Your browser is old and dusty. Try Google Chrome!

Details for slr1740

ORF slr1740
Accession NP_441100.1
Symbol
Category oligopeptide binding protein of ABC transporter
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -148 -134 10.1277 0.0651
NP_441061.1_2 Reverse -134 -148 7.37441 0.104
NP_441061.1_2 Reverse -146 -160 6.48943 0.117
NP_441061.1_2 Reverse -179 -193 -0.393733 0.228
NP_441061.1_2 Reverse -378 -392 -2.65535 0.3
NP_440795.1_7 Forward -399 -392 5.64398 0.293
NP_442100.1_1 Forward -276 -257 5.58586 0.296
NP_442291.1_5 Forward -363 -347 -4.56302 0.28
NP_440295.1_9 Forward -244 -225 7.86593 0.089
NP_440897.1_6 Forward -373 -354 -3.83621 0.257
NP_441453.1_4 Forward -400 -392 7.00092 0.107
NP_441453.1_4 Forward -362 -354 6.80426 0.121
NP_441453.1_7 Forward -191 -184 12.1338 0.295
NP_442151.1_6 Forward -386 -372 11.701 0.0933
NP_442151.1_6 Forward -155 -141 8.06273 0.183
NP_442151.1_6 Reverse -377 -391 7.47274 0.197
NP_440561.1_1 Reverse -217 -236 12.585 0.249
NP_440226.1_1 Reverse -353 -372 5.30933 0.161
NP_440150.1_2 Reverse -204 -223 5.50519 0.269
NP_442744.1_8 Forward -386 -367 -6.1954 0.297
NP_442173.1_1 Reverse -392 -400 6.01761 0.2
NP_442173.1_1 Reverse -354 -362 5.72262 0.203
NP_442173.1_1 Forward -399 -391 4.73931 0.258
NP_442173.1_1 Forward -361 -353 4.54265 0.27
NP_442752.1_4 Forward -362 -355 13.8055 0.0199
NP_442752.1_4 Forward -293 -286 10.8555 0.0846
NP_442752.1_4 Forward -400 -393 4.26735 0.293
NP_443027.1_4 Forward -364 -354 9.41981 0.163
NP_443027.1_4 Forward -243 -233 5.78156 0.298
NP_441812.1_3 Forward -387 -373 6.98109 0.287
NP_441812.1_3 Forward -188 -174 6.6861 0.298
NP_442975.1_10 Reverse -174 -188 4.52221 0.245
NP_441225.1_1 Reverse -286 -305 4.81767 0.0737
NP_440784.1_7 Reverse -392 -399 13.8055 0.0224
NP_440784.1_7 Forward -399 -392 6.43063 0.218
NP_440784.1_7 Forward -361 -354 6.23397 0.241
NP_440784.1_7 Reverse -354 -361 6.13563 0.241
NP_440784.1_7 Reverse -378 -385 5.84064 0.248
NP_440061.1_9 Reverse -282 -296 15.4369 0.0448
NP_440061.1_9 Reverse -351 -365 8.06211 0.183
NP_442062.1_3 Forward -213 -194 2.0644 0.222
NP_442062.1_8 Forward -362 -352 14.238 0.0148
NP_442062.1_8 Forward -400 -390 7.55152 0.0946
NP_442062.1_8 Reverse -71 -81 6.56821 0.123
NP_442062.1_8 Forward -293 -283 4.99491 0.188
NP_442972.1_2 Reverse -248 -262 13.6669 0.185
NP_440304.1_4 Forward -295 -285 6.56821 0.15
NP_440304.1_4 Forward -150 -140 5.19158 0.223
NP_442242.1_4 Reverse -354 -361 10.8555 0.127
NP_442242.1_4 Reverse -392 -399 10.4622 0.161
NP_440044.1_1 Forward -78 -59 15.8307 0.139
NP_442981.1_4 Forward -111 -92 21.9264 0.0199
NP_441594.1_6 Forward -145 -126 11.7992 0.116
NP_441594.1_6 Forward -296 -277 0.982764 0.276
NP_442110.1_7 Forward -400 -386 3.93283 0.209
NP_442110.1_7 Reverse -133 -147 0.687908 0.252
NP_441083.1_5 Forward -362 -352 1.06167 0.218
NP_441083.1_5 Forward -400 -390 0.0783647 0.245
NP_441738.1_2 Reverse -355 -362 15.28 0.0102
NP_441558.1_5 Reverse -282 -301 3.73603 0.299
NP_441942.1_7 Reverse -130 -149 11.7992 0.277
NP_440209.1_1 Forward -400 -392 8.57422 0.0425
NP_440209.1_1 Forward -362 -354 8.57422 0.0425
NP_440209.1_1 Reverse -353 -361 5.23096 0.145
NP_442889.1_8 Forward -365 -351 10.0287 0.0916
NP_440447.1_1 Forward -367 -349 4.54237 0.223
NP_440056.1_9 Reverse -330 -349 12.5063 0.295
NP_441770.1_4 Forward -321 -302 -11.6036 0.29
NP_440178.1_7 Reverse -283 -302 -11.7019 0.0998
NP_441716.1_1 Reverse -377 -391 2.94952 0.284
NP_441716.1_1 Reverse -232 -246 2.65453 0.298
NP_441327.1_4 Reverse -346 -360 16.7159 0.282
NP_442111.1_4 Reverse -352 -366 3.73617 0.233
NP_441624.1_7 Reverse -134 -148 11.111 0.213
NP_441163.1_1 Forward -309 -292 5.44632 0.274
NP_440906.1_5 Reverse -392 -399 6.43063 0.223
NP_440906.1_5 Forward -399 -392 6.3323 0.234
NP_440906.1_5 Forward -361 -354 6.23397 0.234
NP_440906.1_5 Reverse -354 -361 6.13563 0.241
NP_440747.1_10 Reverse -350 -362 5.05386 0.019
NP_440747.1_10 Forward -365 -353 -2.32097 0.0331
NP_440747.1_10 Reverse -388 -400 -11.4657 0.122
