forward -224 -211 13.5883 0.0348
NP_442142.1_4 Reverse -209 -222 12.8017 0.0409
NP_442292.1_1 Forward -220 -211 18.486 0.00229
NP_442292.1_1 Reverse -213 -222 17.5026 0.00435
NP_442292.1_1 Reverse -314 -323 -0.491928 0.252
NP_442292.1_5 Reverse -225 -244 -0.787193 0.257
NP_441711.1_4 Forward -230 -211 15.0441 0.05
NP_443009.1_5 Reverse -211 -222 14.5128 0.02
NP_443009.1_5 Forward -222 -211 10.1862 0.0792
NP_441715.1_4 Reverse -213 -223 14.238 0.0295
NP_441715.1_4 Forward -220 -210 7.84651 0.107
NP_441198.1_8 Forward -223 -213 13.2713 0.108
NP_440379.1_5 Reverse -253 -272 -9.53865 0.264
NP_440379.1_5 Reverse -186 -205 -9.93197 0.27
NP_441468.1_1 Forward -220 -213 15.8704 0.0124
NP_441468.1_1 Reverse -213 -220 15.8704 0.0124
NP_441468.1_1 Forward -270 -263 3.97235 0.277
NP_441020.2_6 Reverse -210 -227 13.2152 0.0765
NP_441673.1_1 Forward -221 -212 20.8459 0.000698
NP_441673.1_1 Reverse -212 -221 20.8459 0.000698
NP_441673.1_1 Forward -322 -313 -7.86675 0.187
NP_441673.1_1 Reverse -313 -322 -7.96508 0.206
NP_441876.1_9 Forward -296 -286 11.2876 0.278
NP_441826.1_2 Reverse -206 -220 6.3911 0.0937
NP_441826.1_2 Reverse -8 -22 4.52282 0.102
NP_441826.1_2 Forward -328 -314 1.08123 0.164
NP_441826.1_2 Forward -227 -213 -2.45868 0.271
NP_442811.1_2 Forward -62 -43 1.76941 0.252
NP_442868.1_6 Reverse -210 -220 17.4829 0.012
NP_442868.1_6 Forward -324 -314 1.06167 0.205
NP_442868.1_6 Forward -223 -213 1.06167 0.205
NP_442719.1_2 Forward -194 -176 -3.32482 0.2
NP_441056.1_1 Forward -221 -202 -8.35868 0.282
NP_442677.1_7 Forward -81 -71 16.4996 0.273
NP_441612.1_2 Forward -221 -211 8.54929 0.21
NP_443058.1_7 Reverse -139 -158 2.16274 0.294
NP_442361.1_3 Forward -227 -214 9.85238 0.272
NP_442361.1_3 Forward -328 -315 9.06573 0.283
NP_442427.1_3 Reverse -207 -225 3.75572 0.171
NP_442808.1_1 Forward -222 -212 8.73102 0.0481
NP_442808.1_1 Reverse -211 -221 8.63269 0.0481
NP_442808.1_1 Forward -395 -385 5.58445 0.146
NP_442808.1_1 Reverse -358 -368 4.69947 0.192
NP_442808.1_1 Reverse -237 -247 4.40448 0.199
NP_442808.1_1 Reverse -139 -149 3.91283 0.218
NP_442808.1_1 Reverse -226 -236 2.04455 0.279
NP_441101.1_10 Forward -326 -307 -5.80207 0.285
NP_440145.1_3 Reverse -202 -221 8.55425 0.0446
NP_442542.1_9 Forward -228 -214 8.84875 0.148
NP_442050.1_5 Forward -223 -213 18.0724 0.00365
NP_442050.1_5 Reverse -210 -220 15.6142 0.01
NP_440342.1_2 Reverse -71 -90 10.2259 0.261
NP_441114.1_3 Forward -73 -64 6.5879 0.262
NP_440558.1_2 Reverse -325 -344 -3.3438 0.234
NP_440558.1_2 Reverse -225 -244 -5.99873 0.269
NP_441048.1_3 Forward -91 -72 6.09597 0.184
NP_442789.1_4 Forward -273 -254 -8.45701 0.299
NP_441518.1_3 Reverse -202 -221 -13.6686 0.264
NP_441518.1_3 Forward -231 -212 -13.8652 0.264
NP_441878.1_6 Forward -222 -212 10.5014 0.0176
NP_441878.1_6 Reverse -211 -221 10.4031 0.0176
NP_441878.1_6 Reverse -195 -205 0.766681 0.134
NP_441878.1_6 Forward -369 -359 -7.49312 0.231
NP_441878.1_6 Forward -272 -262 -7.59145 0.245
NP_441878.1_6 Reverse -312 -322 -7.98478 0.285
NP_441036.1_8 Forward -222 -212 15.713 0.00724
NP_441036.1_8 Reverse -211 -221 8.33817 0.174
NP_441036.1_8 Reverse -308 -318 6.17489 0.242
NP_441557.1_5 Forward -221 -212 19.9609 0.000699
NP_441557.1_5 Reverse -212 -221 19.9609 0.000699
NP_441557.1_5 Reverse -313 -322 -1.57357 0.291
NP_441445.1_1 Reverse -203 -222 10.9142 0.0912
NP_442066.2_4 Reverse -212 -231 -7.37537 0.28
NP_442066.2_9 Reverse -208 -221 8.18076 0.19
NP_442777.1_3 Reverse -237 -255 5.32826 0.26
NP_440744.1_2 Forward -254 -235 17.243 0.172
NP_441308.1_8 Forward -223 -213 13.353 0.218
NP_441458.1_10 Forward -280 -261 2.0644 0.274
NP_442183.1_1 Reverse -212 -226 9.34103 0.0986
NP_442183.1_1 Forward -221 -207 6.78443 0.161
NP_442183.1_1 Forward -271 -257 4.52282 0.26
NP_441407.1_5 Forward -231 -212 11.8975 0.147
NP_442166.1_3 Reverse -288 -307 -10.4236 0.264
NP_441819.1_5 Forward -48 -29 8.35512 0.295
NP_441549.1_3 Forward -338 -320 20.6687 0.172
NP_441549.1_9 Reverse -208 -226 -6.56903 0.201
NP_442170.1_5 Reverse -212 -231 13.0775 0.0374
NP_442347.1_2 Forward -220 -211 12.4878 0.056
