Your browser is old and dusty. Try Google Chrome!

Details for slr1742

ORF slr1742
Accession NP_441102.1
Symbol
Category Cobalamin, heme, phycobilin and porphyrin
Definition probable cobyric acid synthase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -316 -302 19.6658 0.0139
NP_441061.1_2 Reverse -309 -323 0.786239 0.199
NP_441061.1_2 Reverse -186 -200 -2.45868 0.293
NP_440557.1_1 Forward -316 -297 5.50599 0.162
NP_440795.1_7 Forward -316 -309 14.6904 0.0123
NP_440795.1_7 Reverse -309 -316 14.6904 0.0123
NP_442100.1_1 Reverse -268 -287 6.63627 0.284
NP_441418.1_6 Forward -317 -298 6.78429 0.00677
NP_441418.1_6 Reverse -308 -327 0.392778 0.00891
NP_441418.1_6 Forward -329 -310 -28.2215 0.203
NP_441418.1_6 Reverse -296 -315 -30.5815 0.286
NP_440815.1_5 Reverse -308 -327 7.96426 0.237
NP_442291.1_5 Reverse -307 -323 6.54838 0.0694
NP_442291.1_5 Forward -318 -302 -1.71142 0.202
NP_440295.1_2 Reverse -125 -144 8.06259 0.215
NP_441453.1_4 Reverse -308 -316 16.539 0.00633
NP_441453.1_4 Forward -317 -309 16.539 0.00633
NP_441453.1_4 Reverse -243 -251 9.75419 0.0493
NP_441453.1_4 Reverse -236 -244 4.14932 0.264
NP_441453.1_7 Reverse -28 -35 14.1988 0.175
NP_441453.1_7 Reverse -10 -17 12.1338 0.295
NP_441623.1_1 Forward -35 -17 17.0304 0.0619
NP_442151.1_6 Reverse -236 -250 8.84938 0.164
NP_442151.1_6 Reverse -320 -334 8.45605 0.172
NP_442151.1_6 Reverse -308 -322 8.45605 0.172
NP_441818.1_1 Reverse -309 -320 10.1862 0.232
NP_441642.1_8 Forward -334 -315 12.0942 0.287
NP_440226.1_1 Reverse -308 -327 14.7491 0.0291
NP_442169.1_1 Forward -165 -146 -1.18052 0.265
NP_442169.1_1 Forward -186 -167 -3.3438 0.294
NP_441630.1_3 Forward -325 -306 6.39097 0.126
NP_440120.1_4 Forward -389 -375 18.8791 0.0695
NP_442173.1_1 Forward -316 -308 15.4574 0.00633
NP_442173.1_1 Reverse -309 -317 15.4574 0.00633
NP_442752.1_4 Forward -317 -310 13.8055 0.0199
NP_442752.1_4 Reverse -308 -315 13.8055 0.0199
NP_443027.1_4 Reverse -306 -316 14.828 0.0437
NP_443027.1_4 Reverse -189 -199 5.87989 0.294
NP_439997.1_4 Forward -102 -83 12.8808 0.152
NP_441812.1_3 Forward -318 -304 8.06273 0.254
NP_442975.1_10 Reverse -304 -318 14.0603 0.0459
NP_442975.1_10 Forward -321 -307 2.45727 0.274
NP_440784.1_7 Forward -316 -309 15.9687 0.0123
NP_440784.1_7 Reverse -309 -316 15.9687 0.0123
NP_441250.1_3 Reverse -315 -334 12.0942 0.188
NP_440061.1_9 Reverse -147 -161 6.19383 0.255
NP_440061.1_9 Reverse -241 -255 5.99717 0.264
NP_439979.1_2 Forward -174 -155 6.39097 0.292
NP_440878.1_9 Forward -255 -236 -2.26216 0.258
NP_442062.1_8 Forward -317 -307 19.4496 0.000558
NP_442062.1_8 Reverse -308 -318 17.3846 0.00193
NP_442062.1_8 Reverse -236 -246 12.6647 0.0292
NP_440761.1_4 Forward -205 -186 -20.1584 0.285
NP_441900.1_1 Forward -246 -227 13.7641 0.192
NP_441859.1_3 Forward -318 -299 11.7983 0.103
NP_441859.1_3 Reverse -307 -326 8.4551 0.139
NP_441859.1_3 Reverse -295 -314 2.75194 0.257
NP_440304.1_4 Reverse -306 -316 10.8948 0.051
NP_440304.1_4 Forward -247 -237 5.97822 0.185
NP_440304.1_4 Forward -319 -309 1.84832 0.299
NP_442242.1_4 Forward -316 -309 14.3954 0.0124
NP_442242.1_4 Reverse -309 -316 14.3954 0.0124
NP_440044.1_8 Reverse -309 -328 22.3206 0.00823
NP_440044.1_9 Reverse -230 -249 6.88182 0.268
NP_441781.1_7 Reverse -236 -255 4.81767 0.186
NP_442602.1_3 Forward -255 -236 -2.65548 0.261
NP_439918.1_2 Forward -173 -154 -4.32711 0.274
NP_441208.1_9 Forward -320 -306 11.5043 0.15
NP_441208.1_9 Forward -248 -234 5.60446 0.267
NP_441594.1_6 Reverse -299 -318 10.3242 0.13
NP_441594.1_6 Forward -314 -295 5.11266 0.209
NP_441594.1_6 Forward -167 -148 0.294447 0.289
NP_442110.1_7 Forward -317 -303 3.44117 0.21
NP_442110.1_7 Forward -329 -315 1.86788 0.222
NP_440330.1_2 Reverse -224 -243 9.24257 0.297
NP_441083.1_5 Reverse -308 -318 20.3345 0.00053
NP_441083.1_5 Forward -317 -307 11.3864 0.0159
NP_441083.1_5 Reverse -236 -246 -0.314959 0.265
NP_441083.1_5 Reverse -243 -253 -0.511621 0.269
NP_441738.1_2 Forward -315 -308 15.28 0.0102
NP_441738.1_2 Reverse -310 -317 15.28 0.0102
NP_441738.1_2 Forward -353 -346 8.29857 0.176
NP_441558.1_5 Forward -254 -235 6.68596 0.206
NP_441558.1_5 Reverse -306 -325 4.22769 0.286
NP_440209.1_1 Reverse -308 -316 18.1123 0.00295
NP_440209.1_1 Forward -317 -309 18.1123 0.00295
NP_442889.1_1 Reverse -218 -237 -14.9469 0.283
NP_442889.1_8 Reverse -305 -319 13.5686 0.0588
NP_440407.1_6 Forward -132 -118 10.6193 0.28
NP_440447.1_5 Reverse -103 -113 15.6147 0.277
NP_440447.1_5 Reverse -383 -393 12.4681 0.291
NP_440056.1_9 Forward -391 -372 13.3846 0.295
NP_440178.1_7 Forward -246 -227 -21.3384 0.218
NP_439953.1_2 Forward -82 -64 7.19731 0.274
NP_442445.1_1 Forward -164 -145 14.1591 0.202
NP_441716.1_1 Forward -317 -303 10.226 0.0968
NP_441716.1_1 Reverse -243 -257 5.70279 0.22
NP_441327.1_5 Forward -388 -379 16.6177 0.111
NP_442111.1_4 Forward -318 -304 19.6658 0.00373
NP_442111.1_4 Forward -330 -316 4.22782 0.216
NP_441163.1_1 Forward -253 -236 9.28121 0.226
NP_441163.1_4 Reverse -180 -199 11.7587 0.297
NP_440343.1_3 Reverse -151 -169 4.73828 0.266
NP_440343.1_3 Reverse -145 -163 3.36165 0.281
NP_440906.1_5 Forward -316 -309 15.8704 0.0124
NP_440906.1_5 Reverse -309 -316 15.8704 0.0124
NP_440747.1_10 Forward -320 -308 14.9853 0.00221
NP_440747.1_10 Reverse -305 -317 7.70879 0.00236
NP_440747.1_10 Forward -255 -243 -2.71429 0.0639
NP_440747.1_10 Reverse -233 -245 -12.2524 0.254
NP_441130.1_10 Reverse -306 -320 10.9143 0.109
NP_442973.1_5 Forward -254 -235 11.7992 0.226
NP_441486.1_1 Forward -320 -306 20.0591 0.00312
NP_441486.1_1 Reverse -305 -319 13.7659 0.00763
NP_441486.1_1 Reverse -233 -247 -5.90027 0.266
NP_442850.1_8 Reverse -304 -323 15.3417 0.243
NP_440944.1_2 Reverse -296 -315 1.57275 0.25
NP_442634.1_3 Forward -328 -309 13.9616 0.166
NP_442634.1_4 Forward -319 -305 -1.67204 0.149
NP_441014.1_8 Reverse -151 -170 -0.787193 0.218
NP_441014.1_8 Reverse -152 -171 -6.78538 0.276
NP_441014.1_8 Reverse -156 -175 -9.73531 0.299
NP_441014.1_10 Reverse -307 -326 -1.47628 0.262
NP_442848.1_1 Reverse -302 -316 -1.47537 0.263
NP_442848.1_1 Forward -323 -309 -2.36035 0.263
NP_441012.1_4 Forward -315 -302 7.88576 0.272
NP_441012.1_4 Reverse -304 -317 7.19745 0.272
NP_441012.1_4 Reverse -187 -200 7.19745 0.272