NP_441854.1_8 Forward -102 -84 16.3421 0.283
NP_441486.1_1 Reverse -281 -295 -0.197071 0.15
NP_442634.1_4 Forward -364 -350 -2.16369 0.149
NP_441265.1_3 Reverse -385 -399 4.32615 0.181
NP_441012.1_4 Reverse -373 -386 7.98409 0.272
NP_443018.1_3 Forward -361 -354 12.6255 0.0471
NP_443018.1_3 Forward -292 -285 11.5438 0.0752
NP_443018.1_3 Reverse -392 -399 5.44732 0.193
NP_443018.1_3 Forward -399 -392 5.34899 0.212
NP_443018.1_3 Reverse -354 -361 5.25066 0.214
NP_441634.1_8 Reverse -282 -296 -0.0987402 0.247
NP_440376.1_1 Forward -400 -391 0.491382 0.273
NP_440376.1_1 Reverse -391 -400 0.393051 0.279
NP_440376.1_1 Forward -362 -353 0.0980582 0.285
NP_440376.1_1 Reverse -353 -362 -0.196935 0.285
NP_441588.1_4 Forward -153 -143 5.78156 0.235
NP_442485.1_3 Forward -154 -135 -2.45882 0.262
NP_441846.1_10 Forward -251 -232 -23.1083 0.277
NP_440642.1_10 Reverse -283 -297 10.8154 0.161
NP_442658.1_1 Forward -295 -285 7.0594 0.214
NP_440141.1_8 Forward -337 -318 4.52268 0.288
NP_442782.1_2 Forward -148 -134 6.6861 0.22
NP_442782.1_2 Reverse -60 -74 0.491246 0.289
NP_442205.1_3 Reverse -64 -83 15.5354 0.285
NP_442205.1_9 Forward -247 -231 -3.97304 0.3
NP_441414.1_9 Forward -362 -343 -9.34199 0.259
NP_441487.1_9 Reverse -220 -239 1.67108 0.197
NP_442937.1_5 Forward -391 -372 11.1109 0.145
NP_441958.1_5 Forward -363 -353 2.63497 0.0388
NP_441958.1_5 Reverse -390 -400 1.25834 0.108
NP_440610.1_8 Forward -243 -224 8.35759 0.288
NP_441127.1_1 Reverse -2 -16 9.63603 0.271
NP_442057.1_4 Forward -257 -238 13.3725 0.259
NP_440203.1_5 Reverse -235 -245 13.8442 0.11
NP_442911.1_2 Forward -197 -178 -6.49039 0.184
NP_440153.1_5 Reverse -92 -106 1.27789 0.262
NP_440369.1_5 Forward -155 -136 8.94757 0.276
NP_442064.1_1 Reverse -348 -367 -9.047 0.259
NP_443055.1_3 Forward -250 -231 10.3587 0.291
NP_442236.1_3 Reverse -69 -88 12.4875 0.183
NP_440827.1_1 Forward -253 -234 17.699 0.202
NP_440827.1_2 Forward -190 -171 22.7139 0.00645
NP_440827.1_3 Forward -154 -135 20.354 0.101
NP_441099.1_5 Reverse -81 -100 -5.80207 0.154
NP_441099.1_5 Forward -396 -377 -5.99873 0.155
NP_441654.1_7 Forward -72 -53 11.3715 0.285
NP_441646.1_1 Reverse -145 -164 7.86593 0.152
NP_441646.1_1 Forward -393 -374 1.37609 0.231
NP_442431.1_2 Forward -118 -99 17.6007 0.188
NP_441000.1_6 Forward -85 -71 0.392915 0.194
NP_440484.1_3 Forward -364 -350 10.9143 0.242
NP_441175.1_7 Forward -193 -174 5.70265 0.276
NP_441550.1_8 Forward -364 -354 6.56775 0.201
NP_441916.1_7 Reverse -353 -363 7.45319 0.0656
NP_441916.1_10 Forward -150 -131 1.67108 0.262
NP_440383.1_1 Forward -253 -234 5.60432 0.211
NP_441041.1_4 Forward -154 -135 3.44104 0.065
NP_441041.1_4 Reverse -134 -153 -3.14714 0.119
NP_441041.1_4 Forward -148 -129 -3.83545 0.126
NP_442396.1_5 Forward -170 -157 5.23083 0.292
NP_441725.1_5 Forward -399 -389 10.2065 0.0317
NP_441725.1_5 Reverse -140 -150 7.15819 0.103
NP_441725.1_5 Reverse -285 -295 6.37155 0.115
NP_439966.1_7 Reverse -282 -292 7.35439 0.15
NP_439966.1_7 Forward -364 -354 4.60114 0.265
NP_442941.1_3 Reverse -354 -364 9.41981 0.0319
NP_442941.1_3 Forward -186 -176 5.68323 0.103
NP_442941.1_5 Forward -15 -1 14.334 0.293
NP_442281.1_1 Forward -367 -353 9.83206 0.0661
NP_442281.1_1 Reverse -386 -400 2.94893 0.249
NP_441334.1_7 Reverse -351 -370 -13.9635 0.242
NP_440437.1_1 Forward -382 -363 0.0977854 0.172
NP_440437.1_1 Reverse -278 -297 -1.57384 0.205
NP_442049.1_8 Forward -238 -219 19.9606 0.0905
NP_440498.1_1 Reverse -344 -362 1.88744 0.201
NP_442982.1_5 Forward -90 -71 3.34271 0.21
NP_442068.1_4 Reverse -239 -258 4.03023 0.299
NP_441644.1_6 Forward -362 -352 5.28945 0.199
NP_441644.1_6 Forward -148 -138 5.28945 0.199
NP_441644.1_6 Forward -386 -376 4.30615 0.242
NP_441644.1_6 Forward -400 -390 3.91283 0.256
NP_441644.1_6 Forward -293 -283 3.61784 0.272
NP_441644.1_6 Reverse -134 -144 3.22451 0.293
NP_443049.1_6 Forward -294 -284 14.3735 0.114
NP_443049.1_6 Forward -363 -353 11.7385 0.24
NP_442215.1_2 Reverse -131 -147 5.76173 0.0769