NP_442347.1_2 Reverse -213 -222 3.34298 0.284
NP_442645.1_2 Reverse -204 -223 -13.7669 0.164
NP_442888.1_6 Forward -379 -360 1.57275 0.283
NP_441037.1_4 Reverse -210 -220 9.55921 0.21
NP_441037.1_4 Forward -223 -213 7.31769 0.237
NP_441037.1_4 Reverse -311 -321 6.34312 0.267
NP_442317.1_2 Forward -143 -124 10.9142 0.189
NP_441633.1_3 Forward -223 -210 -3.4223 0.177
NP_441633.1_3 Reverse -210 -223 -6.17557 0.238
NP_440136.1_2 Forward -220 -213 15.9687 0.0123
NP_440136.1_2 Reverse -213 -220 15.9687 0.0123
NP_442590.1_9 Reverse -72 -91 4.52268 0.273
NP_442998.1_10 Forward -219 -212 15.5754 0.0102
NP_442998.1_10 Reverse -214 -221 15.5754 0.0102
NP_440299.1_1 Reverse -258 -271 6.90188 0.127
NP_440299.1_1 Reverse -355 -368 4.14862 0.217
NP_440299.1_1 Reverse -208 -221 3.95196 0.224
NP_441799.1_1 Reverse -208 -222 11.307 0.0591
NP_441799.1_1 Forward -225 -211 11.2087 0.0606
NP_440640.1_6 Forward -161 -142 8.25926 0.17
NP_441007.1_10 Reverse -308 -321 8.86907 0.108
NP_441007.1_10 Reverse -207 -220 3.26421 0.182
NP_441007.1_10 Forward -226 -213 2.77255 0.183
NP_441007.1_10 Reverse -257 -270 0.510939 0.226
NP_442334.1_2 Reverse -202 -219 -5.07437 0.2
NP_442333.2_1 Forward -315 -296 -6.68705 0.256
NP_442333.2_5 Forward -216 -197 -14.0619 0.271
NP_440256.1_1 Reverse -209 -228 6.19431 0.0314
NP_440256.1_1 Forward -202 -183 -4.22878 0.15
NP_440256.1_1 Reverse -241 -260 -5.01543 0.171
NP_440709.1_1 Forward -43 -24 8.94676 0.0834
NP_441559.1_8 Reverse -354 -368 2.85119 0.143
NP_441559.1_8 Reverse -252 -266 1.96621 0.151
NP_440915.1_6 Reverse -208 -222 13.5693 0.0187
NP_442158.1_4 Forward -346 -336 10.5998 0.285
NP_441179.1_9 Reverse -357 -367 10.4026 0.28
NP_442866.1_1 Forward -122 -103 -9.34199 0.292
NP_440748.1_5 Reverse -331 -350 9.24257 0.145
NP_441464.1_8 Forward -322 -308 14.8476 0.112
NP_441464.1_8 Forward -221 -207 8.94771 0.192
NP_441199.1_6 Forward -225 -206 2.26107 0.198
NP_442993.1_1 Forward -221 -205 1.63183 0.0504
NP_442993.1_1 Reverse -212 -228 -0.138127 0.0696
NP_442993.1_1 Reverse -341 -357 -1.3181 0.0893
NP_442993.1_1 Reverse -14 -30 -9.87289 0.197
NP_440677.1_1 Forward -365 -346 11.7008 0.154
NP_442386.1_9 Reverse -211 -220 13.8639 0.0289
NP_442386.1_9 Forward -206 -197 7.07914 0.219
NP_442386.1_9 Forward -222 -213 6.39082 0.219
NP_441750.1_1 Forward -337 -318 -9.93197 0.3
NP_441340.1_5 Forward -220 -213 15.6737 0.0124
NP_441340.1_5 Reverse -213 -220 15.6737 0.0124
NP_441340.1_5 Reverse -263 -270 11.0522 0.0749
NP_441271.1_8 Forward -291 -281 15.5163 0.266
NP_440168.1_4 Reverse -252 -271 -5.60541 0.255
NP_440586.1_1 Reverse -73 -92 -5.31042 0.285
NP_440586.1_8 Forward -220 -213 13.2151 0.026
NP_440586.1_8 Reverse -213 -220 13.2151 0.026
NP_440586.1_8 Reverse -320 -327 5.8403 0.283
NP_442251.1_6 Forward -220 -213 15.2804 0.0124
NP_442251.1_6 Reverse -213 -220 15.2804 0.0124
NP_441262.1_3 Reverse -212 -219 14.7888 0.0223
NP_441262.1_3 Forward -221 -214 14.7888 0.0223
NP_440027.1_3 Forward -328 -310 2.47668 0.289
NP_443051.1_1 Forward -222 -213 19.5676 0.00335
NP_443051.1_1 Reverse -211 -220 10.4228 0.00754
NP_439937.1_9 Forward -239 -222 -0.551837 0.122
NP_439937.1_9 Forward -199 -182 -11.7615 0.264
NP_439937.1_9 Forward -318 -301 -13.5315 0.287
NP_439937.1_9 Reverse -226 -243 -15.2031 0.287
NP_440408.1_7 Forward -253 -234 10.3242 0.247
NP_440626.1_1 Reverse -245 -264 10.2251 0.247
NP_440439.1_1 Forward -224 -211 1.88757 0.139
NP_440439.1_1 Reverse -209 -222 1.10092 0.162
NP_440439.1_1 Reverse -71 -84 -0.472371 0.221
NP_440439.1_1 Reverse -382 -395 -0.767364 0.236
NP_440372.1_2 Forward -220 -213 16.3621 0.0124
NP_440372.1_2 Reverse -213 -220 16.3621 0.0124
NP_440574.1_3 Forward -355 -336 1.0811 0.201
NP_441789.1_7 Forward -230 -211 -5.1145 0.293
NP_440819.1_4 Forward -252 -233 20.059 0.0246
NP_440316.1_10 Reverse -195 -205 8.1415 0.24
NP_441803.1_2 Forward -226 -207 1.96607 0.222
NP_440267.1_2 Forward -226 -212 17.7968 0.0349
NP_440267.1_2 Forward -28 -14 11.7003 0.125
NP_440267.1_2 Forward -88 -74 9.6354 0.156
NP_442384.1_10 Forward -368 -355 5.32916 0.131
NP_442384.1_10 Forward -394 -381 1.39592 0.26