NP_443018.1_3 Forward -316 -309 14.8871 0.0123
NP_443018.1_3 Reverse -309 -316 14.8871 0.0123
NP_443018.1_3 Reverse -237 -244 10.7572 0.0907
NP_443018.1_3 Forward -244 -237 4.56234 0.241
NP_441634.1_8 Forward -319 -305 -3.147 0.295
NP_441634.1_9 Forward -199 -180 15.0432 0.165
NP_441991.1_2 Forward -111 -92 18.3865 0.207
NP_441182.1_5 Reverse -116 -135 7.86593 0.273
NP_440376.1_1 Forward -317 -308 19.4693 0.000692
NP_440376.1_1 Reverse -308 -317 19.4693 0.000692
NP_440376.1_1 Forward -245 -236 6.48957 0.0963
NP_440376.1_1 Reverse -236 -245 6.19458 0.109
NP_440376.1_1 Forward -252 -243 2.65466 0.216
NP_440376.1_1 Forward -174 -165 0.196389 0.283
NP_441588.1_4 Reverse -310 -320 18.1713 0.0143
NP_442687.1_7 Reverse -307 -317 15.8113 0.0125
NP_442687.1_7 Forward -246 -236 9.12481 0.0994
NP_442687.1_7 Forward -318 -308 8.92815 0.0994
NP_442191.1_4 Reverse -337 -351 11.4779 0.256
NP_442191.1_7 Forward -173 -154 13.7658 0.206
NP_441077.1_6 Forward -106 -90 8.58628 0.199
NP_442485.1_3 Reverse -297 -316 -3.73712 0.277
NP_442485.1_3 Forward -328 -309 -5.99873 0.297
NP_441846.1_10 Forward -159 -140 -10.3253 0.19
NP_441846.1_10 Forward -168 -149 -11.3086 0.19
NP_441846.1_10 Forward -174 -155 -13.2752 0.201
NP_441846.1_10 Forward -170 -151 -19.0768 0.256
NP_441846.1_10 Forward -157 -138 -19.8634 0.256
NP_441846.1_10 Forward -173 -154 -20.0601 0.256
NP_441846.1_10 Forward -172 -153 -21.24 0.256
NP_441846.1_10 Forward -171 -152 -22.715 0.264
NP_441846.1_10 Forward -169 -150 -22.715 0.264
NP_440781.1_1 Forward -82 -68 10.521 0.296
NP_440642.1_10 Reverse -148 -162 11.9953 0.138
NP_442770.1_1 Reverse -152 -166 13.8636 0.3
NP_442296.1_9 Reverse -237 -256 3.04771 0.17
NP_442296.1_9 Reverse -309 -328 1.47442 0.197
NP_442658.1_1 Reverse -306 -316 15.9091 0.00966
NP_442658.1_1 Forward -247 -237 12.3692 0.0569
NP_442658.1_1 Forward -319 -309 6.76441 0.214
NP_440141.1_8 Forward -114 -95 10.4225 0.208
NP_440141.1_8 Forward -332 -313 5.70265 0.273
NP_441855.2_4 Reverse -300 -319 10.6799 0.244
NP_442782.1_2 Forward -317 -303 0.88457 0.282
NP_442782.1_2 Forward -245 -231 0.392915 0.29
NP_442782.1_7 Reverse -300 -319 2.94938 0.193
NP_442544.1_6 Reverse -301 -320 2.3594 0.111
NP_441487.1_9 Reverse -307 -326 3.24438 0.161
NP_442300.1_5 Forward -319 -300 10.5209 0.298
NP_441256.1_1 Reverse -305 -324 -5.31042 0.233
NP_442937.1_5 Forward -322 -303 17.7974 0.0297
NP_442937.1_5 Forward -310 -291 7.17762 0.26
NP_442321.1_4 Reverse -100 -119 -7.67036 0.284
NP_441958.1_5 Forward -318 -308 12.2714 0.00183
NP_441958.1_5 Reverse -307 -317 12.2714 0.00183
NP_441958.1_5 Reverse -235 -245 1.55333 0.095
NP_441958.1_5 Forward -246 -236 1.06167 0.116
NP_440610.1_5 Reverse -111 -130 16.1257 0.249
NP_440203.1_5 Reverse -188 -198 14.4342 0.0886
NP_440203.1_5 Forward -116 -106 9.321 0.263
NP_439905.1_2 Reverse -150 -164 8.35772 0.265
NP_440984.1_7 Forward -250 -236 7.37441 0.175
NP_440984.1_7 Reverse -160 -174 5.60446 0.248
NP_440984.1_7 Forward -322 -308 5.30946 0.259
NP_441338.2_5 Reverse -323 -342 2.55606 0.299
NP_442690.1_1 Reverse -253 -272 -8.85033 0.189
NP_442690.1_1 Forward -287 -268 -10.817 0.22
NP_442911.1_2 Reverse -298 -317 21.6323 0.00418
NP_440153.1_5 Forward -316 -302 7.07942 0.173
NP_441591.1_10 Forward -176 -157 4.71934 0.297
NP_443055.1_6 Forward -325 -307 16.7346 0.0593
NP_440138.1_6 Reverse -238 -257 12.7816 0.113
NP_441913.1_1 Forward -111 -95 15.272 0.246
NP_441099.1_5 Forward -327 -308 -5.80207 0.154
NP_442002.1_9 Reverse -307 -314 10.7572 0.185
NP_441654.1_5 Forward -272 -253 15.1754 0.239
NP_441294.1_7 Reverse -239 -253 11.1704 0.153
NP_441294.1_7 Forward -321 -307 9.25063 0.256
NP_441646.1_1 Reverse -301 -320 2.75272 0.214
NP_442438.1_10 Reverse -303 -317 10.9143 0.0478
NP_441000.1_6 Reverse -307 -321 3.63784 0.108
NP_441000.1_6 Forward -246 -232 -5.21195 0.266
NP_442771.1_1 Forward -319 -301 -8.63398 0.2
NP_440147.1_4 Forward -319 -306 10.049 0.0355
NP_440147.1_4 Forward -247 -234 7.98409 0.0579
NP_440147.1_4 Reverse -306 -319 3.46087 0.187
NP_441550.1_8 Forward -319 -309 14.6309 0.0132
NP_441550.1_8 Reverse -306 -316 6.0761 0.214
NP_441916.1_7 Forward -317 -307 18.4663 0.00144
NP_441916.1_7 Reverse -308 -318 10.3048 0.0261
NP_441916.1_7 Forward -245 -235 6.46988 0.0941
NP_441916.1_10 Reverse -300 -319 9.43923 0.157
NP_441916.1_10 Forward -376 -357 3.93269 0.225
NP_441916.1_10 Forward -127 -108 3.6377 0.227
NP_440206.1_9 Forward -393 -374 10.7175 0.272
NP_441041.1_4 Reverse -308 -327 -7.27704 0.185
NP_441041.1_4 Forward -200 -181 -12.6852 0.272
NP_441041.1_4 Forward -329 -310 -13.4719 0.288
NP_441041.1_4 Forward -317 -298 -13.8652 0.297
NP_441041.1_7 Forward -320 -308 11.8878 0.0689
NP_441041.1_7 Forward -248 -236 8.09784 0.147
NP_441041.1_7 Reverse -305 -317 7.61196 0.162
NP_441041.1_7 Reverse -233 -245 4.98816 0.282
NP_441725.1_4 Reverse -303 -317 3.63724 0.278
NP_441725.1_5 Forward -316 -306 11.2881 0.0247
NP_441725.1_5 Reverse -237 -247 7.64985 0.0904
NP_441725.1_5 Reverse -309 -319 2.04498 0.115
NP_439966.1_7 Reverse -306 -316 18.4657 0.00473
NP_439966.1_7 Reverse -163 -173 10.796 0.0811
NP_439966.1_7 Forward -319 -309 7.25606 0.15
NP_439966.1_9 Reverse -306 -315 0.983037 0.253
NP_440736.1_6 Forward -334 -315 14.5524 0.217
NP_442941.1_3 Forward -316 -306 11.4848 0.0116
NP_442941.1_3 Reverse -309 -319 11.0914 0.0116
NP_442941.1_3 Forward -244 -234 -0.216628 0.252
NP_440289.1_2 Reverse -305 -318 11.819 0.0171
NP_440289.1_2 Forward -320 -307 -2.144 0.251
NP_440289.1_2 Reverse -233 -246 -3.91395 0.273
NP_440983.1_9 Forward -52 -33 -0.000545616 0.295
NP_440260.1_8 Forward -326 -308 -2.93078 0.246
NP_440260.1_8 Forward -314 -296 -7.35568 0.295
NP_442281.1_1 Reverse -303 -317 20.4518 0.00192
NP_442281.1_1 Forward -322 -308 18.5835 0.00414
NP_442281.1_1 Forward -250 -236 14.5519 0.0176
NP_442281.1_1 Reverse -238 -252 3.63724 0.224
NP_442281.1_1 Reverse -231 -245 3.24392 0.238
NP_442575.1_8 Forward -170 -151 -6.58872 0.286
NP_440437.1_1 Reverse -302 -321 5.30933 0.0881
NP_440437.1_1 Reverse -314 -333 -5.31042 0.28
NP_442500.1_8 Forward -367 -353 9.88916 0.272
NP_441087.1_6 Reverse -150 -168 -3.32482 0.296
NP_440498.1_1 Reverse -299 -317 -1.16082 0.222
NP_442982.1_5 Reverse -298 -317 4.03102 0.191
NP_441644.1_6 Reverse -308 -318 17.3841 0.00127