NP_442215.1_2 Forward -151 -135 -0.924775 0.175
NP_442215.1_2 Forward -157 -141 -5.64466 0.254
NP_442215.1_2 Reverse -144 -160 -6.52964 0.273
NP_442215.1_2 Reverse -351 -367 -7.31629 0.291
NP_442029.1_6 Reverse -124 -143 6.98095 0.231
NP_442029.1_8 Forward -321 -302 9.43923 0.284
NP_440929.1_8 Forward -400 -391 16.126 0.00544
NP_440929.1_8 Reverse -391 -400 8.1612 0.0473
NP_440929.1_8 Reverse -353 -362 7.76787 0.0533
NP_440929.1_8 Forward -362 -353 7.66954 0.0624
NP_442933.1_10 Forward -400 -391 7.17789 0.112
NP_442933.1_10 Reverse -353 -362 6.48957 0.119
NP_440382.1_2 Reverse -251 -270 3.83357 0.274
NP_441751.2_8 Reverse -354 -368 2.75286 0.0759
NP_441751.2_8 Reverse -179 -193 -4.22864 0.166
NP_442554.1_8 Reverse -354 -364 7.45319 0.092
NP_442554.1_8 Reverse -285 -295 6.07655 0.126
NP_442554.1_8 Forward -361 -351 2.53664 0.268
NP_442554.1_8 Forward -142 -132 2.43831 0.272
NP_442554.1_8 Reverse -140 -150 2.14332 0.281
NP_442554.1_8 Forward -292 -282 2.04498 0.285
NP_442554.1_8 Forward -399 -389 1.94665 0.288
NP_442292.1_1 Forward -361 -352 8.1612 0.0478
NP_442292.1_1 Reverse -354 -363 7.66954 0.0634
NP_442292.1_1 Forward -399 -390 -0.590259 0.258
NP_440254.1_1 Reverse -172 -191 9.43923 0.228
NP_442476.1_6 Reverse -354 -368 3.14618 0.161
NP_440895.1_6 Reverse -264 -277 8.18076 0.291
NP_442381.1_4 Reverse -353 -372 17.404 0.207
NP_442301.1_2 Reverse -168 -187 5.80018 0.263
NP_441715.1_4 Reverse -354 -364 6.96153 0.121
NP_443034.1_4 Forward -244 -225 20.8456 0.118
NP_440379.1_5 Forward -152 -133 -2.95047 0.204
NP_441468.1_1 Forward -399 -392 12.3305 0.0592
NP_441468.1_1 Reverse -392 -399 6.43063 0.175
NP_441468.1_1 Forward -361 -354 6.13563 0.209
NP_441468.1_1 Reverse -354 -361 6.0373 0.223
NP_441468.1_1 Forward -292 -285 4.07068 0.263
NP_441020.2_6 Forward -244 -227 7.11867 0.241
NP_441015.1_10 Forward -154 -135 6.19431 0.111
NP_441015.1_10 Forward -304 -285 2.16274 0.152
NP_441673.1_1 Forward -400 -391 1.57302 0.0764
NP_441673.1_1 Reverse -391 -400 1.57302 0.0764
NP_441673.1_1 Forward -362 -353 1.37636 0.114
NP_441673.1_1 Reverse -353 -362 1.1797 0.163
NP_441956.1_9 Forward -363 -344 4.32602 0.281
NP_441826.1_2 Reverse -140 -154 -2.55701 0.273
NP_441826.1_5 Forward -154 -135 4.32602 0.255
NP_441330.1_1 Forward -367 -348 -15.5368 0.285
NP_442490.1_9 Forward -142 -123 -6.88371 0.275
NP_441764.1_8 Forward -117 -107 14.6604 0.284
NP_442868.1_6 Forward -364 -354 0.668351 0.213
NP_442719.1_2 Reverse -65 -83 -10.9946 0.286
NP_440051.1_5 Reverse -26 -40 15.5167 0.219
NP_442050.1_5 Reverse -176 -186 10.206 0.162
NP_442342.1_9 Forward -388 -372 2.12349 0.29
NP_441114.1_3 Reverse -185 -194 6.39124 0.277
NP_440558.1_2 Reverse -130 -149 3.14605 0.161
NP_440558.1_2 Reverse -136 -155 -1.96717 0.22
NP_440558.1_2 Forward -146 -127 -5.60541 0.262
NP_441518.1_3 Forward -75 -56 -14.8485 0.283
NP_442792.1_4 Forward -238 -219 15.3391 0.167
NP_441878.1_6 Forward -294 -284 1.74999 0.0642
NP_441878.1_6 Reverse -390 -400 0.963343 0.128
NP_441878.1_6 Forward -149 -139 -7.49312 0.231
NP_441100.1_3 Forward -59 -40 29.2679 0.000675
NP_441100.1_6 Forward -264 -250 21.9408 0.00587
NP_441036.1_3 Forward -44 -25 -3.73712 0.26
NP_441036.1_8 Reverse -390 -400 5.78156 0.258
NP_442503.1_9 Forward -143 -124 8.35759 0.221
NP_441557.1_5 Reverse -391 -400 7.96454 0.0372
NP_441557.1_5 Reverse -353 -362 7.57121 0.049
NP_441557.1_5 Forward -400 -391 1.27803 0.0743
NP_441557.1_5 Forward -362 -353 1.08137 0.0794
NP_442183.1_1 Reverse -178 -192 5.30946 0.223
NP_440676.1_4 Forward -111 -92 18.6815 0.267
NP_442347.1_2 Reverse -76 -85 6.68623 0.156
NP_442347.1_2 Reverse -179 -188 3.83464 0.284
NP_442347.1_2 Reverse -354 -363 3.14632 0.286
NP_442965.1_4 Forward -392 -373 12.2908 0.208
NP_441037.1_4 Forward -295 -285 8.58464 0.237
NP_441633.1_3 Reverse -282 -295 -4.01229 0.179
NP_441633.1_3 Reverse -73 -86 -6.86388 0.277
NP_441633.1_3 Reverse -351 -364 -6.96221 0.283
NP_440136.1_2 Reverse -392 -399 6.52896 0.116