NP_441877.1_7 Forward -276 -257 15.7316 0.0595
NP_442262.1_10 Forward -220 -213 14.1988 0.0123
NP_442262.1_10 Reverse -213 -220 14.1988 0.0123
NP_442262.1_10 Forward -204 -197 9.47889 0.187
NP_442262.1_10 Reverse -263 -270 7.90559 0.266
NP_441689.1_5 Forward -223 -213 17.8758 0.0158
NP_441689.1_5 Reverse -210 -220 5.87944 0.197
NP_440163.1_10 Forward -325 -315 11.6814 0.169
NP_440163.1_10 Forward -152 -142 9.61647 0.229
NP_440344.1_10 Forward -228 -211 -7.13932 0.115
NP_440282.1_10 Reverse -234 -253 -1.37718 0.221
NP_440531.1_6 Forward -229 -210 -3.24547 0.264
NP_440531.1_8 Reverse -77 -96 3.34271 0.269
NP_441965.1_10 Reverse -94 -110 2.32015 0.288
NP_441965.1_10 Reverse -316 -332 2.22182 0.289
NP_440297.1_9 Reverse -213 -223 9.22315 0.0917
NP_440297.1_9 Forward -204 -194 9.22315 0.0917
NP_440297.1_9 Reverse -197 -207 -0.118297 0.282
NP_440297.1_9 Forward -220 -210 -0.216628 0.282
NP_441103.1_9 Forward -296 -286 13.6614 0.243
NP_440894.1_10 Forward -399 -380 14.0608 0.102
NP_440894.1_10 Forward -339 -320 3.24438 0.276
NP_440999.1_9 Reverse -355 -369 6.6861 0.0962
NP_440999.1_9 Reverse -208 -222 1.76955 0.158
NP_440999.1_9 Forward -317 -303 0.982901 0.172
NP_440999.1_9 Reverse -309 -323 0.491246 0.183
NP_440888.1_2 Forward -221 -207 17.5018 0.00388
NP_440888.1_2 Reverse -212 -226 16.2235 0.00758
NP_440600.1_4 Forward -229 -211 -7.94566 0.294
NP_440491.1_1 Reverse -209 -228 13.1543 0.13
NP_440491.1_1 Forward -281 -262 9.84073 0.206
NP_440105.1_7 Forward -175 -156 14.9458 0.204
NP_441543.1_2 Forward -220 -211 16.9127 0.00359
NP_441543.1_2 Reverse -213 -222 15.9293 0.00518
NP_441543.1_2 Reverse -263 -272 13.1761 0.0284
NP_441543.1_2 Forward -367 -358 4.32629 0.26
NP_442845.1_2 Reverse -206 -220 11.5043 0.128
NP_442845.1_2 Forward -227 -213 3.73617 0.279
NP_441304.1_10 Forward -51 -42 14.1594 0.207
NP_441551.1_5 Reverse -70 -86 12.9392 0.14
NP_441551.1_5 Reverse -208 -224 6.74435 0.258
NP_440982.1_1 Forward -23 -4 16.7149 0.0714
NP_441469.1_8 Forward -222 -213 6.5879 0.227
NP_441469.1_8 Reverse -211 -220 6.48957 0.227
NP_441469.1_8 Forward -272 -263 5.80125 0.253
NP_442315.1_2 Reverse -181 -193 9.87208 0.291
NP_443064.1_6 Forward -221 -211 12.5669 0.0796
NP_443064.1_6 Reverse -212 -222 10.8217 0.13
NP_442578.1_7 Forward -220 -213 14.5921 0.026
NP_442578.1_7 Reverse -213 -220 14.5921 0.026
NP_440710.1_1 Forward -229 -211 7.29564 0.113
NP_442286.1_1 Forward -221 -202 9.53756 0.246
NP_442286.1_2 Forward -340 -322 24.0119 0.0324
NP_442286.1_4 Forward -175 -156 26.7455 0.00181
NP_442286.1_6 Forward -267 -248 17.2074 0.228
NP_442286.1_7 Forward -196 -177 24.483 0.0155
NP_441462.1_2 Reverse -212 -222 20.2362 0.000805
NP_441462.1_2 Forward -221 -211 11.5831 0.00406
NP_441462.1_2 Forward -322 -312 0.373358 0.154
NP_441621.1_3 Reverse -282 -300 17.4237 0.148
NP_441621.1_7 Reverse -311 -325 -5.11362 0.248
NP_441621.1_7 Reverse -210 -224 -5.31028 0.25
NP_441621.1_7 Reverse -260 -274 -6.09693 0.275
NP_443062.1_1 Reverse -212 -230 20.3443 0.0208
NP_443062.1_1 Forward -221 -203 15.5664 0.0373
NP_443062.1_1 Reverse -262 -280 3.96308 0.279
NP_442204.1_1 Forward -225 -214 0.157002 0.283
NP_442204.1_6 Reverse -187 -206 4.62101 0.287
NP_440516.1_2 Forward -400 -382 1.78911 0.186
NP_440516.1_8 Forward -221 -212 16.9127 0.00442
NP_440516.1_8 Reverse -212 -221 16.9127 0.00442
NP_442428.1_5 Forward -220 -213 15.8704 0.0124
NP_442428.1_5 Reverse -213 -220 15.8704 0.0124
NP_442428.1_5 Forward -270 -263 4.36568 0.271
NP_442120.1_10 Reverse -341 -360 -5.99873 0.203
NP_440673.1_2 Forward -266 -247 11.7553 0.165
NP_440673.1_2 Reverse -202 -221 10.8773 0.194
NP_440673.1_2 Reverse -252 -271 10.292 0.217
NP_440673.1_3 Forward -219 -212 12.4288 0.0426
NP_440673.1_3 Reverse -214 -221 12.4288 0.0426
NP_440673.1_7 Forward -232 -213 1.96607 0.235
NP_441052.1_2 Forward -221 -211 19.9412 0.00106
NP_441052.1_2 Reverse -212 -222 10.4031 0.0285
NP_441052.1_2 Forward -271 -261 3.81494 0.173
NP_441052.1_2 Forward -74 -64 2.83163 0.19
NP_441052.1_2 Forward -368 -358 1.06167 0.252
NP_442219.1_9 Forward -220 -211 17.7976 0.00718
NP_442219.1_9 Reverse -213 -222 8.25953 0.0681