NP_441644.1_6 Forward -317 -307 10.1076 0.0628
NP_441644.1_6 Reverse -236 -246 10.0093 0.0649
NP_441644.1_6 Forward -245 -235 8.04271 0.11
NP_441644.1_6 Reverse -243 -253 6.0761 0.167
NP_441644.1_6 Forward -311 -301 4.30615 0.242
NP_442215.1_2 Forward -319 -303 6.54838 0.0702
NP_442215.1_2 Reverse -234 -250 6.05672 0.074
NP_442215.1_2 Reverse -306 -322 -1.90808 0.189
NP_442215.1_2 Reverse -363 -379 -3.57971 0.218
NP_442215.1_2 Forward -121 -105 -4.75968 0.239
NP_440253.1_2 Reverse -308 -326 7.59063 0.0682
NP_440253.1_2 Forward -317 -299 3.65739 0.114
NP_440929.1_8 Forward -317 -308 19.2726 0.000701
NP_440929.1_8 Reverse -308 -317 19.2726 0.000701
NP_440780.1_1 Reverse -86 -105 7.01823 0.289
NP_442933.1_10 Forward -317 -308 17.601 0.00325
NP_442933.1_10 Reverse -308 -317 17.601 0.00325
NP_442933.1_10 Forward -245 -236 4.52295 0.24
NP_441751.2_8 Forward -316 -302 9.5377 0.0312
NP_441751.2_8 Reverse -309 -323 -3.147 0.134
NP_441751.2_8 Reverse -139 -153 -5.40861 0.206
NP_442554.1_8 Reverse -309 -319 15.3197 0.00882
NP_442554.1_8 Forward -316 -306 13.8447 0.0145
NP_442554.1_8 Forward -244 -234 7.05986 0.0993
NP_442554.1_8 Reverse -237 -247 3.91327 0.203
NP_442554.1_8 Forward -251 -241 2.63497 0.265
NP_442554.1_8 Forward -199 -189 1.74999 0.298
NP_442075.1_9 Reverse -148 -167 7.66846 0.276
NP_442075.1_9 Reverse -150 -169 7.4718 0.284
NP_441762.1_7 Reverse -307 -319 9.57708 0.0142
NP_441762.1_7 Forward -318 -306 2.89058 0.0676
NP_442142.1_4 Reverse -305 -318 17.1282 0.0264
NP_442142.1_4 Forward -320 -307 13.49 0.0348
NP_442292.1_1 Reverse -309 -318 18.486 0.00229
NP_442292.1_1 Forward -316 -307 9.63616 0.0183
NP_441899.1_1 Forward -239 -221 19.1937 0.0747
NP_442381.1_8 Reverse -305 -324 -14.5535 0.283
NP_441711.1_4 Forward -326 -307 5.30933 0.18
NP_443009.1_5 Forward -318 -307 18.3477 0.00265
NP_443009.1_5 Reverse -235 -246 11.0712 0.068
NP_443009.1_5 Forward -246 -235 6.1547 0.173
NP_441715.1_4 Forward -316 -306 16.303 0.0117
NP_441715.1_4 Reverse -309 -319 7.94484 0.107
NP_440357.1_3 Reverse -306 -325 2.75272 0.245
NP_440279.1_8 Forward -208 -189 14.3558 0.242
NP_442076.1_5 Forward -140 -121 11.4058 0.186
NP_441198.1_5 Reverse -310 -323 12.7034 0.216
NP_441198.1_8 Forward -247 -237 10.6345 0.254
NP_440464.1_10 Reverse -309 -319 13.0082 0.169
NP_441468.1_1 Forward -316 -309 15.8704 0.0124
NP_441468.1_1 Reverse -309 -316 15.8704 0.0124
NP_441468.1_1 Forward -244 -237 4.07068 0.263
NP_441020.2_6 Reverse -306 -323 9.67528 0.165
NP_441020.2_6 Forward -319 -302 8.98696 0.182
NP_441015.1_10 Forward -163 -144 -7.4737 0.267
NP_441015.1_10 Forward -173 -154 -10.6203 0.286
NP_441673.1_1 Forward -317 -308 20.8459 0.000698
NP_441673.1_1 Reverse -308 -317 20.8459 0.000698
NP_441673.1_1 Forward -245 -236 1.37636 0.114
NP_441673.1_1 Reverse -236 -245 1.1797 0.163
NP_441826.1_2 Reverse -302 -316 19.9608 0.00795
NP_441826.1_2 Reverse -250 -264 -0.688726 0.22
NP_441826.1_2 Reverse -237 -251 -2.85201 0.277
NP_442811.1_2 Reverse -189 -208 -2.45882 0.281
NP_442490.1_9 Reverse -296 -315 8.45592 0.125
NP_441764.1_8 Forward -388 -378 12.4592 0.284
NP_442868.1_6 Forward -319 -309 9.81313 0.038
NP_442868.1_6 Reverse -306 -316 0.963343 0.205
NP_441612.1_2 Reverse -308 -318 8.54929 0.21
NP_442227.1_2 Reverse -146 -165 4.62101 0.206
NP_442227.1_2 Reverse -150 -169 -2.85214 0.283
NP_442227.1_2 Reverse -145 -164 -3.54046 0.293
NP_443058.1_7 Forward -318 -299 2.65439 0.283
NP_442361.1_3 Reverse -326 -339 8.37742 0.285
NP_442361.1_3 Reverse -302 -315 7.49244 0.3
NP_442808.1_1 Reverse -307 -317 18.4657 0.00201
NP_442808.1_1 Forward -318 -308 8.63269 0.0481
NP_442808.1_1 Reverse -242 -252 5.09279 0.173
NP_442808.1_1 Reverse -164 -174 4.10949 0.207
NP_441101.1_10 Reverse -151 -170 1.17943 0.173
NP_441176.1_1 Forward -395 -376 7.17762 0.273
NP_440145.1_3 Forward -262 -243 -5.21209 0.261
NP_442050.1_1 Forward -161 -142 9.73422 0.247
NP_442050.1_1 Forward -166 -147 8.55425 0.25
NP_442050.1_1 Forward -165 -146 8.45592 0.25
NP_442050.1_5 Reverse -306 -316 9.12434 0.193
NP_442050.1_5 Forward -319 -309 7.64939 0.243
NP_440334.1_2 Forward -104 -91 14.8673 0.226
NP_440342.1_1 Forward -168 -149 12.2908 0.263
NP_441114.1_3 Reverse -238 -247 17.1093 0.113
NP_440558.1_2 Reverse -299 -318 -6.88371 0.283
NP_441048.1_6 Reverse -89 -103 15.7678 0.296
NP_442789.1_4 Forward -331 -312 3.44104 0.163
NP_442789.1_4 Reverse -309 -328 -7.57203 0.298
NP_441518.1_3 Forward -327 -308 3.73603 0.0525
NP_441878.1_6 Forward -246 -236 12.0747 0.013
NP_441878.1_6 Forward -318 -308 10.4031 0.0176
NP_441878.1_6 Reverse -307 -317 10.4031 0.0176
NP_441878.1_6 Reverse -235 -245 1.25834 0.108
NP_441878.1_6 Forward -253 -243 -7.59145 0.245
NP_441036.1_8 Reverse -307 -317 17.7779 0.000554
NP_441036.1_8 Forward -318 -308 8.33817 0.174
NP_441557.1_5 Forward -317 -308 19.9609 0.000699
NP_441557.1_5 Reverse -308 -317 19.9609 0.000699
NP_441557.1_5 Forward -245 -236 0.491382 0.144
NP_441557.1_5 Reverse -236 -245 0.29472 0.174
NP_441557.1_8 Reverse -152 -162 14.7292 0.183
NP_441445.1_1 Forward -326 -307 13.2741 0.0613
NP_441445.1_1 Reverse -299 -318 1.57275 0.252
NP_441445.1_1 Forward -261 -242 -0.000545616 0.283
NP_442777.1_3 Reverse -142 -160 1.19838 0.292
NP_441308.1_8 Reverse -306 -316 10.1081 0.22
NP_440101.1_10 Forward -206 -187 3.24438 0.243
NP_442830.1_2 Forward -62 -43 17.9932 0.0627
NP_442183.1_1 Forward -317 -303 19.1741 0.0065
NP_442183.1_1 Reverse -308 -322 7.76774 0.131
NP_442397.1_9 Reverse -236 -255 5.01433 0.253
NP_442397.1_9 Forward -252 -233 2.45773 0.276
NP_440440.1_2 Reverse -312 -331 16.4199 0.225
NP_441574.1_1 Forward -317 -298 2.16274 0.164
NP_441574.1_1 Forward -329 -310 1.47442 0.173
NP_441574.1_1 Forward -212 -193 -6.88371 0.281
NP_440276.1_6 Reverse -82 -101 16.8539 0.281
NP_441638.1_10 Reverse -3 -17 16.1259 0.245
NP_442347.1_2 Reverse -309 -318 12.4878 0.056
NP_442347.1_2 Forward -316 -307 11.1111 0.056
NP_442347.1_2 Reverse -321 -330 5.11294 0.238
NP_442347.1_2 Forward -40 -31 4.52295 0.282
NP_442645.1_2 Forward -325 -306 -21.9284 0.29
NP_442645.1_2 Forward -260 -241 -22.715 0.293
NP_442965.1_2 Forward -391 -372 -8.06369 0.277
NP_441037.1_4 Forward -319 -309 7.9999 0.237
NP_441037.1_4 Reverse -306 -316 7.02532 0.237