NP_440136.1_2 Forward -399 -392 6.43063 0.154
NP_440136.1_2 Forward -361 -354 6.23397 0.171
NP_440136.1_2 Reverse -354 -361 6.13563 0.193
NP_440136.1_2 Forward -186 -179 4.26735 0.218
NP_442590.1_10 Reverse -127 -146 14.5524 0.122
NP_442998.1_5 Reverse -333 -343 10.8948 0.201
NP_442998.1_5 Forward -75 -65 8.73149 0.261
NP_442998.1_10 Reverse -355 -362 15.5754 0.0102
NP_442998.1_10 Reverse -393 -400 6.13563 0.181
NP_442998.1_10 Reverse -286 -293 6.13563 0.181
NP_440899.1_1 Forward -154 -135 7.13875 0.267
NP_440899.1_2 Forward -373 -354 12.7816 0.112
NP_441799.1_1 Forward -366 -352 4.8172 0.236
NP_441007.1_10 Forward -367 -354 1.39592 0.203
NP_441007.1_10 Forward -298 -285 1.10092 0.209
NP_442201.1_10 Reverse -380 -399 -8.65367 0.224
NP_442333.2_5 Forward -159 -140 -6.09707 0.219
NP_440256.1_1 Reverse -136 -155 -5.70374 0.189
NP_441090.1_2 Forward -399 -380 10.5209 0.0791
NP_441559.1_8 Reverse -227 -241 -6.78525 0.279
NP_440915.1_6 Forward -390 -376 2.2612 0.121
NP_442158.1_4 Forward -259 -249 13.943 0.21
NP_442866.1_1 Forward -154 -135 -3.44213 0.221
NP_441939.1_4 Forward -358 -339 13.2252 0.257
NP_442993.1_1 Forward -386 -370 -11.4462 0.247
NP_442993.1_1 Reverse -313 -329 -11.8395 0.26
NP_442386.1_9 Forward -188 -179 8.94741 0.178
NP_440570.1_5 Forward -396 -377 -2.95047 0.283
NP_441340.1_5 Forward -361 -354 6.23397 0.132
NP_441340.1_5 Reverse -392 -399 6.23397 0.132
NP_441340.1_5 Forward -399 -392 6.13563 0.175
NP_441340.1_5 Reverse -354 -361 5.84064 0.208
NP_441947.1_1 Forward -153 -134 9.14423 0.205
NP_442240.1_2 Reverse -354 -373 -3.63879 0.0766
NP_442240.1_2 Forward -399 -380 -20.65 0.295
NP_440586.1_8 Forward -361 -354 14.69 0.026
NP_440586.1_8 Forward -292 -285 10.9535 0.119
NP_442251.1_6 Reverse -354 -361 12.0355 0.0627
NP_442959.1_5 Reverse -336 -355 16.5191 0.166
NP_441262.1_3 Forward -362 -355 14.7888 0.0223
NP_441262.1_3 Reverse -391 -398 5.44732 0.11
NP_441262.1_3 Forward -400 -393 5.25066 0.215
NP_441262.1_3 Forward -293 -286 5.25066 0.215
NP_440027.1_8 Reverse -136 -155 5.11187 0.285
NP_443051.1_1 Forward -363 -354 10.0295 0.0139
NP_443051.1_1 Reverse -390 -399 6.5879 0.0724
NP_443051.1_1 Forward -294 -285 -1.18024 0.297
NP_439937.1_8 Forward -95 -76 -2.36049 0.259
NP_440372.1_2 Reverse -392 -399 6.92228 0.0492
NP_440372.1_2 Forward -399 -392 6.82395 0.0854
NP_440372.1_2 Forward -361 -354 6.82395 0.0854
NP_440372.1_2 Reverse -354 -361 6.52896 0.188
NP_441789.1_7 Reverse -223 -242 -4.42619 0.281
NP_440378.1_1 Forward -244 -225 24.8772 0.00295
NP_441616.1_1 Forward -291 -272 1.47442 0.22
NP_441572.1_7 Forward -368 -349 0.786102 0.161
NP_440267.1_2 Reverse -386 -400 5.70218 0.259
NP_442384.1_10 Forward -386 -373 2.96921 0.206
NP_440693.1_4 Reverse -342 -361 16.7157 0.24
NP_441018.1_7 Reverse -67 -86 7.47261 0.269
NP_442790.1_4 Forward -395 -376 -13.3736 0.26
NP_442262.1_10 Forward -361 -354 12.9205 0.0422
NP_442262.1_10 Forward -292 -285 11.7405 0.0841
NP_441689.1_5 Reverse -176 -186 8.04271 0.166
NP_442244.1_6 Forward -236 -217 1.57275 0.291
NP_440163.1_10 Reverse -316 -326 8.1415 0.287
NP_440282.1_3 Forward -154 -135 3.44104 0.271
NP_440531.1_6 Forward -370 -351 1.27776 0.178
NP_442693.1_7 Forward -156 -137 11.6025 0.227
NP_440297.1_9 Forward -399 -389 9.81313 0.0917
NP_440297.1_9 Reverse -140 -150 7.05986 0.15
NP_440297.1_9 Reverse -285 -295 -0.0199663 0.282
NP_440297.1_9 Forward -292 -282 -0.41329 0.283
NP_441896.1_3 Reverse -156 -175 -1.67217 0.267
NP_441103.1_9 Reverse -234 -244 13.8568 0.234
NP_440888.1_2 Reverse -377 -391 7.57046 0.19
NP_440575.1_8 Reverse -254 -273 -3.44213 0.255
NP_442818.1_3 Reverse -56 -73 -5.36936 0.276
NP_441543.1_2 Reverse -354 -363 6.09625 0.153
NP_441543.1_2 Forward -361 -352 5.50626 0.197
NP_442845.1_2 Forward -149 -135 7.57108 0.195
NP_442845.1_2 Reverse -172 -186 4.81781 0.251
NP_442845.1_4 Forward -364 -345 7.66927 0.189
NP_442578.1_7 Forward -361 -354 14.6904 0.026
NP_442578.1_7 Forward -399 -392 5.25066 0.251
NP_442578.1_7 Reverse -392 -399 5.15232 0.291