NP_440436.1_4 Forward -220 -211 17.2072 0.00233
NP_440436.1_4 Reverse -213 -222 9.24241 0.0871
NP_440436.1_4 Reverse -263 -272 5.70251 0.186
NP_441884.1_9 Reverse -209 -228 -22.3217 0.277
NP_441884.1_9 Forward -274 -255 -22.6167 0.281
NP_441336.1_3 Reverse -378 -392 14.5526 0.298
NP_440314.1_9 Forward -220 -201 7.66927 0.0442
NP_440648.1_1 Reverse -212 -231 12.7825 0.105
NP_442907.1_2 Forward -220 -202 8.47561 0.269
NP_441719.1_4 Forward -220 -213 16.3621 0.0124
NP_441719.1_4 Reverse -213 -220 16.3621 0.0124
NP_441733.1_10 Reverse -209 -222 10.2457 0.106
NP_440746.1_3 Reverse -109 -128 0.884433 0.267
NP_441004.1_1 Forward -337 -318 -6.68705 0.19
NP_441004.1_1 Forward -271 -252 -8.752 0.202
NP_442366.1_3 Reverse -211 -229 -0.374176 0.19
NP_442366.1_3 Forward -351 -333 -0.472507 0.191
NP_442366.1_3 Reverse -6 -24 -2.14413 0.221
NP_440129.1_9 Reverse -336 -355 4.42435 0.299
NP_440296.1_10 Forward -256 -237 -13.1769 0.269
NP_441115.1_4 Reverse -333 -351 9.16315 0.223
NP_441115.1_4 Forward -24 -6 8.3765 0.25
NP_442694.1_3 Reverse -309 -327 5.13236 0.242
NP_442694.1_4 Reverse -176 -185 15.536 0.164
NP_442694.1_4 Reverse -79 -88 14.2577 0.188
NP_440288.1_3 Reverse -165 -184 8.16093 0.261
NP_443054.1_2 Forward -223 -209 12.291 0.0722
NP_443054.1_2 Forward -359 -345 5.01447 0.24
NP_442430.1_10 Forward -231 -212 10.3234 0.262
NP_441851.1_6 Forward -42 -23 18.4065 0.125
NP_441851.1_10 Reverse -211 -221 15.8113 0.00552
NP_441851.1_10 Forward -222 -212 8.53483 0.114
NP_441851.1_10 Forward -272 -262 4.50326 0.266
NP_442208.1_5 Forward -280 -261 -7.4737 0.274
NP_441501.1_4 Reverse -71 -90 19.6656 0.147
NP_442515.1_1 Forward -323 -309 5.01447 0.107
NP_442515.1_1 Forward -222 -208 3.34284 0.12
NP_442515.1_1 Reverse -211 -225 2.65453 0.131
NP_441396.1_5 Forward -244 -235 7.37455 0.279
NP_440593.1_9 Forward -325 -311 14.1593 0.24
NP_441982.1_6 Forward -189 -180 11.1485 0.288
NP_441349.1_10 Reverse -202 -221 -0.197208 0.0936
NP_441349.1_10 Forward -231 -212 -1.86883 0.109
NP_441349.1_10 Forward -281 -262 -6.68705 0.235
NP_441349.1_10 Reverse -300 -319 -8.45701 0.275
NP_440155.1_3 Forward -31 -12 9.63589 0.225
NP_442024.1_9 Reverse -264 -277 17.1289 0.201
NP_441409.1_6 Reverse -206 -225 -7.67036 0.154
NP_441409.1_6 Forward -227 -208 -8.26035 0.165
NP_440432.1_9 Reverse -213 -228 15.5162 0.0126
NP_440432.1_9 Forward -220 -205 -0.216765 0.164
NP_442843.1_1 Reverse -197 -216 2.65439 0.16
NP_442843.1_1 Forward -137 -118 -11.2103 0.286
NP_439960.1_10 Reverse -78 -96 -4.20908 0.292
NP_440474.1_8 Reverse -213 -227 13.1753 0.0735
NP_440474.1_8 Forward -220 -206 10.1271 0.146
NP_440474.1_8 Forward -321 -307 6.48882 0.226
NP_440431.1_3 Forward -369 -350 -11.8003 0.291
NP_442450.1_5 Forward -223 -213 9.41981 0.115
NP_441031.1_1 Forward -45 -26 6.82273 0.259
NP_440954.1_1 Reverse -74 -93 -11.0136 0.289
NP_443047.1_7 Reverse -213 -232 4.71934 0.256
NP_441570.1_1 Reverse -212 -230 17.5221 0.00337
NP_441570.1_1 Forward -253 -235 -16.5005 0.247
NP_440078.1_10 Reverse -313 -332 10.3242 0.182
NP_441078.1_4 Forward -221 -212 19.6659 0.0007
NP_441078.1_4 Reverse -212 -221 19.6659 0.0007
NP_441078.1_4 Forward -368 -359 6.29291 0.079
NP_441078.1_4 Forward -271 -262 6.09625 0.0863
NP_441078.1_4 Reverse -359 -368 -2.06522 0.295
NP_441078.1_4 Reverse -262 -271 -2.06522 0.295
NP_442348.1_2 Reverse -78 -87 10.5211 0.263
NP_442348.1_2 Reverse -175 -184 7.47288 0.28
NP_440707.1_6 Forward -229 -210 10.1267 0.29
NP_440526.1_3 Forward -220 -209 20.0193 0.0113
NP_440526.1_3 Reverse -213 -224 1.82816 0.267
NP_440526.1_3 Forward -22 -11 1.53316 0.267
NP_440526.1_3 Forward -321 -310 0.156538 0.297
NP_441432.1_8 Reverse -211 -220 16.8143 0.00595
NP_441432.1_8 Forward -222 -213 16.8143 0.00595
NP_441432.1_8 Forward -369 -360 9.73449 0.0754
NP_441432.1_8 Forward -272 -263 4.22796 0.235
NP_441432.1_8 Forward -248 -239 4.22796 0.235
NP_441432.1_8 Reverse -340 -349 2.55633 0.298
NP_442320.1_8 Reverse -206 -220 5.99778 0.0309
NP_442320.1_8 Forward -227 -213 4.03116 0.0559
NP_442344.1_7 Reverse -213 -232 -8.45701 0.215
NP_441732.1_2 Forward -225 -209 2.71347 0.0186