NP_441037.1_4 Forward -247 -237 6.44058 0.263
NP_442594.1_8 Forward -161 -142 17.0107 0.146
NP_442594.1_8 Forward -224 -205 3.04771 0.289
NP_442508.1_8 Forward -196 -179 11.1502 0.256
NP_440690.1_3 Forward -265 -246 12.6841 0.295
NP_441633.1_3 Forward -319 -306 8.47575 0.0377
NP_441633.1_3 Reverse -306 -319 -3.71729 0.177
NP_442764.1_6 Reverse -310 -328 1.98577 0.259
NP_440136.1_2 Forward -316 -309 15.9687 0.0123
NP_440136.1_2 Reverse -309 -316 15.9687 0.0123
NP_442998.1_5 Forward -387 -377 13.0581 0.158
NP_442998.1_5 Forward -100 -90 12.0747 0.176
NP_442998.1_5 Forward -388 -378 9.61647 0.238
NP_442998.1_5 Forward -108 -98 9.41981 0.241
NP_442998.1_10 Forward -315 -308 15.5754 0.0102
NP_442998.1_10 Reverse -310 -317 15.5754 0.0102
NP_440899.1_8 Reverse -120 -139 3.53937 0.124
NP_440299.1_1 Reverse -304 -317 20.1765 0.00128
NP_440299.1_1 Forward -321 -308 4.44361 0.207
NP_441799.1_1 Forward -321 -307 16.1252 0.0153
NP_441799.1_1 Forward -249 -235 6.78381 0.162
NP_441799.1_1 Reverse -304 -318 4.03056 0.269
NP_441799.1_1 Reverse -262 -276 3.73557 0.284
NP_441007.1_10 Forward -322 -309 0.412608 0.23
NP_441007.1_10 Forward -250 -237 -0.275709 0.273
NP_442201.1_10 Reverse -297 -316 -13.7669 0.277
NP_441449.1_8 Forward -331 -312 15.728 0.21
NP_440256.1_1 Forward -320 -301 5.80098 0.0334
NP_440256.1_1 Forward -177 -158 -2.36049 0.116
NP_440256.1_1 Reverse -305 -324 -2.65548 0.122
NP_440256.1_1 Forward -248 -229 -8.65367 0.264
NP_441090.1_3 Reverse -77 -94 21.9658 0.0625
NP_441090.1_6 Forward -399 -385 10.226 0.239
NP_441559.1_8 Reverse -303 -317 2.5562 0.143
NP_441559.1_8 Forward -36 -22 -4.22864 0.219
NP_441559.1_8 Reverse -105 -119 -5.40861 0.261
NP_440915.1_6 Reverse -304 -318 5.70279 0.0879
NP_440915.1_6 Forward -256 -242 -2.65535 0.278
NP_442158.1_4 Reverse -6 -16 13.648 0.219
NP_441179.1_9 Forward -202 -192 8.73102 0.284
NP_440717.1_1 Reverse -237 -256 4.42435 0.296
NP_440717.1_3 Reverse -152 -166 9.73373 0.25
NP_440748.1_5 Reverse -311 -330 -1.08219 0.267
NP_441464.1_8 Reverse -308 -322 4.91614 0.26
NP_440695.1_5 Forward -329 -310 6.39097 0.158
NP_441199.1_6 Reverse -304 -323 -0.590531 0.276
NP_441494.1_6 Forward -310 -297 6.90245 0.272
NP_442993.1_1 Forward -317 -301 -7.0213 0.146
NP_442993.1_1 Forward -245 -229 -13.0195 0.283
NP_440677.1_1 Reverse -299 -318 13.8641 0.129
NP_442386.1_9 Reverse -307 -316 15.7322 0.0144
NP_442386.1_9 Forward -318 -309 13.8639 0.0289
NP_442386.1_9 Reverse -164 -173 7.66912 0.219
NP_442386.1_9 Reverse -185 -194 5.30919 0.257
NP_442386.1_10 Reverse -339 -352 8.47575 0.217
NP_441750.1_1 Reverse -327 -346 -10.6203 0.3
NP_441750.1_7 Forward -167 -157 13.8447 0.254
NP_441340.1_5 Forward -316 -309 15.6737 0.0124
NP_441340.1_5 Reverse -309 -316 15.6737 0.0124
NP_441340.1_5 Reverse -237 -244 3.97235 0.274
NP_441340.1_9 Forward -388 -378 8.25522 0.256
NP_442484.1_2 Forward -328 -309 4.32602 0.187
NP_440168.1_4 Reverse -233 -252 -3.54046 0.255
NP_441952.1_9 Forward -110 -91 12.6269 0.296
NP_440327.1_6 Forward -206 -187 8.06259 0.222
NP_440327.1_8 Forward -200 -181 18.3873 0.151
NP_442240.1_2 Forward -316 -297 -14.2585 0.177
NP_440586.1_8 Forward -316 -309 13.2151 0.026
NP_440586.1_8 Reverse -309 -316 13.2151 0.026
NP_440586.1_8 Reverse -192 -199 5.8403 0.283
NP_442251.1_6 Forward -316 -309 15.2804 0.0124
NP_442251.1_6 Reverse -309 -316 15.2804 0.0124
NP_440684.1_9 Reverse -302 -316 15.2409 0.0988
NP_440684.1_9 Forward -323 -309 12.0943 0.168
NP_441262.1_3 Reverse -308 -315 14.7888 0.0223
NP_441262.1_3 Forward -317 -310 14.7888 0.0223
NP_440027.1_3 Reverse -326 -344 8.96649 0.187
NP_440027.1_3 Reverse -155 -173 6.21323 0.23
NP_440027.1_3 Forward -174 -156 2.28001 0.292
NP_443051.1_1 Reverse -307 -316 10.4228 0.00754
NP_443051.1_1 Forward -318 -309 10.4228 0.00754
NP_443051.1_1 Reverse -235 -244 -0.0986038 0.256
NP_440451.1_10 Forward -310 -291 7.76679 0.283
NP_441232.1_10 Forward -328 -309 3.24438 0.233
NP_439937.1_8 Forward -331 -312 2.94938 0.209
NP_439937.1_8 Forward -319 -300 -3.73712 0.271
NP_440398.1_6 Forward -60 -41 2.3594 0.294
NP_440408.1_7 Forward -158 -139 9.3409 0.262
NP_440626.1_1 Reverse -309 -328 23.598 0.0165
NP_440439.1_1 Reverse -305 -318 8.37742 0.0537
NP_440439.1_1 Reverse -162 -175 -1.849 0.285
NP_439943.1_3 Reverse -114 -133 20.5506 0.0962
NP_439943.1_7 Forward -124 -105 3.34271 0.29
NP_440372.1_2 Forward -316 -309 16.3621 0.0124
NP_440372.1_2 Reverse -309 -316 16.3621 0.0124
NP_441138.1_5 Reverse -122 -135 3.88145 0.297
NP_441138.1_5 Reverse -351 -364 2.92653 0.297
NP_441789.1_7 Reverse -150 -169 -3.14789 0.268
NP_441789.1_7 Reverse -164 -183 -5.31116 0.297
NP_440819.1_5 Forward -141 -133 7.8859 0.266
NP_440819.1_5 Forward -388 -380 7.68924 0.266
NP_440316.1_10 Forward -168 -158 7.05986 0.251
NP_440316.1_10 Forward -246 -236 6.8632 0.251
NP_441803.1_2 Reverse -303 -322 5.70265 0.165
NP_440139.1_1 Forward -323 -304 3.53858 0.202
NP_440139.1_1 Reverse -230 -249 2.06362 0.24
NP_441572.1_1 Forward -319 -300 -2.45882 0.212
NP_441572.1_7 Reverse -302 -321 -3.14714 0.207
NP_440267.1_2 Reverse -231 -245 8.55376 0.162
NP_442384.1_10 Forward -317 -304 15.7522 0.00946
NP_442384.1_10 Reverse -308 -321 1.10092 0.268
NP_442384.1_10 Forward -174 -161 0.707601 0.282
NP_442114.1_8 Forward -365 -351 3.53891 0.29
NP_441018.1_7 Forward -178 -159 8.84924 0.239
NP_441018.1_7 Forward -321 -302 7.96426 0.259
NP_442790.1_4 Reverse -299 -318 -6.68705 0.144
NP_442262.1_10 Forward -316 -309 14.1988 0.0123
NP_442262.1_10 Reverse -309 -316 14.1988 0.0123
NP_442262.1_10 Reverse -237 -244 9.87221 0.164
NP_441689.1_5 Reverse -306 -316 8.53436 0.132
NP_441689.1_5 Forward -319 -309 5.78111 0.197
NP_440163.1_10 Reverse -305 -315 16.303 0.0762
NP_440344.1_10 Reverse -301 -318 11.5436 0.006
NP_440344.1_10 Forward -324 -307 4.07041 0.0253
NP_440531.1_6 Forward -325 -306 -5.31042 0.296
NP_440189.1_10 Forward -256 -237 3.34271 0.282
NP_441640.1_8 Reverse -321 -340 -3.93378 0.259
NP_440297.1_9 Forward -316 -306 9.32148 0.0917
NP_440297.1_9 Reverse -237 -247 7.35486 0.126
NP_440297.1_9 Reverse -309 -319 -0.118297 0.282
NP_440297.1_9 Forward -199 -189 -0.216628 0.282
NP_442280.1_10 Reverse -94 -112 10.227 0.223
NP_441894.1_1 Forward -21 -2 -4.32711 0.21
NP_440999.1_9 Reverse -304 -318 13.1759 0.0329