NP_442578.1_7 Forward -292 -285 5.15232 0.291
NP_441462.1_2 Forward -400 -390 1.74999 0.0811
NP_441462.1_2 Reverse -353 -363 0.57002 0.144
NP_441929.1_3 Reverse -277 -296 6.98095 0.266
NP_443062.1_1 Reverse -134 -152 5.5232 0.227
NP_443062.1_6 Reverse -262 -281 7.37428 0.17
NP_442204.1_1 Forward -366 -355 11.2684 0.0565
NP_442204.1_1 Forward -245 -234 -0.432984 0.299
NP_440544.1_5 Reverse -110 -117 14.5681 0.264
NP_441351.1_8 Forward -295 -276 1.17943 0.276
NP_440255.1_3 Reverse -260 -270 14.918 0.298
NP_440516.1_8 Forward -362 -353 1.08137 0.129
NP_440516.1_8 Forward -400 -391 -0.000272808 0.156
NP_442428.1_5 Reverse -392 -399 6.43063 0.148
NP_442428.1_5 Forward -399 -392 6.3323 0.193
NP_442428.1_5 Forward -361 -354 6.13563 0.209
NP_442428.1_5 Reverse -354 -361 6.0373 0.212
NP_442428.1_5 Forward -292 -285 4.46401 0.267
NP_441443.1_1 Forward -296 -277 4.62101 0.194
NP_442120.1_10 Forward -155 -136 -16.1268 0.296
NP_440673.1_3 Reverse -355 -362 12.4288 0.0426
NP_440673.1_3 Reverse -286 -293 11.6422 0.0724
NP_441052.1_2 Reverse -377 -387 11.5831 0.0285
NP_441052.1_2 Forward -362 -352 6.8632 0.0857
NP_441052.1_2 Forward -293 -283 3.71661 0.175
NP_441052.1_2 Forward -386 -376 1.94665 0.221
NP_442219.1_9 Reverse -179 -188 4.32629 0.198
NP_440436.1_4 Forward -278 -269 7.76745 0.124
NP_440436.1_4 Forward -399 -390 4.12922 0.288
NP_442864.1_7 Forward -105 -87 5.13236 0.294
NP_442907.1_9 Forward -148 -129 -7.08038 0.293
NP_441719.1_4 Forward -361 -354 13.5105 0.026
NP_441719.1_4 Reverse -392 -399 6.92228 0.0565
NP_441719.1_4 Forward -399 -392 6.82395 0.0855
NP_441719.1_4 Reverse -354 -361 6.52896 0.188
NP_441719.1_4 Forward -292 -285 3.77569 0.285
NP_442366.1_3 Forward -150 -132 -0.7675 0.199
NP_440296.1_10 Forward -244 -225 -11.8003 0.269
NP_442206.1_10 Forward -362 -347 2.73316 0.198
NP_442854.1_6 Forward -149 -130 4.03102 0.252
NP_440328.1_4 Reverse -347 -366 1.57275 0.223
NP_440328.1_4 Forward -368 -349 -0.983855 0.295
NP_440508.1_2 Reverse -209 -228 14.3526 0.234
NP_441851.1_10 Forward -294 -284 11.8781 0.0602
NP_441851.1_10 Forward -188 -178 11.5831 0.0685
NP_441851.1_10 Reverse -390 -400 6.66654 0.159
NP_441851.1_10 Forward -363 -353 4.40493 0.271
NP_441851.1_10 Reverse -352 -362 4.40493 0.271
NP_441157.1_1 Forward -339 -325 5.30886 0.241
NP_441668.1_3 Reverse -61 -80 6.88262 0.249
NP_441668.1_4 Reverse -130 -149 -2.75381 0.294
NP_440593.1_3 Reverse -135 -154 -6.29373 0.272
NP_441982.1_6 Forward -204 -195 13.0583 0.274
NP_441046.1_2 Forward -304 -285 -0.197208 0.276
NP_441046.1_2 Reverse -60 -79 -0.688862 0.284
NP_441349.1_10 Reverse -343 -362 -5.80207 0.212
NP_441409.1_6 Forward -368 -349 -6.78538 0.136
NP_440432.1_9 Reverse -285 -300 -4.54333 0.211
NP_440431.1_3 Forward -280 -261 -1.67217 0.16
NP_440431.1_7 Reverse -61 -80 -1.47551 0.297
NP_442450.1_5 Reverse -389 -399 9.02648 0.12
NP_440588.1_2 Reverse -75 -94 0.392778 0.147
NP_442006.1_2 Forward -302 -285 2.30045 0.101
NP_441003.1_9 Forward -395 -376 4.81767 0.277
NP_440483.1_4 Forward -109 -90 2.16274 0.288
NP_442243.1_1 Forward -161 -143 -3.02983 0.298
NP_441570.1_1 Forward -362 -344 -9.42063 0.137
NP_441570.1_1 Forward -400 -382 -9.91228 0.153
NP_441570.1_1 Forward -136 -118 -16.6971 0.252
NP_441078.1_4 Reverse -391 -400 0.393051 0.205
NP_441078.1_4 Forward -400 -391 0.393051 0.205
NP_441078.1_4 Forward -362 -353 0.196389 0.205
NP_441078.1_4 Reverse -353 -362 -0.000272808 0.205
NP_441078.1_4 Forward -386 -377 -1.96689 0.282
NP_441078.1_4 Forward -293 -284 -2.06522 0.295
NP_440526.1_3 Forward -278 -267 5.85971 0.229
NP_440526.1_3 Reverse -285 -296 1.72983 0.267
NP_441432.1_8 Forward -363 -354 7.27622 0.101
NP_441432.1_8 Forward -143 -134 2.85133 0.281
NP_442344.1_7 Forward -361 -342 -6.58872 0.171
NP_441732.1_2 Reverse -373 -389 -15.8711 0.163
NP_440760.1_1 Reverse -284 -303 -4.42544 0.0432
NP_442797.1_7 Reverse -138 -156 -0.177514 0.282
NP_440199.1_10 Reverse -374 -384 11.6814 0.152
NP_440199.1_10 Forward -87 -77 10.6981 0.173