NP_440313.1_5 Reverse -284 -302 15.2596 0.214
NP_440497.1_6 Forward -333 -314 1.86774 0.239
NP_440497.1_6 Reverse -239 -258 -4.72043 0.264
NP_440760.1_1 Forward -221 -202 -14.1602 0.125
NP_440760.1_1 Forward -271 -252 -15.6352 0.152
NP_440131.1_1 Reverse -252 -271 6.09597 0.188
NP_440199.1_10 Forward -224 -214 14.238 0.0861
NP_440199.1_10 Reverse -209 -219 7.35486 0.231
NP_441945.1_10 Reverse -1 -20 6.88262 0.291
NP_441057.1_4 Reverse -253 -271 -3.02911 0.278
NP_442353.1_1 Forward -395 -376 5.01433 0.233
NP_442353.1_3 Forward -90 -71 10.1267 0.184
NP_442353.1_6 Reverse -377 -396 9.3409 0.298
NP_440913.1_1 Reverse -210 -228 13.2938 0.139
NP_440913.1_1 Reverse -6 -24 7.39397 0.202
NP_441072.1_2 Reverse -201 -220 12.3892 0.173
NP_441072.1_2 Forward -232 -213 5.40766 0.296
NP_440713.1_4 Reverse -375 -394 4.71934 0.223
NP_442489.1_7 Forward -221 -212 20.1576 0.000695
NP_442489.1_7 Reverse -212 -221 20.1576 0.000695
NP_442489.1_7 Forward -368 -359 -1.6719 0.235
NP_442489.1_7 Forward -271 -262 -1.6719 0.235
NP_440559.1_1 Forward -220 -211 17.4043 0.00658
NP_440559.1_1 Reverse -213 -222 8.65285 0.0586
NP_441659.2_8 Reverse -212 -222 20.9245 0.000805
NP_441659.2_8 Forward -221 -211 18.1713 0.00133
NP_441659.2_8 Forward -322 -312 3.61828 0.154
NP_442913.1_10 Forward -230 -211 11.6025 0.0421
NP_442913.1_10 Reverse -203 -222 5.99764 0.0664
NP_442913.1_10 Reverse -304 -323 -4.13045 0.227
NP_442849.1_1 Reverse -183 -197 21.6324 0.046
NP_439956.1_7 Forward -259 -240 7.17762 0.257
NP_441800.1_7 Forward -25 -7 -2.43913 0.263
NP_440779.1_5 Reverse -212 -229 -14.5141 0.246
NP_442346.1_5 Reverse -211 -221 16.6963 0.00248
NP_442346.1_5 Forward -222 -212 16.303 0.00248
NP_442346.1_5 Forward -369 -359 8.4365 0.137
NP_442346.1_5 Reverse -195 -205 5.5849 0.238
NP_440352.1_5 Reverse -192 -211 9.73562 0.289
NP_440545.1_3 Reverse -208 -225 -4.09106 0.218
NP_440545.1_3 Forward -326 -309 -5.56602 0.253
NP_440025.1_1 Reverse -208 -227 12.4875 0.147
NP_441629.1_3 Forward -90 -71 0.490334 0.235
NP_441923.1_6 Reverse -66 -80 10.226 0.274
NP_440459.1_2 Forward -230 -213 7.90532 0.276
NP_441948.1_4 Forward -228 -210 -4.11075 0.217
NP_439970.1_4 Forward -346 -327 1.76941 0.293
NP_441833.1_4 Forward -220 -213 15.9687 0.0124
NP_441833.1_4 Reverse -213 -220 15.9687 0.0124
NP_440751.1_3 Forward -89 -70 5.80018 0.29
NP_442498.1_7 Reverse -84 -101 19.6817 0.108
NP_442060.1_9 Reverse -57 -76 7.27595 0.261
NP_441112.1_6 Forward -231 -212 9.24257 0.122
NP_442162.1_9 Forward -220 -213 16.2637 0.0124
NP_442162.1_9 Reverse -213 -220 16.2637 0.0124
NP_440671.1_4 Forward -328 -314 14.3559 0.0632
NP_440671.1_4 Reverse -206 -220 5.89945 0.27
NP_440671.1_4 Forward -227 -213 5.50613 0.281
NP_442199.1_5 Forward -229 -210 -4.22878 0.221
NP_442140.1_1 Reverse -131 -150 13.1415 0.275
NP_442140.1_3 Forward -220 -210 13.5497 0.0542
NP_442140.1_3 Reverse -263 -273 6.8632 0.158
NP_442140.1_3 Forward -327 -317 4.99491 0.232
NP_442140.1_3 Forward -270 -260 3.81494 0.278
NP_441671.1_10 Forward -94 -75 15.2408 0.137
NP_440875.1_9 Forward -219 -209 8.66404 0.233
NP_440875.1_9 Reverse -214 -224 7.59334 0.255
NP_441813.1_5 Forward -223 -213 15.9097 0.01
NP_441813.1_5 Reverse -210 -220 8.73149 0.0367
NP_441813.1_5 Forward -273 -263 -0.118297 0.234
NP_442089.1_1 Forward -259 -240 7.47261 0.123
NP_440590.1_4 Forward -220 -207 13.1956 0.013
NP_440590.1_4 Reverse -213 -226 -5.78224 0.289
NP_440567.1_1 Reverse -213 -227 6.29277 0.085
NP_440567.1_1 Forward -220 -206 0.589577 0.24
NP_440567.1_4 Reverse -174 -193 1.86774 0.261
NP_442497.1_10 Reverse -213 -222 17.601 0.00813
NP_442497.1_10 Forward -220 -211 10.4228 0.0087
NP_442497.1_10 Forward -321 -312 -0.983583 0.224
NP_440821.1_4 Reverse -210 -220 17.9746 0.00497
NP_440821.1_4 Forward -223 -213 11.0914 0.0146
NP_440821.1_4 Reverse -311 -321 -0.0199663 0.217
NP_440821.1_4 Forward -324 -314 -0.708283 0.287
NP_441239.1_9 Forward -207 -195 15.6736 0.0186
NP_441239.1_9 Forward -223 -211 12.1337 0.0494
NP_441239.1_9 Reverse -210 -222 7.11881 0.169
NP_441239.1_9 Forward -100 -88 4.5622 0.251