NP_440999.1_9 Forward -309 -295 -3.54032 0.296
NP_440888.1_2 Forward -317 -303 14.9452 0.0137
NP_440888.1_2 Reverse -308 -322 7.66879 0.186
NP_440888.1_2 Reverse -152 -166 6.48882 0.232
NP_442147.1_6 Reverse -163 -177 16.7152 0.205
NP_440491.1_1 Forward -262 -243 6.62464 0.293
NP_442948.1_2 Forward -318 -299 6.68596 0.231
NP_442033.1_10 Reverse -162 -181 -12.5869 0.273
NP_441543.1_2 Forward -316 -307 18.486 0.00236
NP_441543.1_2 Reverse -309 -318 16.9127 0.00359
NP_442845.1_2 Forward -180 -166 7.37441 0.195
NP_442845.1_2 Reverse -302 -316 5.70279 0.225
NP_441178.1_6 Reverse -148 -167 4.52188 0.268
NP_440982.1_1 Reverse -151 -170 4.91521 0.294
NP_441469.1_8 Reverse -307 -316 16.126 0.00797
NP_441469.1_8 Forward -246 -237 9.63616 0.227
NP_441469.1_8 Forward -318 -309 6.48957 0.227
NP_443064.1_6 Reverse -308 -318 12.5669 0.0796
NP_442578.1_7 Forward -316 -309 14.5921 0.026
NP_442578.1_7 Reverse -309 -316 14.5921 0.026
NP_440220.1_4 Reverse -370 -389 9.53674 0.151
NP_440220.1_4 Reverse -103 -122 8.25844 0.176
NP_441462.1_2 Forward -317 -307 11.5831 0.00406
NP_441462.1_2 Reverse -308 -318 11.5831 0.00406
NP_441462.1_2 Forward -245 -235 0.766681 0.125
NP_441462.1_2 Reverse -236 -246 0.471689 0.148
NP_441462.1_5 Forward -110 -91 1.17943 0.291
NP_441621.1_7 Forward -319 -305 -3.44199 0.188
NP_443062.1_1 Forward -317 -299 9.91103 0.125
NP_443062.1_1 Reverse -308 -326 4.84065 0.247
NP_443062.1_1 Forward -245 -227 3.76806 0.285
NP_443062.1_6 Forward -325 -306 9.53756 0.125
NP_442204.1_1 Reverse -304 -315 9.69511 0.0736
NP_442204.1_1 Reverse -187 -198 0.550326 0.281
NP_442204.1_2 Reverse -298 -317 7.07928 0.287
NP_442204.1_5 Forward -255 -236 5.01433 0.16
NP_441560.1_8 Reverse -315 -334 13.5579 0.205
NP_440516.1_2 Reverse -302 -320 3.26407 0.152
NP_440516.1_8 Forward -317 -308 16.9127 0.00442
NP_440516.1_8 Reverse -308 -317 16.9127 0.00442
NP_440516.1_8 Forward -147 -138 -0.196935 0.185
NP_440128.1_10 Forward -196 -177 13.4708 0.286
NP_442428.1_4 Forward -253 -234 4.62101 0.224
NP_442428.1_5 Forward -316 -309 15.8704 0.0124
NP_442428.1_5 Reverse -309 -316 15.8704 0.0124
NP_442428.1_5 Forward -244 -237 4.46401 0.267
NP_440818.1_6 Forward -236 -217 8.06259 0.243
NP_441443.1_1 Forward -162 -143 -3.24547 0.284
NP_442120.1_10 Forward -206 -187 -9.53865 0.243
NP_441867.1_2 Forward -115 -96 -11.6036 0.231
NP_440673.1_2 Forward -327 -308 10.3896 0.212
NP_440673.1_3 Forward -315 -308 12.4288 0.0426
NP_440673.1_3 Reverse -310 -317 12.4288 0.0426
NP_440673.1_3 Reverse -238 -245 8.98723 0.203
NP_440673.1_3 Reverse -322 -329 7.41394 0.263
NP_440673.1_3 Reverse -196 -203 6.3323 0.283
NP_441052.1_2 Reverse -308 -318 19.9412 0.00106
NP_441052.1_2 Forward -317 -307 10.5014 0.0285
NP_441052.1_2 Forward -252 -242 4.0116 0.168
NP_442219.1_8 Forward -315 -296 14.8348 0.133
NP_442219.1_8 Forward -327 -308 14.255 0.138
NP_442219.1_9 Reverse -309 -318 17.7976 0.00718
NP_442219.1_9 Forward -316 -307 8.35786 0.0681
NP_440436.1_4 Forward -316 -307 18.1905 0.00233
NP_440436.1_4 Reverse -309 -318 17.2072 0.00233
NP_440436.1_4 Reverse -237 -246 9.73406 0.0871
NP_441884.1_7 Reverse -120 -133 17.3249 0.265
NP_441884.1_9 Reverse -305 -324 -14.1602 0.138
NP_442086.1_6 Reverse -296 -315 11.1109 0.255
NP_442086.1_6 Reverse -308 -327 6.88262 0.289
NP_440314.1_9 Reverse -309 -328 -7.96535 0.243
NP_441719.1_4 Forward -316 -309 16.3621 0.0124
NP_441719.1_4 Reverse -309 -316 16.3621 0.0124
NP_441733.1_10 Forward -320 -307 9.85238 0.106
NP_441004.1_1 Forward -251 -232 -11.5053 0.24
NP_441004.1_1 Forward -173 -154 -18.2901 0.299
NP_441004.1_2 Forward -256 -237 -0.885524 0.259
NP_442366.1_3 Forward -318 -300 9.55725 0.0552
NP_442366.1_3 Reverse -307 -325 4.05072 0.101
NP_442366.1_5 Forward -320 -310 14.8275 0.0375
NP_440129.1_10 Reverse -301 -315 15.8309 0.0373
NP_442873.1_9 Forward -327 -308 3.83357 0.287
NP_440296.1_10 Forward -177 -158 -13.6686 0.269
NP_441115.1_4 Reverse -235 -253 11.8181 0.127
NP_442694.1_4 Reverse -347 -356 12.9794 0.225
NP_442206.1_10 Forward -317 -302 4.99478 0.178
NP_440094.1_9 Forward -318 -299 -3.04881 0.227
NP_443054.1_2 Reverse -306 -320 11.3077 0.0761
NP_443054.1_2 Reverse -234 -248 6.6861 0.185
NP_441851.1_10 Reverse -307 -317 16.008 0.00552
NP_441851.1_10 Forward -318 -308 15.8113 0.00552
NP_441851.1_10 Forward -246 -236 6.27322 0.178
NP_442208.1_5 Forward -173 -154 -8.55534 0.277
NP_441668.1_4 Reverse -298 -317 -1.27885 0.271
NP_441668.1_4 Forward -255 -236 -2.45882 0.288
NP_441668.1_5 Forward -109 -90 9.63589 0.225
NP_441668.1_5 Forward -108 -89 9.24257 0.232
NP_442515.1_1 Forward -318 -304 -4.81863 0.298
NP_440165.1_5 Reverse -307 -326 -7.17871 0.259
NP_442689.1_2 Reverse -297 -316 15.7324 0.212
NP_442689.1_8 Reverse -257 -274 6.43035 0.155
NP_441349.1_10 Reverse -226 -245 3.6377 0.0652
NP_441349.1_10 Forward -327 -308 -8.94866 0.28
NP_441409.1_6 Reverse -302 -321 -6.88371 0.14
NP_440389.1_2 Reverse -15 -34 12.2908 0.281
NP_440432.1_9 Reverse -309 -324 9.71466 0.0419
NP_442843.1_1 Forward -391 -372 -2.0655 0.202
NP_442843.1_1 Reverse -309 -328 -2.36049 0.203
NP_442450.1_5 Reverse -306 -316 9.32148 0.115
NP_442450.1_5 Forward -319 -309 7.55152 0.13
NP_440588.1_2 Reverse -299 -318 -1.7705 0.157
NP_440588.1_2 Reverse -227 -246 -5.31042 0.247
NP_440040.1_8 Forward -369 -350 17.9043 0.11
NP_442006.1_2 Forward -167 -150 -7.23765 0.171
NP_442006.1_2 Forward -173 -156 -13.4325 0.197
NP_442006.1_3 Forward -164 -146 -7.84733 0.298
NP_441570.1_1 Reverse -308 -326 7.19731 0.0175
NP_441570.1_1 Forward -317 -299 -16.6971 0.252
NP_441570.1_1 Reverse -17 -35 -17.2871 0.269
NP_441078.1_4 Forward -317 -308 19.6659 0.0007
NP_441078.1_4 Reverse -308 -317 19.6659 0.0007
NP_441078.1_4 Forward -245 -236 8.1612 0.039
NP_441078.1_4 Forward -252 -243 6.09625 0.0863
NP_441078.1_4 Reverse -236 -245 0.983037 0.151
NP_441078.1_4 Reverse -243 -252 -2.06522 0.295
NP_442729.1_8 Reverse -304 -317 8.08242 0.125
NP_441663.1_8 Reverse -302 -321 -3.83545 0.298
NP_442348.1_2 Reverse -346 -355 17.011 0.055
NP_440526.1_3 Reverse -309 -320 10.2846 0.0646
NP_440526.1_3 Reverse -237 -248 1.13984 0.267
NP_441432.1_8 Forward -318 -309 16.8143 0.00595
NP_441432.1_8 Forward -253 -244 10.0295 0.0681
NP_441432.1_8 Forward -195 -186 9.53783 0.0755