NP_441057.1_4 Forward -165 -147 0.707465 0.253
NP_442489.1_7 Reverse -353 -362 7.47288 0.0613
NP_442489.1_7 Forward -400 -391 0.884706 0.145
NP_442489.1_7 Reverse -391 -400 0.884706 0.145
NP_442489.1_7 Forward -362 -353 0.688044 0.152
NP_442489.1_7 Forward -293 -284 -1.57357 0.213
NP_442489.1_7 Forward -386 -377 -1.6719 0.235
NP_440559.1_1 Forward -361 -352 13.4711 0.0387
NP_440559.1_1 Forward -399 -390 6.8829 0.122
NP_441659.2_8 Forward -400 -390 6.46988 0.0744
NP_441659.2_8 Forward -362 -352 5.28991 0.112
NP_441659.2_8 Reverse -146 -156 3.02829 0.177
NP_441659.2_8 Reverse -353 -363 1.74999 0.227
NP_441659.2_8 Forward -279 -269 0.963343 0.254
NP_441022.1_1 Forward -71 -62 12.8891 0.222
NP_441022.1_1 Reverse -257 -266 10.8747 0.284
NP_442913.1_10 Forward -302 -283 0.196116 0.155
NP_442913.1_10 Reverse -344 -363 -5.40875 0.264
NP_441185.1_7 Forward -159 -140 15.2408 0.279
NP_442346.1_5 Forward -387 -377 8.1415 0.146
NP_442346.1_5 Reverse -376 -386 7.35486 0.172
NP_442346.1_5 Forward -294 -284 6.76487 0.192
NP_442346.1_5 Forward -363 -353 5.87989 0.225
NP_442346.1_5 Reverse -269 -279 4.3066 0.291
NP_440545.1_3 Reverse -349 -366 5.64371 0.0607
NP_440545.1_3 Reverse -130 -147 -1.63279 0.171
NP_440545.1_3 Forward -152 -135 -4.87771 0.235
NP_440545.1_3 Forward -297 -280 -5.1727 0.242
NP_440831.1_3 Forward -310 -291 8.32868 0.229
NP_440459.1_2 Forward -151 -134 10.9536 0.185
NP_440010.1_4 Reverse -117 -136 1.17865 0.24
NP_442603.1_7 Reverse -377 -391 10.9137 0.125
NP_441948.1_4 Reverse -212 -230 -1.94747 0.156
NP_441833.1_4 Reverse -392 -399 6.52896 0.0924
NP_441833.1_4 Reverse -354 -361 6.52896 0.0924
NP_441833.1_4 Forward -399 -392 6.43063 0.125
NP_441833.1_4 Forward -361 -354 6.23397 0.163
NP_441329.1_4 Reverse -255 -273 11.652 0.251
NP_442162.1_9 Reverse -392 -399 6.82395 0.0927
NP_442162.1_9 Forward -399 -392 6.72562 0.116
NP_442162.1_9 Forward -361 -354 6.62729 0.142
NP_442162.1_9 Reverse -354 -361 6.52896 0.178
NP_442404.1_9 Reverse -377 -391 8.3571 0.296
NP_440224.1_1 Forward -373 -354 9.53756 0.0591
NP_442546.1_6 Reverse -8 -27 16.3764 0.259
NP_442140.1_3 Forward -361 -351 4.0116 0.265
NP_440875.1_9 Reverse -355 -365 16.5483 0.0145
NP_440875.1_9 Forward -146 -136 10.8055 0.196
NP_441813.1_5 Forward -364 -354 8.4365 0.0432
NP_441813.1_5 Reverse -389 -399 5.87989 0.106
NP_441813.1_7 Reverse -244 -258 9.24208 0.259
NP_440567.1_1 Reverse -354 -368 4.81781 0.111
NP_442497.1_1 Reverse -140 -159 7.4718 0.291
NP_442497.1_10 Forward -399 -390 8.45619 0.0332
NP_442497.1_10 Reverse -354 -363 7.76787 0.0731
NP_442497.1_10 Reverse -285 -294 0.196389 0.208
NP_442497.1_10 Forward -361 -352 -1.18024 0.256
NP_440821.1_4 Reverse -389 -399 9.81313 0.0246
NP_440821.1_4 Forward -189 -179 5.09324 0.119
NP_440821.1_4 Forward -295 -285 0.0783647 0.205
NP_441239.1_9 Forward -150 -138 3.97222 0.269
NP_441727.1_3 Forward -156 -137 3.24438 0.291
NP_440624.1_5 Forward -354 -336 7.37817 0.298
NP_441892.1_1 Forward -302 -285 0.727158 0.163
NP_442669.1_1 Reverse -48 -67 22.2223 0.000502
NP_440604.1_6 Forward -166 -147 -1.57384 0.203
NP_441617.1_6 Forward -344 -325 -6.88371 0.288
NP_442041.1_5 Forward -154 -135 3.14605 0.244
NP_441230.1_5 Forward -154 -135 4.42435 0.188
NP_440462.1_6 Forward -364 -354 15.5163 0.0142
NP_442611.1_1 Forward -148 -129 -2.0655 0.284
NP_440868.1_4 Forward -366 -354 7.51213 0.0691
NP_440868.1_4 Reverse -349 -361 3.2839 0.137
NP_441474.1_1 Reverse -222 -241 5.40686 0.212
NP_442402.1_2 Forward -346 -332 14.8469 0.263
NP_442039.1_4 Forward -399 -392 13.0188 0.0371
NP_442679.1_1 Reverse -159 -178 -2.85214 0.244
NP_440825.1_6 Reverse -61 -80 11.7992 0.277
NP_442837.1_3 Forward -399 -392 12.7238 0.0481
NP_442837.1_3 Reverse -354 -361 12.1338 0.0702
NP_442837.1_3 Reverse -392 -399 6.3323 0.237
NP_442837.1_3 Forward -361 -354 6.0373 0.25
NP_442053.1_1 Reverse -391 -400 7.76787 0.0895
NP_442053.1_1 Reverse -353 -362 6.78456 0.115
NP_440505.1_3 Forward -364 -354 8.33817 0.145
NP_441203.1_1 Reverse -354 -373 -4.6221 0.0797