NP_441239.1_9 Forward -18 -6 4.5622 0.251
NP_441239.1_9 Forward -85 -73 4.16888 0.26
NP_441892.1_1 Forward -230 -213 6.62702 0.0946
NP_441892.1_1 Reverse -187 -204 -0.0594896 0.177
NP_441892.1_1 Reverse -203 -220 -5.76269 0.288
NP_440665.1_1 Forward -161 -142 -1.27885 0.177
NP_440604.1_6 Reverse -212 -231 6.19431 0.107
NP_440604.1_6 Forward -253 -234 1.17943 0.162
NP_441017.1_6 Forward -225 -211 12.192 0.224
NP_442772.1_1 Forward -43 -24 15.1147 0.292
NP_441769.1_1 Reverse -248 -267 10.1275 0.195
NP_440833.1_8 Reverse -217 -236 16.5191 0.266
NP_443035.1_10 Reverse -67 -84 7.70866 0.273
NP_440354.1_7 Reverse -256 -274 6.90232 0.278
NP_440546.1_4 Reverse -212 -222 13.5365 0.0459
NP_440546.1_4 Forward -221 -211 10.046 0.109
NP_440546.1_4 Reverse -319 -329 8.20381 0.199
NP_440546.1_4 Forward -199 -189 6.8464 0.276
NP_440462.1_6 Forward -223 -213 16.893 0.00853
NP_440462.1_6 Reverse -210 -220 10.3048 0.0396
NP_440868.1_4 Reverse -208 -220 7.21714 0.0749
NP_440868.1_4 Forward -225 -213 5.93884 0.0879
NP_442499.1_1 Forward -82 -63 8.25926 0.203
NP_442499.1_1 Forward -270 -251 5.01433 0.226
NP_442499.1_3 Forward -272 -254 3.65739 0.289
NP_441474.1_1 Reverse -234 -253 -3.44288 0.299
NP_442402.1_4 Forward -244 -225 -4.91784 0.233
NP_442402.1_4 Forward -201 -182 -8.55607 0.283
NP_442402.1_10 Forward -235 -225 14.8275 0.18
NP_441084.1_6 Forward -223 -209 13.0285 0.146
NP_441084.1_6 Reverse -332 -346 12.3498 0.164
NP_441084.1_6 Forward -25 -11 11.2833 0.208
NP_441084.1_6 Forward -85 -71 10.9924 0.225
NP_441084.1_6 Forward -330 -316 10.6046 0.234
NP_439942.1_7 Reverse -370 -389 4.03102 0.167
NP_441843.2_9 Reverse -214 -232 10.3948 0.238
NP_442923.1_4 Reverse -2 -21 -3.44213 0.234
NP_442039.1_4 Forward -220 -213 15.1821 0.0124
NP_442039.1_4 Reverse -213 -220 15.1821 0.0124
NP_442039.1_7 Forward -326 -316 13.353 0.211
NP_442039.1_7 Forward -14 -4 7.15819 0.279
NP_442273.1_10 Forward -263 -245 3.95239 0.288
NP_441926.1_3 Reverse -212 -228 15.1032 0.0428
NP_441926.1_3 Forward -221 -205 7.33503 0.17
NP_440825.1_6 Reverse -294 -313 9.53756 0.285
NP_440825.1_7 Forward -42 -32 11.0554 0.278
NP_442837.1_3 Forward -220 -213 15.7721 0.0124
NP_442837.1_3 Reverse -213 -220 15.7721 0.0124
NP_440160.1_1 Forward -44 -25 9.86352 0.249
NP_439994.1_3 Forward -222 -203 8.43855 0.291
NP_442053.1_1 Forward -221 -212 18.3876 0.0007
NP_442053.1_1 Reverse -212 -221 18.3876 0.0007
NP_440505.1_3 Reverse -210 -220 16.598 0.00683
NP_440505.1_3 Forward -223 -213 15.123 0.014
NP_441252.1_6 Reverse -183 -190 14.3954 0.168
NP_442532.1_7 Forward -271 -257 4.62115 0.171
NP_442532.1_7 Forward -328 -314 2.94952 0.214
NP_440914.1_1 Forward -221 -211 17.5935 0.000537
NP_440914.1_1 Reverse -212 -222 16.3248 0.00196
NP_440914.1_1 Reverse -335 -345 8.41992 0.191
NP_441011.1_8 Reverse -213 -222 16.6177 0.00602
NP_441011.1_8 Forward -220 -211 8.25953 0.144
NP_442101.1_10 Forward -229 -210 2.65439 0.0714
NP_442533.1_6 Forward -221 -212 17.2076 0.00137
NP_442533.1_6 Reverse -212 -221 17.2076 0.00137
NP_442533.1_6 Forward -368 -359 5.01461 0.16
NP_442533.1_6 Forward -205 -196 3.7363 0.204
NP_442533.1_6 Reverse -74 -83 2.16301 0.27
NP_442533.1_6 Reverse -14 -23 1.67135 0.293
NP_442541.1_10 Forward -205 -191 7.07881 0.247
NP_442322.1_4 Forward -91 -74 0.529798 0.21
NP_442322.1_4 Forward -397 -380 -7.23831 0.279
NP_443016.1_1 Reverse -59 -78 -7.17871 0.27
NP_443016.1_5 Forward -196 -177 4.12856 0.292
NP_441482.1_7 Forward -328 -314 -1.27871 0.0666
NP_441482.1_7 Forward -227 -213 -10.9151 0.222
NP_439944.1_9 Forward -220 -210 19.1546 0.00329
NP_439944.1_9 Reverse -213 -223 17.6796 0.00347
NP_439944.1_9 Forward -270 -260 11.6814 0.0887
NP_441028.1_6 Forward -210 -200 5.38779 0.255
NP_441028.1_6 Forward -297 -287 3.71617 0.281
NP_441028.1_6 Forward -296 -286 3.42118 0.296
NP_440115.1_6 Reverse -209 -219 9.81313 0.115
NP_440007.1_9 Reverse -331 -345 3.34284 0.27
NP_440007.1_9 Forward -225 -211 2.85119 0.277
NP_443045.1_2 Forward -211 -192 12.4875 0.293
NP_443045.1_3 Reverse -358 -377 15.9291 0.254
NP_441170.1_4 Reverse -220 -238 2.18243 0.285
NP_441972.1_5 Forward -22 -3 -8.35868 0.263