NP_441432.1_8 Reverse -307 -316 8.25953 0.0755
NP_441432.1_8 Forward -246 -237 6.5879 0.112
NP_441432.1_9 Forward -92 -79 11.604 0.221
NP_442320.1_8 Reverse -302 -316 4.71948 0.0472
NP_442320.1_8 Forward -323 -309 3.63784 0.0578
NP_441732.1_2 Reverse -304 -320 1.92682 0.0254
NP_441732.1_2 Reverse -316 -332 -16.7561 0.195
NP_441732.1_2 Reverse -30 -46 -17.4444 0.258
NP_441030.1_6 Reverse -241 -260 13.2365 0.226
NP_441737.1_6 Forward -103 -84 20.649 0.12
NP_442815.1_2 Forward -256 -238 2.28076 0.296
NP_440199.1_10 Forward -320 -310 7.25653 0.231
NP_440578.1_8 Forward -85 -66 11.0125 0.273
NP_441057.1_3 Reverse -228 -247 -11.3086 0.223
NP_441072.1_2 Forward -178 -159 11.9958 0.176
NP_442400.1_10 Forward -365 -352 8.84703 0.278
NP_440713.1_4 Forward -199 -180 0.982764 0.298
NP_442489.1_2 Forward -211 -192 7.07928 0.172
NP_442489.1_7 Forward -317 -308 20.1576 0.000695
NP_442489.1_7 Reverse -308 -317 20.1576 0.000695
NP_442489.1_7 Forward -245 -236 8.1612 0.0294
NP_442489.1_7 Reverse -236 -245 7.76787 0.0518
NP_442489.1_7 Forward -252 -243 -1.6719 0.235
NP_441830.1_2 Forward -182 -163 -4.72043 0.275
NP_440565.1_3 Reverse -107 -126 15.2899 0.227
NP_442079.1_7 Forward -316 -297 1.47442 0.251
NP_442079.1_7 Reverse -309 -328 0.687771 0.275
NP_440559.1_1 Reverse -309 -318 17.4043 0.00658
NP_440559.1_1 Forward -316 -307 8.75118 0.0586
NP_441659.2_8 Reverse -308 -318 18.1713 0.00133
NP_441659.2_8 Forward -317 -307 11.9764 0.0147
NP_441659.2_8 Reverse -236 -246 7.45319 0.0601
NP_441659.2_8 Reverse -243 -253 3.22496 0.169
NP_441659.2_8 Forward -245 -235 1.74999 0.227
NP_442913.1_10 Forward -254 -235 3.6377 0.102
NP_441040.1_2 Forward -319 -300 -12.7836 0.262
NP_440708.1_6 Forward -53 -34 -11.0136 0.296
NP_440335.1_9 Forward -369 -351 11.6222 0.273
NP_442776.1_6 Reverse -234 -253 8.84924 0.243
NP_440779.1_5 Reverse -308 -325 -5.86102 0.152
NP_442346.1_5 Forward -318 -308 16.6963 0.00248
NP_442346.1_5 Forward -246 -236 14.4347 0.0134
NP_442346.1_5 Reverse -307 -317 9.02648 0.118
NP_442346.1_5 Reverse -235 -245 5.97822 0.219
NP_440352.1_5 Forward -397 -378 13.6291 0.186
NP_440352.1_7 Reverse -151 -164 17.4232 0.194
NP_440545.1_3 Forward -321 -304 9.47861 0.0393
NP_440025.1_1 Forward -321 -302 5.50599 0.293
NP_440025.1_3 Forward -279 -265 12.1598 0.269
NP_440831.1_3 Reverse -323 -342 8.03745 0.233
NP_441786.1_3 Forward -257 -238 7.66927 0.287
NP_441786.1_3 Forward -199 -180 7.07928 0.287
NP_441923.1_6 Forward -199 -185 8.25939 0.278
NP_440004.1_5 Reverse -334 -353 14.0608 0.293
NP_440459.1_2 Reverse -234 -251 12.3302 0.151
NP_440459.1_2 Forward -254 -237 9.67528 0.224
NP_441653.1_2 Forward -328 -309 14.5459 0.0904
NP_441653.1_2 Reverse -297 -316 6.71853 0.225
NP_440010.1_4 Reverse -298 -317 1.96529 0.227
NP_440010.1_4 Reverse -292 -311 -0.787962 0.262
NP_442551.1_4 Reverse -234 -249 -0.905081 0.245
NP_440847.1_3 Reverse -151 -165 14.1586 0.205
NP_442603.1_7 Forward -317 -303 8.3571 0.176
NP_441888.1_7 Reverse -303 -317 13.3726 0.0743
NP_440449.1_6 Forward -253 -235 10.2984 0.158
NP_441948.1_4 Forward -324 -306 -0.374176 0.139
NP_441358.1_2 Forward -164 -145 15.4374 0.171
NP_441833.1_4 Forward -316 -309 15.9687 0.0124
NP_441833.1_4 Reverse -309 -316 15.9687 0.0124
NP_441895.1_2 Forward -392 -373 -17.8968 0.234
NP_442060.1_5 Forward -330 -311 10.8159 0.299
NP_442162.1_9 Forward -316 -309 16.2637 0.0124
NP_442162.1_9 Reverse -309 -316 16.2637 0.0124
NP_440671.1_4 Reverse -302 -316 22.6157 0.00197
NP_440224.1_1 Forward -328 -309 3.04771 0.132
NP_442199.1_5 Reverse -228 -247 1.47442 0.165
NP_442199.1_5 Reverse -288 -307 -1.67217 0.181
NP_442199.1_5 Reverse -300 -319 -3.73712 0.211
NP_442199.1_5 Forward -208 -189 -6.78538 0.281
NP_442140.1_3 Reverse -309 -319 12.2714 0.0632
NP_442140.1_3 Reverse -192 -202 10.8948 0.0893
NP_442140.1_3 Forward -316 -306 8.33817 0.119
NP_442723.1_1 Reverse -140 -159 4.03023 0.276
NP_441692.1_2 Reverse -260 -279 2.94938 0.193
NP_441692.1_2 Forward -142 -123 2.16274 0.212
NP_440875.1_9 Forward -243 -233 11.6815 0.157
NP_440875.1_9 Forward -315 -305 9.05339 0.233
NP_440875.1_9 Reverse -188 -198 7.00932 0.287
NP_441813.1_5 Reverse -306 -316 17.188 0.00979
NP_441813.1_5 Forward -319 -309 8.63316 0.0367
NP_440590.1_4 Forward -173 -160 10.639 0.0261
NP_440590.1_4 Reverse -309 -322 2.2809 0.0939
NP_440590.1_4 Forward -251 -238 -0.767364 0.2
NP_440590.1_4 Forward -316 -303 -2.24233 0.239
NP_440590.1_4 Reverse -321 -334 -5.38892 0.277
NP_440567.1_1 Forward -316 -302 11.5043 0.0285
NP_440567.1_1 Reverse -309 -323 4.52282 0.118
NP_442497.1_10 Forward -316 -307 10.4228 0.0087
NP_442497.1_10 Reverse -309 -318 10.4228 0.0087
NP_442497.1_10 Reverse -237 -246 0.196389 0.208
NP_440821.1_4 Reverse -306 -316 19.0562 0.00399
NP_440821.1_4 Forward -319 -309 9.41981 0.0286
NP_441239.1_9 Reverse -306 -318 13.3137 0.037
NP_441239.1_9 Forward -247 -235 8.39711 0.134
NP_441239.1_9 Reverse -234 -246 8.10212 0.142
NP_441239.1_9 Forward -319 -307 5.93884 0.202
NP_441239.1_9 Forward -352 -340 4.07055 0.264
NP_442568.1_5 Reverse -282 -301 12.8808 0.177
NP_441727.1_3 Forward -324 -305 8.06259 0.213
NP_441892.1_1 Forward -326 -309 2.59545 0.14
NP_441892.1_1 Reverse -299 -316 -0.157821 0.179
NP_441892.1_1 Forward -167 -150 -3.8944 0.251
NP_442193.1_1 Forward -173 -155 8.47561 0.272
NP_442270.1_6 Reverse -307 -325 16.4404 0.279
NP_442270.1_9 Forward -256 -237 -10.0303 0.249
NP_442270.1_9 Forward -328 -309 -10.227 0.253
NP_442643.1_3 Forward -124 -105 -6.39206 0.261
NP_441017.1_8 Reverse -233 -248 6.86307 0.287
NP_443035.1_6 Reverse -147 -166 15.9282 0.208
NP_440949.1_7 Reverse -300 -319 11.8967 0.218
NP_442138.1_10 Reverse -308 -327 13.1758 0.0359
NP_442138.1_10 Forward -317 -298 5.40766 0.0923
NP_442052.1_8 Forward -247 -237 15.3197 0.253
NP_442809.1_6 Reverse -296 -315 1.57275 0.272
NP_440546.1_4 Forward -317 -307 11.8882 0.0679
NP_440546.1_4 Reverse -308 -318 10.046 0.109
NP_440546.1_4 Forward -174 -164 9.75513 0.121
NP_440546.1_4 Forward -252 -242 7.23423 0.252
NP_441230.1_5 Reverse -231 -250 5.01433 0.185
NP_441230.1_5 Reverse -180 -199 1.86774 0.232
NP_440675.1_3 Reverse -308 -327 6.09597 0.277
NP_440462.1_6 Reverse -306 -316 15.418 0.0142
NP_440462.1_6 Forward -319 -309 1.35667 0.294