NP_441408.2_7 Forward -151 -132 -2.65548 0.272
NP_441408.2_7 Forward -364 -345 -3.24547 0.272
NP_440914.1_1 Forward -148 -138 9.00547 0.186
NP_440914.1_1 Forward -247 -237 6.27291 0.288
NP_441011.1_8 Reverse -354 -363 6.78456 0.184
NP_442533.1_1 Forward -244 -225 -1.7705 0.14
NP_442533.1_6 Reverse -377 -386 5.11294 0.155
NP_442533.1_6 Reverse -391 -400 4.71961 0.177
NP_442533.1_6 Forward -386 -377 3.83464 0.202
NP_442533.1_6 Reverse -134 -143 3.53964 0.21
NP_442541.1_10 Reverse -214 -228 3.04726 0.254
NP_442541.1_10 Reverse -139 -153 1.27731 0.287
NP_442541.1_10 Reverse -284 -298 0.883986 0.295
NP_439944.1_9 Forward -399 -389 5.78156 0.221
NP_439944.1_9 Forward -292 -282 4.99491 0.284
NP_441028.1_6 Reverse -76 -86 8.14104 0.217
NP_441028.1_6 Reverse -37 -47 3.51951 0.292
NP_440116.1_8 Forward -154 -135 -9.24366 0.271
NP_440115.1_6 Forward -365 -355 14.0414 0.0615
NP_440115.1_6 Forward -296 -286 8.53483 0.13
NP_440007.1_9 Forward -366 -352 6.78443 0.217
NP_440007.1_9 Forward -152 -138 1.17956 0.29
NP_439965.1_7 Reverse -234 -253 11.4877 0.294
NP_442492.1_2 Forward -362 -343 -0.590531 0.27
NP_441106.1_1 Forward -363 -354 8.75118 0.0469
NP_441286.1_1 Reverse -283 -295 3.2839 0.048
NP_441286.1_1 Reverse -352 -364 -5.17256 0.192
NP_440670.1_8 Forward -362 -353 7.47288 0.0773
NP_440670.1_8 Forward -400 -391 6.78456 0.099
NP_440670.1_8 Reverse -353 -362 5.89959 0.131
NP_440670.1_8 Reverse -391 -400 5.70292 0.14
NP_442614.1_2 Forward -247 -233 6.3911 0.291
NP_441753.1_10 Reverse -304 -323 7.96426 0.186
NP_441403.1_4 Reverse -143 -161 5.42735 0.299
NP_442264.1_2 Forward -297 -280 7.61033 0.236
NP_442264.1_2 Reverse -129 -146 5.54538 0.275
NP_441021.1_1 Reverse -378 -397 -4.81876 0.172
NP_441463.1_6 Reverse -282 -296 5.54623 0.287
NP_441626.1_2 Reverse -392 -399 12.6255 0.0468
NP_441626.1_2 Forward -399 -392 6.23397 0.172
NP_441626.1_2 Forward -361 -354 6.13563 0.177
NP_441626.1_2 Reverse -354 -361 5.93897 0.231
NP_442211.1_3 Forward -154 -135 10.9735 0.257
NP_442238.1_1 Forward -148 -129 2.0644 0.222
NP_442794.1_1 Forward -21 -9 6.03717 0.198
NP_442794.1_1 Reverse -136 -148 3.08724 0.286
NP_441401.1_1 Reverse -335 -354 9.0459 0.288
NP_441962.1_4 Forward -228 -209 -10.1286 0.224
NP_441962.1_4 Forward -298 -279 -14.7502 0.293
NP_440387.1_1 Forward -362 -346 1.04184 0.114
NP_440387.1_1 Reverse -377 -393 -4.56302 0.19
NP_440855.1_5 Reverse -236 -255 4.42355 0.285
NP_440855.1_5 Reverse -138 -157 1.86696 0.295
NP_441993.1_1 Reverse -140 -159 1.4594 0.276
NP_441174.1_4 Forward -243 -233 16.303 0.238
NP_442090.1_2 Forward -213 -194 6.15881 0.287
NP_440766.1_4 Reverse -280 -294 4.52282 0.126
NP_439988.1_3 Forward -147 -133 4.71948 0.292
NP_440422.1_10 Reverse -51 -70 8.17758 0.212
NP_441237.1_9 Reverse -285 -295 14.238 0.0429
NP_441237.1_9 Forward -361 -351 12.2714 0.127
NP_442743.1_1 Forward -347 -328 5.99684 0.268
NP_440457.1_1 Forward -297 -285 7.21714 0.105
NP_440457.1_1 Forward -366 -354 0.333971 0.25
NP_440457.1_1 Forward -152 -140 -0.846001 0.278
NP_440457.1_1 Reverse -387 -399 -1.14099 0.294
NP_440798.1_6 Forward -399 -386 1.88757 0.192
NP_441253.1_8 Reverse -348 -362 14.4365 0.128
NP_440554.1_4 Reverse -354 -364 8.33817 0.0773
NP_441885.1_5 Forward -362 -352 2.33998 0.0799
NP_442341.1_9 Reverse -137 -151 7.47213 0.198
NP_442341.1_9 Forward -364 -350 4.71887 0.294
NP_441756.1_5 Forward -233 -214 -5.11376 0.298
NP_441173.1_9 Forward -340 -332 13.1954 0.184
NP_441173.1_9 Forward -341 -333 12.9004 0.206
NP_440423.1_6 Forward -246 -227 -21.3384 0.288
NP_443000.1_7 Forward -364 -354 10.5998 0.0345
NP_443000.1_7 Reverse -176 -186 4.60159 0.179
NP_443000.1_7 Reverse -375 -385 1.94665 0.226
NP_440507.2_3 Reverse -275 -294 10.6184 0.205
NP_441561.1_4 Reverse -355 -374 12.9791 0.169
NP_440275.1_3 Forward -364 -354 6.56821 0.101
NP_440275.1_3 Reverse -389 -399 1.16001 0.294
NP_442354.1_2 Forward -255 -236 4.62101 0.299
NP_441902.1_1 Reverse -102 -121 10.2251 0.282
NP_441902.1_3 Forward -121 -111 15.3139 0.205