NP_441106.1_1 Forward -222 -213 18.486 0.0028
NP_441106.1_1 Reverse -211 -220 9.63616 0.0311
NP_441106.1_1 Forward -272 -263 5.21127 0.167
NP_441106.1_1 Reverse -73 -82 2.75299 0.261
NP_440429.1_4 Forward -228 -209 11.6025 0.296
NP_442455.1_7 Forward -234 -215 22.1578 0.0741
NP_441825.1_4 Reverse -175 -185 15.8113 0.186
NP_442588.1_6 Reverse -168 -187 -2.45882 0.294
NP_441286.1_1 Reverse -211 -223 14.3953 0.00424
NP_441286.1_1 Forward -222 -210 12.232 0.00999
NP_441286.1_1 Forward -323 -311 -3.89426 0.147
NP_442674.1_10 Forward -250 -231 12.8808 0.205
NP_440670.1_8 Forward -221 -212 18.3876 0.000699
NP_440670.1_8 Reverse -212 -221 18.3876 0.000699
NP_440886.1_7 Forward -222 -212 8.04271 0.0805
NP_440886.1_7 Reverse -211 -221 7.94438 0.0805
NP_440886.1_7 Forward -314 -304 5.28945 0.188
NP_440828.1_4 Forward -84 -65 -5.60616 0.258
NP_441001.1_10 Reverse -252 -271 4.52268 0.293
NP_442614.1_2 Forward -322 -308 7.17775 0.275
NP_439995.1_5 Forward -231 -212 3.73603 0.291
NP_442072.1_9 Forward -222 -204 -11.0923 0.0789
NP_442072.1_9 Reverse -211 -229 -11.4856 0.0789
NP_441753.1_10 Forward -230 -211 12.7825 0.101
NP_441403.1_4 Reverse -180 -198 9.26226 0.282
NP_441808.1_8 Reverse -367 -386 5.89931 0.294
NP_440907.2_8 Forward -220 -210 10.8943 0.0969
NP_440907.2_8 Reverse -213 -223 9.51767 0.103
NP_442264.1_2 Reverse -309 -326 13.7068 0.141
NP_441021.1_8 Forward -226 -208 3.16574 0.234
NP_440326.1_5 Reverse -210 -223 13.589 0.229
NP_441463.1_3 Forward -231 -212 5.80098 0.0697
NP_441463.1_3 Reverse -237 -256 3.6377 0.0997
NP_441463.1_6 Forward -223 -209 10.1846 0.242
NP_441626.1_2 Forward -220 -213 15.7721 0.0124
NP_441626.1_2 Reverse -213 -220 15.7721 0.0124
NP_442615.1_1 Reverse -203 -221 2.67408 0.0637
NP_442467.1_4 Reverse -212 -231 8.94757 0.198
NP_441962.1_4 Forward -327 -308 -7.17871 0.185
NP_440387.1_1 Reverse -212 -228 -1.12144 0.142
NP_440387.1_1 Forward -221 -205 -1.21977 0.142
NP_440387.1_1 Reverse -313 -329 -1.3181 0.142
NP_440855.1_1 Forward -334 -315 -0.885524 0.266
NP_440634.1_6 Reverse -228 -242 16.8142 0.191
NP_441993.1_1 Reverse -8 -27 18.3195 0.0394
NP_441993.1_1 Reverse -206 -225 5.35769 0.205
NP_441993.1_1 Reverse -212 -231 2.43397 0.259
NP_440143.1_1 Reverse -325 -344 14.5524 0.246
NP_440114.1_10 Reverse -212 -226 19.3708 0.00349
NP_440114.1_10 Reverse -341 -355 9.93102 0.159
NP_440114.1_10 Forward -221 -207 7.86607 0.223
NP_442323.1_7 Forward -349 -330 9.14342 0.163
NP_440287.1_6 Reverse -203 -222 5.211 0.185
NP_440293.1_3 Reverse -72 -91 -5.99873 0.285
NP_441237.1_9 Forward -220 -210 14.9263 0.0242
NP_442743.1_1 Forward -215 -196 11.3067 0.241
NP_439910.1_2 Reverse -204 -221 -11.9575 0.0788
NP_439910.1_2 Forward -229 -212 -12.1542 0.0788
NP_440457.1_1 Reverse -192 -204 1.61227 0.232
NP_440457.1_1 Forward -225 -213 0.137309 0.25
NP_440213.1_5 Forward -355 -336 10.2259 0.247
NP_442940.1_2 Forward -238 -219 0.491109 0.296
NP_440798.1_6 Reverse -213 -226 3.16588 0.152
NP_441801.1_4 Forward -113 -103 3.02829 0.231
NP_441984.1_3 Forward -27 -9 15.0638 0.124
NP_441984.1_3 Forward -160 -142 5.62401 0.279
NP_440473.1_9 Reverse -201 -220 -7.17871 0.236
NP_440473.1_9 Reverse -63 -82 -7.17871 0.236
NP_442509.1_9 Forward -221 -211 8.14104 0.192
NP_442509.1_9 Reverse -212 -222 8.04271 0.192
NP_441253.1_1 Forward -230 -211 10.0292 0.205
NP_442514.1_5 Reverse -276 -295 -5.31116 0.257
NP_440554.1_4 Reverse -213 -223 16.1063 0.0189
NP_440554.1_4 Forward -220 -210 6.37155 0.123
NP_440554.1_4 Reverse -263 -273 3.81494 0.213
NP_441885.1_5 Forward -221 -211 20.9245 0.000538
NP_441885.1_5 Reverse -212 -222 11.3864 0.00668
NP_441885.1_5 Forward -271 -261 0.766681 0.123
NP_441275.1_1 Reverse -22 -40 8.47561 0.113
NP_442341.1_7 Forward -222 -208 2.16287 0.267
NP_442341.1_9 Forward -223 -209 7.96378 0.182
NP_441756.1_5 Reverse -70 -89 1.27776 0.217
NP_441173.1_9 Forward -232 -224 11.0321 0.228
NP_442395.2_4 Forward -395 -376 -0.591301 0.298
NP_440423.1_6 Reverse -204 -223 -21.24 0.284
NP_443000.1_7 Forward -223 -213 17.4829 0.00719
NP_443000.1_7 Reverse -210 -220 10.4031 0.0345
NP_441842.1_10 Forward -228 -214 7.27608 0.264