NP_442592.1_3 Reverse -312 -331 13.5691 0.144
NP_440868.1_4 Reverse -304 -316 8.6921 0.0582
NP_440868.1_4 Forward -321 -309 5.93884 0.0879
NP_441249.1_8 Forward -174 -155 2.26107 0.284
NP_440036.1_1 Reverse -107 -126 9.73422 0.277
NP_441848.1_6 Reverse -156 -175 15.5349 0.259
NP_441084.1_6 Reverse -189 -203 10.0228 0.255
NP_439942.1_7 Reverse -376 -395 2.16274 0.19
NP_440696.1_3 Forward -345 -327 0.117479 0.237
NP_440696.1_6 Forward -239 -220 11.5042 0.207
NP_440696.1_6 Forward -257 -238 10.3242 0.207
NP_442039.1_4 Forward -316 -309 15.1821 0.0124
NP_442039.1_4 Reverse -309 -316 15.1821 0.0124
NP_442039.1_7 Reverse -29 -39 11.8781 0.257
NP_441811.1_1 Reverse -150 -169 4.71934 0.282
NP_441926.1_3 Forward -245 -229 3.89344 0.206
NP_440825.1_7 Reverse -309 -319 12.9096 0.152
NP_442837.1_3 Forward -316 -309 15.7721 0.0124
NP_442837.1_3 Reverse -309 -316 15.7721 0.0124
NP_442053.1_1 Forward -317 -308 18.3876 0.0007
NP_442053.1_1 Reverse -308 -317 18.3876 0.0007
NP_440505.1_3 Reverse -306 -316 13.8447 0.0247
NP_440505.1_3 Forward -319 -309 9.22315 0.122
NP_440505.1_3 Reverse -234 -244 4.79825 0.266
NP_442360.1_5 Forward -251 -241 12.9597 0.298
NP_441102.1_1 Forward -316 -297 18.584 0.0646
NP_441102.1_2 Forward -105 -86 16.8141 0.125
NP_441102.1_4 Forward -155 -136 16.7157 0.248
NP_441102.1_6 Forward -390 -371 19.8623 0.0542
NP_441102.1_8 Forward -225 -206 18.1907 0.259
NP_442456.1_5 Forward -79 -61 10.3439 0.26
NP_441203.1_1 Forward -316 -297 -10.817 0.137
NP_442532.1_4 Reverse -78 -96 9.80712 0.273
NP_440914.1_1 Reverse -308 -318 17.5935 0.000537
NP_440914.1_1 Forward -245 -235 13.2019 0.0378
NP_440914.1_1 Forward -317 -307 8.6151 0.186
NP_441011.1_8 Forward -316 -307 16.9127 0.00602
NP_441011.1_8 Reverse -309 -318 8.25953 0.144
NP_442533.1_1 Forward -171 -152 -5.50708 0.155
NP_442533.1_1 Forward -176 -157 -13.9635 0.239
NP_442533.1_1 Forward -174 -155 -14.8485 0.247
NP_442533.1_6 Forward -317 -308 17.2076 0.00137
NP_442533.1_6 Reverse -308 -317 17.2076 0.00137
NP_442533.1_6 Reverse -165 -174 11.7994 0.0386
NP_442533.1_6 Reverse -236 -245 8.25953 0.0776
NP_442533.1_6 Forward -245 -236 7.66954 0.0897
NP_442533.1_6 Reverse -243 -252 5.40793 0.14
NP_442541.1_10 Forward -350 -336 3.93223 0.252
NP_440263.1_5 Forward -281 -267 21.5341 0.0613
NP_442232.1_3 Forward -190 -171 -15.6352 0.295
NP_442232.1_5 Forward -254 -235 8.75091 0.278
NP_442322.1_4 Reverse -149 -166 -1.04349 0.226
NP_442322.1_4 Reverse -183 -200 -5.96001 0.275
NP_442322.1_4 Reverse -151 -168 -7.33664 0.28
NP_442322.1_4 Reverse -157 -174 -8.8116 0.286
NP_442322.1_4 Reverse -156 -173 -8.90993 0.286
NP_442229.1_1 Forward -319 -305 7.27547 0.196
NP_441482.1_7 Reverse -302 -316 8.25939 0.0181
NP_439944.1_9 Reverse -309 -319 10.5014 0.0887
NP_439944.1_9 Forward -316 -306 10.3048 0.0887
NP_440816.1_2 Forward -110 -91 8.37121 0.246
NP_441028.1_6 Reverse -380 -390 10.1076 0.21
NP_440116.1_5 Forward -320 -303 7.61033 0.155
NP_441527.1_4 Forward -368 -349 -2.72194 0.161
NP_440115.1_6 Forward -206 -196 7.15819 0.158
NP_440007.1_4 Reverse -225 -244 21.3373 0.0466
NP_440007.1_9 Forward -198 -184 4.42448 0.267
NP_440007.1_9 Reverse -304 -318 3.73617 0.267
NP_443045.1_5 Forward -199 -186 13.8487 0.275
NP_441972.1_3 Forward -170 -151 13.0775 0.257
NP_441972.1_5 Reverse -297 -316 11.4058 0.0535
NP_441972.1_5 Reverse -309 -328 6.19431 0.0843
NP_441106.1_1 Reverse -307 -316 18.191 0.0028
NP_441106.1_1 Forward -318 -309 9.63616 0.0311
NP_439903.1_6 Reverse -233 -252 5.99684 0.173
NP_439903.1_6 Reverse -182 -201 1.6703 0.241
NP_439903.1_6 Reverse -374 -393 -0.0996487 0.276
NP_439903.1_6 Reverse -305 -324 -0.984623 0.289
NP_001035870.1_3 Forward -263 -244 -3.93378 0.278
NP_441286.1_1 Forward -318 -306 14.4936 0.00418
NP_441286.1_1 Reverse -307 -319 3.38223 0.0467
NP_440670.1_8 Forward -317 -308 18.3876 0.000699
NP_440670.1_8 Reverse -308 -317 18.3876 0.000699
NP_440670.1_8 Reverse -236 -245 5.3096 0.167
NP_441930.1_2 Forward -246 -236 15.9097 0.19
NP_440886.1_7 Reverse -307 -317 17.7774 0.0011
NP_440886.1_7 Forward -318 -308 7.94438 0.0805
NP_440886.1_7 Reverse -157 -167 5.78111 0.163
NP_440886.1_7 Reverse -164 -174 4.20782 0.249
NP_440828.1_4 Reverse -148 -167 -0.29631 0.19
NP_442614.1_2 Reverse -243 -257 7.47274 0.273
NP_442382.1_9 Reverse -126 -145 8.65176 0.281
NP_442072.1_9 Forward -318 -300 -14.0422 0.129
NP_442072.1_9 Forward -253 -235 -22.892 0.266
NP_440907.2_8 Forward -316 -306 7.84605 0.117
NP_440907.2_8 Reverse -309 -319 7.64939 0.117
NP_442264.1_2 Reverse -298 -315 9.87194 0.193
NP_441021.1_1 Reverse -237 -256 0.982764 0.0848
NP_441021.1_1 Reverse -309 -328 0.58944 0.088
NP_441021.1_1 Forward -316 -297 -12.1936 0.281
NP_440841.1_4 Forward -247 -228 3.73603 0.0964
NP_441463.1_3 Forward -327 -308 8.45592 0.0487
NP_441463.1_3 Forward -315 -296 -0.787193 0.133
NP_441463.1_3 Reverse -310 -329 -3.54046 0.178
NP_441463.1_3 Reverse -298 -317 -6.78538 0.249
NP_441463.1_3 Reverse -226 -245 -7.57203 0.259
NP_441463.1_6 Forward -319 -305 5.54623 0.287
NP_441626.1_2 Forward -316 -309 15.7721 0.0124
NP_441626.1_2 Reverse -309 -316 15.7721 0.0124
NP_441460.1_2 Reverse -381 -394 21.7498 0.00263
NP_442209.1_6 Reverse -237 -256 17.8957 0.185
NP_442794.1_1 Reverse -304 -316 10.1671 0.0721
NP_442794.1_1 Forward -321 -309 2.69391 0.286
NP_442615.1_1 Forward -326 -308 7.68896 0.0306
NP_441962.1_4 Forward -322 -303 -10.7186 0.232
NP_440387.1_1 Forward -317 -301 15.5948 0.00527
NP_440387.1_1 Reverse -308 -324 -2.39974 0.147
NP_441431.1_2 Reverse -233 -247 11.7003 0.135
NP_441431.1_2 Reverse -305 -319 11.5037 0.136
NP_442020.1_1 Forward -365 -346 13.7649 0.0919
NP_441993.1_1 Forward -311 -292 9.64582 0.135
NP_441993.1_1 Forward -177 -158 6.62464 0.178
NP_441993.1_1 Forward -251 -232 1.16703 0.284
NP_441993.1_1 Reverse -237 -256 0.582284 0.297
NP_441174.1_2 Reverse -263 -277 13.0776 0.222
NP_440114.1_10 Forward -245 -231 18.2892 0.00696
NP_440114.1_10 Reverse -236 -250 10.6193 0.142
NP_440114.1_10 Reverse -308 -322 9.5377 0.169
NP_442437.1_8 Forward -316 -297 12.8808 0.133
NP_442698.1_10 Forward -371 -352 0.884433 0.297
NP_441510.2_7 Reverse -302 -316 12.192 0.28
NP_440287.1_5 Reverse -144 -163 7.86512 0.286
NP_440293.1_3 Forward -166 -147 -4.03212 0.257
NP_440766.1_4 Reverse -304 -318 8.25939 0.0871