NP_440275.1_3 Reverse -210 -220 17.6796 0.0102
NP_440275.1_3 Reverse -311 -321 9.22315 0.055
NP_440275.1_3 Forward -223 -213 9.12481 0.055
NP_440275.1_3 Forward -367 -357 1.84832 0.282
NP_440091.1_1 Reverse -208 -220 18.3285 0.0114
NP_440091.1_1 Forward -225 -213 8.9871 0.0567
NP_443010.1_10 Forward -224 -207 13.014 0.0803
NP_439962.1_4 Reverse -254 -273 -8.85033 0.298
NP_440149.1_8 Forward -253 -234 -1.08219 0.156
NP_441105.1_3 Forward -34 -15 -5.11376 0.213
NP_440216.1_1 Reverse -212 -226 15.8309 0.00314
NP_440216.1_1 Forward -221 -207 -1.77037 0.0383
NP_440172.1_1 Reverse -212 -222 17.5813 0.00421
NP_440172.1_1 Forward -221 -211 15.0247 0.00945
NP_442788.1_7 Forward -256 -237 8.45592 0.278
NP_442015.1_10 Reverse -355 -368 -0.472371 0.268
NP_441226.1_7 Forward -220 -213 14.4934 0.0123
NP_441226.1_7 Reverse -213 -220 14.4934 0.0123
NP_442446.1_5 Reverse -214 -233 14.0608 0.0973
NP_442834.1_9 Reverse -194 -213 8.75091 0.176
NP_441111.1_7 Forward -220 -212 18.7023 0.00294
NP_441111.1_7 Reverse -213 -221 18.7023 0.00294
NP_441111.1_7 Reverse -314 -322 -0.275572 0.0693
NP_442379.1_10 Reverse -205 -222 8.29864 0.102
NP_442379.1_10 Forward -228 -211 5.34871 0.132
NP_441766.1_2 Forward -221 -212 17.5026 0.00297
NP_441766.1_2 Reverse -212 -221 17.5026 0.00297
NP_441766.1_2 Reverse -313 -322 3.44131 0.212
NP_440416.1_1 Reverse -212 -231 -4.42544 0.128
NP_440416.1_9 Forward -216 -197 -18.0934 0.251
NP_440416.1_9 Forward -339 -320 -20.65 0.287
NP_440416.1_9 Forward -206 -187 -21.0434 0.29
NP_443052.1_8 Forward -231 -212 8.55425 0.0249
NP_443052.1_8 Reverse -202 -221 2.0644 0.0585
NP_443052.1_8 Reverse -303 -322 -0.295539 0.0688
NP_443052.1_9 Forward -273 -254 -5.80207 0.274
NP_442154.1_1 Reverse -80 -98 -8.92897 0.174
NP_442154.1_1 Forward -255 -237 -14.7305 0.218
NP_442154.1_1 Reverse -254 -272 -15.3205 0.218
NP_442154.1_1 Reverse -66 -84 -17.6804 0.262
NP_440261.1_5 Forward -220 -207 -3.02898 0.108
NP_440261.1_5 Reverse -213 -226 -10.6988 0.203
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTACCGCTGAACCCCTCCGGCAAGAATTACAGGCTATGACCGGGGAAACTCCCATTGTCATTGGCTTTGAAAACCATGGCGGCCGCACCTATCTCCAAACCGTTTCTCCCCTGGGTAAGGTTAAAACCGGCTATGGCAACAACGGCGAAGATGGCTTTGAGGGGGCTTTCCACCAAAAGGCGATCGCCACTTACTCCCATGGCCCTCTGTTGCCCAAAAATCCCTTTTTAGCTGATTGGTTAATCCGCACGGCGTTGGAGAAGAAGTATCAGGATTCGGTGCAGTTAACTCCCTTGGATGACTGCCTCGCCCAACAAGCCCGCGCCGCCATGCTCAAACGGCTAGAATAGGAGCAATTTGATTACAAAATGTAACAAGCCCTCACCACTGGCAGAGATT

CDS

ATGACGGACGCTCGACCACGGATTTGTATTTTAGGGGGAGGATTTGGCGGACTTTACACCGCTCTACGCCTCGGTCAACTATCCTGGGAGGGCCATACCCCACCGGAAATTGTCCTCGTCGACCAACGGGATCGGTTTTTATTTGCCCCTTTCCTCTACGAACTGGTAACAGAGGAAATGCAAACTTGGGAAATTGCCCCTCCTTTTGTAGAACTTTTAGCGGAATCGGGGGTAATTTTTCGTCAGGCGGAAGTGACCGCCATTGATTTTGACCACCAAAAAGTGTTGTTAAATGACCAGGACAAGGGCACCGAAAGTTTAGCGTTTGATCAGTTAGTCATTGCCCTGGGGGGCCAAACTCCCCTGCCAAATCTGCCGGGGCTAAAGGATTATGGTTTGGGATTCCGCACCCTGGAAGATGCCTATAAACTCAAGCAAAAATTAAAATCACTGGAACAAGCCGACGCAGAGAAAATTCGTATTGCTATTGTTGGTGGGGGCTACAGCGGGGTGGAATTAGCGGCCAAACTCGGCGATCGCCTAGGGGAACGGGGCCGCATCCGCATTATTGAGCGGGGCAAAGAAATTTTAGCCATGTCCCCGGAGTTCAATCGTCAACAGGCCCAGGCCAGTCTTTCCGCCAAGGGAATTTGGGTGGATACGGAAACCACCGTTACCGCCATCACCGCCACCGATGTCACCCTCCAGTTCCGAGAGCAGGAAGATGTAATTCCAGTGGACTTGGTGCTTTGGACTGTGGGCACCACCGTTTCTCCTTTGATTCGTAATTTAGCCCTGCCCCATAACGACCAAGGCCAGCTTAGAACCAATGCCCAACTACAGGTGGAAGGAAAAACTAACATTTTTGCCTTGGGGGACGGAGCCGAAGGTCGGGATGCTAGTGGACAATTAATTCCCACCACGGCCCAAGGAGCCTTCCAACAGACGGACTATTGTGCCTGGAACATTTGGGCTAACTTAACCGGCCGTCCCCTGCTGCCCTGTCGTTATCAACCCCTAGGGGAAATGTTGGCCCTGGGCACCGATGGCGCTGTGCTGAGTGGTTTGGGCATTAAATTAAGTGGCCCCGCCGCCTTGTTGGCTCGTCGTTTGGTCTATCTCTACCGTTTTCCCACTTGGCAACATCAACTGACTGTGGGCTTGAATTGGCTGACCCGCCCCCTGGGGGATTGGCTCAAAAATGAACCTTCCTGA

Protein

MTDARPRICILGGGFGGLYTALRLGQLSWEGHTPPEIVLVDQRDRFLFAPFLYELVTEEMQTWEIAPPFVELLAESGVIFRQAEVTAIDFDHQKVLLNDQDKGTESLAFDQLVIALGGQTPLPNLPGLKDYGLGFRTLEDAYKLKQKLKSLEQADAEKIRIAIVGGGYSGVELAAKLGDRLGERGRIRIIERGKEILAMSPEFNRQQAQASLSAKGIWVDTETTVTAITATDVTLQFREQEDVIPVDLVLWTVGTTVSPLIRNLALPHNDQGQLRTNAQLQVEGKTNIFALGDGAEGRDASGQLIPTTAQGAFQQTDYCAWNIWANLTGRPLLPCRYQPLGEMLALGTDGAVLSGLGIKLSGPAALLARRLVYLYRFPTWQHQLTVGLNWLTRPLGDWLKNEPS