NP_440766.1_4 Reverse -328 -342 3.14618 0.155
NP_440422.1_10 Reverse -347 -366 13.5991 0.147
NP_441237.1_9 Reverse -309 -319 14.828 0.0242
NP_441237.1_9 Reverse -237 -247 14.0414 0.0535
NP_439910.1_2 Reverse -300 -317 -21.299 0.183
NP_439910.1_2 Forward -325 -308 -21.6923 0.184
NP_442867.1_3 Reverse -83 -102 0.392778 0.262
NP_440457.1_1 Reverse -304 -316 8.29878 0.101
NP_440457.1_1 Forward -164 -152 1.31728 0.241
NP_440457.1_1 Forward -256 -244 0.0389777 0.25
NP_440798.1_1 Forward -286 -268 14.6004 0.294
NP_441801.1_4 Forward -353 -343 11.1898 0.231
NP_440801.1_8 Reverse -307 -326 3.6377 0.225
NP_440801.1_9 Reverse -102 -116 14.7744 0.232
NP_440801.1_10 Reverse -249 -268 5.60432 0.289
NP_440142.1_7 Forward -158 -139 6.4893 0.259
NP_441332.1_6 Reverse -157 -167 13.6798 0.184
NP_441436.1_2 Forward -155 -136 -2.45882 0.28
NP_442509.1_9 Forward -317 -307 16.2041 0.00739
NP_442509.1_9 Reverse -308 -318 8.14104 0.192
NP_440660.1_2 Reverse -222 -241 15.6341 0.14
NP_441253.1_8 Forward -322 -308 15.113 0.122
NP_442514.1_5 Reverse -149 -168 -6.78612 0.274
NP_440554.1_4 Forward -316 -306 14.6313 0.02
NP_440554.1_4 Reverse -166 -176 4.3066 0.195
NP_441885.1_5 Reverse -308 -318 20.9245 0.000538
NP_441885.1_5 Forward -317 -307 11.4848 0.00668
NP_441885.1_5 Forward -252 -242 7.64985 0.0466
NP_442341.1_7 Forward -318 -304 17.7975 0.0111
NP_442341.1_7 Reverse -307 -321 8.35772 0.0881
NP_442341.1_7 Forward -253 -239 2.45787 0.256
NP_442341.1_9 Reverse -306 -320 14.4536 0.068
NP_442341.1_9 Reverse -234 -248 10.8154 0.133
NP_441756.1_5 Reverse -304 -323 -3.73712 0.29
NP_442395.2_4 Forward -318 -299 2.26028 0.223
NP_440750.1_5 Forward -365 -351 5.1128 0.294
NP_440423.1_6 Forward -325 -306 -21.535 0.297
NP_443000.1_7 Forward -319 -309 10.3048 0.0345
NP_443000.1_7 Reverse -306 -316 8.73149 0.0437
NP_443000.1_7 Reverse -234 -244 0.668351 0.293
NP_440507.2_3 Reverse -299 -318 8.75009 0.244
NP_441842.1_10 Forward -324 -310 10.9143 0.148
NP_440275.1_3 Reverse -306 -316 8.4365 0.0602
NP_440275.1_3 Forward -319 -309 8.04317 0.0602
NP_442932.1_10 Reverse -245 -264 10.8159 0.123
NP_440091.1_1 Forward -321 -309 8.88877 0.0567
NP_440091.1_1 Reverse -304 -316 1.41561 0.197
NP_440091.1_1 Forward -204 -192 1.02229 0.218
NP_441902.1_3 Reverse -13 -23 12.9817 0.23
NP_441122.1_1 Forward -256 -241 9.91133 0.28
NP_442495.1_5 Forward -211 -192 5.60432 0.291
NP_441105.1_3 Reverse -225 -244 9.3409 0.0465
NP_441105.1_3 Reverse -297 -316 7.07928 0.0565
NP_441105.1_3 Forward -322 -303 -8.752 0.278
NP_442373.1_2 Forward -170 -151 -0.0988766 0.19
NP_440216.1_1 Reverse -308 -322 -1.77037 0.0383
NP_440216.1_1 Forward -317 -303 -2.26202 0.0484
NP_440216.1_1 Forward -245 -231 -3.63866 0.0849
NP_440216.1_1 Reverse -236 -250 -11.3085 0.178
NP_440216.1_9 Forward -16 -7 13.6677 0.189
NP_440216.1_9 Forward -391 -382 8.65285 0.286
NP_440216.1_9 Forward -390 -381 7.27622 0.286
NP_440216.1_9 Forward -123 -114 6.39124 0.289
NP_440216.1_9 Reverse -328 -337 5.3096 0.298
NP_440172.1_1 Reverse -308 -318 15.0247 0.00945
NP_440172.1_1 Forward -245 -235 11.5831 0.0368
NP_440172.1_1 Forward -317 -307 8.73149 0.0586
NP_440172.1_1 Reverse -236 -246 3.61828 0.222
NP_442371.1_1 Forward -389 -379 14.0409 0.191
NP_442015.1_3 Reverse -150 -169 9.53674 0.296
NP_442015.1_10 Reverse -304 -317 19.1938 0.00444
NP_442015.1_10 Reverse -386 -399 3.5592 0.179
NP_442015.1_10 Forward -321 -308 1.59258 0.204
NP_441226.1_7 Forward -316 -309 14.4934 0.0123
NP_441226.1_7 Reverse -309 -316 14.4934 0.0123
NP_441226.1_7 Reverse -166 -173 8.29857 0.205
NP_441111.1_7 Forward -316 -308 18.7023 0.00294
NP_441111.1_7 Reverse -309 -317 18.7023 0.00294
NP_442379.1_10 Forward -154 -137 -0.354483 0.223
NP_440244.1_1 Forward -168 -149 -1.37718 0.203
NP_440244.1_1 Forward -162 -143 -5.99873 0.286
NP_441766.1_2 Forward -317 -308 17.5026 0.00297
NP_441766.1_2 Reverse -308 -317 17.5026 0.00297
NP_441766.1_2 Reverse -138 -147 1.47469 0.289
NP_442417.1_5 Forward -317 -303 21.3374 0.00922
NP_440416.1_1 Forward -245 -226 -12.2919 0.272
NP_440416.1_9 Reverse -301 -320 -12.3902 0.157
NP_440416.1_9 Reverse -325 -344 -14.3569 0.176
NP_440416.1_9 Forward -312 -293 -16.8151 0.223
NP_440416.1_9 Forward -324 -305 -18.5851 0.26
NP_440416.1_9 Reverse -138 -157 -19.2734 0.272
NP_440416.1_9 Reverse -158 -177 -19.9617 0.281
NP_443052.1_8 Forward -327 -308 -7.57203 0.161
NP_443052.1_8 Forward -235 -216 -9.44032 0.19
NP_443052.1_9 Reverse -151 -170 -7.27704 0.295
NP_440072.1_3 Reverse -340 -359 17.6007 0.294
NP_441940.1_1 Reverse -154 -173 11.405 0.212
NP_442154.1_1 Forward -343 -325 -17.4838 0.257
NP_440261.1_5 Forward -316 -303 -10.5021 0.201
NP_440261.1_5 Reverse -237 -250 -10.5021 0.201
NP_440988.1_10 Reverse -324 -338 6.54464 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTTGATCCGCCAGGGAAAAATTCTGGGCAGTGAGAAAAGTAACAAAAAATCCCCGGGCCCCGTTTTCAGTGGCGACCAAATTGGCGATCGCCGTGGTCATTTCCTGGTCAGTAAGATTATTTGCCGCAATTTCTAGCAATAATGCCTGGCTATGGGCAATGGCCTGTTCAAAGCTGAGGTCAGTGTAATTTATGGAAGCAACCATGGCATTGGGGTGAGGATTCAAGGGATGGGCGGCGGGGGAGAGGGAAAGGAGAGCGGGTAAAATCAACGGCAACATGGAAAATGCCTAGGGAAAATGGGAAGATTTTCTCGACTATTGTAGTCAGTGGTGCCAAGATTTACATCCGAACCGTGTCTTGCTCCCAGGGATTAATCTCTCCCCAATGAAAATAAAGT

CDS

ATGGAATTAACAATCGGCTGGCTTTATCCCAAACTCATGAGCACCTACGGCGATCGGGGCAATGTCATTTGCATCCAACGTCGTTGTCAATGGCGGGATATCCCTGTGAAAATTCTGCCCCTGGAACAGACCAGCGAGGCGGCACTGTTTCTCCAAGCCGACTTAATTGTGGGGGGCGGGGCCCAGGATCGCCAACAGGAAATTGTCATGCGGGATTTGCAAGGATCCAAAGCAGAGGCGCTGAAAAATCAGTTAGACGATGGCATTCCCGGAGTATTCACCTGTGGTTCTCCCCAACTGCTGGGGCATTATTACGAGCCTGCCTTAGGGCAACGCATTCAGGGTTTGGGACTGCTGGATATGGTCAGTAAACATCCAGGACCAGAAGCAAAACGCTGCATTGGTAACGTAGTGTTTGAAATTACCGCTGAACCCCTCCGGCAAGAATTACAGGCTATGACCGGGGAAACTCCCATTGTCATTGGCTTTGAAAACCATGGCGGCCGCACCTATCTCCAAACCGTTTCTCCCCTGGGTAAGGTTAAAACCGGCTATGGCAACAACGGCGAAGATGGCTTTGAGGGGGCTTTCCACCAAAAGGCGATCGCCACTTACTCCCATGGCCCTCTGTTGCCCAAAAATCCCTTTTTAGCTGATTGGTTAATCCGCACGGCGTTGGAGAAGAAGTATCAGGATTCGGTGCAGTTAACTCCCTTGGATGACTGCCTCGCCCAACAAGCCCGCGCCGCCATGCTCAAACGGCTAGAATAG

Protein

MELTIGWLYPKLMSTYGDRGNVICIQRRCQWRDIPVKILPLEQTSEAALFLQADLIVGGGAQDRQQEIVMRDLQGSKAEALKNQLDDGIPGVFTCGSPQLLGHYYEPALGQRIQGLGLLDMVSKHPGPEAKRCIGNVVFEITAEPLRQELQAMTGETPIVIGFENHGGRTYLQTVSPLGKVKTGYGNNGEDGFEGAFHQKAIATYSHGPLLPKNPFLADWLIRTALEKKYQDSVQLTPLDDCLAQQARAAMLKRLE