NP_442451.1_2 Forward -295 -276 -10.6203 0.277
NP_440175.1_4 Forward -231 -212 -11.9969 0.215
NP_442495.1_4 Forward -144 -134 13.648 0.187
NP_442495.1_4 Reverse -357 -367 12.3697 0.229
NP_441105.1_3 Forward -160 -141 -9.53865 0.29
NP_441105.1_3 Reverse -135 -154 -9.63698 0.292
NP_440216.1_1 Reverse -353 -367 -2.26202 0.0484
NP_440216.1_1 Forward -400 -386 -3.83532 0.09
NP_440172.1_1 Forward -386 -376 2.14332 0.283
NP_440172.1_1 Forward -148 -138 2.04498 0.286
NP_442015.1_10 Reverse -387 -400 3.06754 0.185
NP_442015.1_10 Reverse -349 -362 2.77255 0.187
NP_441226.1_7 Reverse -392 -399 5.25032 0.293
NP_441111.1_7 Reverse -392 -400 9.26253 0.0107
NP_441111.1_7 Reverse -354 -362 8.86921 0.0589
NP_441111.1_7 Forward -399 -391 -0.570565 0.233
NP_441766.1_2 Reverse -391 -400 6.78456 0.0896
NP_441766.1_2 Reverse -353 -362 6.48957 0.096
NP_440416.1_9 Reverse -132 -151 -6.09707 0.0854
NP_440416.1_9 Reverse -150 -169 -20.5517 0.286
NP_443052.1_8 Reverse -381 -400 -9.24366 0.187
NP_443052.1_9 Reverse -292 -311 -6.58872 0.285
NP_442116.1_6 Reverse -262 -279 6.35461 0.28
NP_442116.1_6 Reverse -339 -356 5.59067 0.293
NP_440845.1_1 Reverse -319 -338 2.0644 0.165
NP_442403.1_9 Reverse -72 -91 2.55606 0.285
NP_440261.1_5 Reverse -354 -367 6.31247 0.038
NP_440261.1_5 Forward -399 -386 -10.6988 0.203
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGCGCTCGCACTGTGGTGATGACCTTTGAACGTCTCCAGGCGATCGAAAAGTTTCAGAGTTTTACCCAAAGGTTTAACGGCCATTTACGTCTTGCTGACGAAGAGGGGGCGATGGAAATTGAACCATCGTCAGTAAAATTTATTTTTGGTGGAGACGAAGGGGATGAACTGCGGGGTGCCCAGTGCAGTTTTGACCTAGTTAAAAATGATCATTGGGAACGCTTTATCCGTTTCATGGAGCGCTATGCGGAGGCCAATGGCATGGGCTACCAAGATCGTTAGGGGAGAAAAGTTACCGGAGCTGAACCGGAATGACGGAGATCAAAGGCCAAAACTTTGCAAACAGACTCTAATCAGGGGACAATCTAGCGAAATTAAGCCTTGATTATCCCTGTTGCCT

CDS

GTGTTGCTAAATCTTCCCGCCACCGTTAAGTCTCGTTCTTGCCAAAAACTAATTGGGGGGCTGTTGCCCTTATTATTGTTTGCCTGTGGTAGCCCCAATGTCGGCAATGGTAACTCTCAGCAGAATGGTCAAGAAACCCTGAAAATTCTCTCTTGGCAGGCTCCCACGATTTTAAATCCCCATTTGGCTACGGGCTTTAAGGATGCGGAAGCTAGTCGTATTGCCCTGGAACCCCTGGCAAGTTTTGACCAAGAAGGCAACCTAGTCCCGTTTTTGGCGGCGGAAATTCCCAGCGTAGAAAATGGCGGCGTGGCGGCGGATGGTTTGTCCGTCACCTGGAAGTTAAAGCCTGATGTGCTCTGGTCTGATGGGCAACCCTTCTCGGCGGAGGATGTGGCGTTCACTTACAAATTCCTCAGTGATCCCAAAACTGGGGCCACCAGCACTGGTACCTATGAGGCGATCGCCAAGGTGGAAGCGTTGGACAAAAATACAGTCAAAATAACCTTTAAGGAACCCAACCCAGCTTGGTTTTTACCCTTTGTGGGCAGTGAAGGGATGATTTTGCCCCAGCACATTTATAAAGATTTTGTCGGGGAAAAGGCGCGGCAGGCACCGGCAAATCTGTTGCCCATCGGTACTGGGCCCTATCGGGTCACCAGTTTTAAACCAGGGGATGTGGTGTTGTATGAAGTTAATCCCCATTATCGAGACCGGAAAAATATCGGTTTCCAACAGGTGGAAATTAAGGGTGGGGGAGATGCTACCTCCGCGGCCCGGGCCGTACTGCAAACTGGGGATGCGGATTTTGCCCTCAATTTACAGGTGGAGGACAATATCCTCCAGTCCTTGGCCCAAGGCGGCAAAGGGGAAATTGTGGCAGATTTAGGCAGTTTGAGTGAACGGGTAATATTTAATCTCAGCGATCCCGATCCTGCGCGCACCAATGGCGATCGCTCCTCGGTGAAGTTTCCCCATCCCTTTTTGCAGGATCCCTTGGTGAGGAAAGCTATAACTCTAGGCATTGACCGGGATTTAATTGCCAAGCAACTCTATGGTGTCACCGGACAGCCCACGGCCAACGTTCTGGTTTTACCCCAGCAGTATGCTTCCCAAAATACGAGTTTCCAATTTAATCCCACCGAAGCCCAGCAATTACTCGACCAAGCGGGTTGGAAGGACAGCAACGGCAACGGTATTCGGGACAAGGATGGCATTGAGTTGCAAATGGTATTCCAAACCAGCGTTAATCCCCTGCGGCAAAAGACCCAACAGGTAATTAAACAAACTCTCCAGGCGATCGGCGTGGGGGTAGAACTGAAAAGCATTGACCCCAGTGTGTTCTTTTCCGGTGATCCGGCCAACCCCGATACTTTGGAACGATTTCAGGGGGATTTGTCTATGTTCACCACGGGCAACACTAACCCGGATCCGAGCAAATATATGCAAACCTTCACCTGTGGGGCCATTCCCACCGCCGAGAATCAATGGAGTGGGGACAATTATGGGCGTTACTGTAGTGCCGAATACGACCAACTCTGGCAAAAAGCAGTGGCTGAACTGGACCCGGAAAAGCGCCAACAACTATTCATTCAAATGAACGATTTGTTAGTGGATGATTATATTTTGGTACCCGTGGTGCATCGAGCCAGTGTGGTGGGAGTAGGCGATCGCCTGGATGGGGTGGCGTTAACTCCCTGGGATCGTCCCACTTGGAATATCAAAGATTGGCAGCCGAAAGCAAAATAG

Protein

MLLNLPATVKSRSCQKLIGGLLPLLLFACGSPNVGNGNSQQNGQETLKILSWQAPTILNPHLATGFKDAEASRIALEPLASFDQEGNLVPFLAAEIPSVENGGVAADGLSVTWKLKPDVLWSDGQPFSAEDVAFTYKFLSDPKTGATSTGTYEAIAKVEALDKNTVKITFKEPNPAWFLPFVGSEGMILPQHIYKDFVGEKARQAPANLLPIGTGPYRVTSFKPGDVVLYEVNPHYRDRKNIGFQQVEIKGGGDATSAARAVLQTGDADFALNLQVEDNILQSLAQGGKGEIVADLGSLSERVIFNLSDPDPARTNGDRSSVKFPHPFLQDPLVRKAITLGIDRDLIAKQLYGVTGQPTANVLVLPQQYASQNTSFQFNPTEAQQLLDQAGWKDSNGNGIRDKDGIELQMVFQTSVNPLRQKTQQVIKQTLQAIGVGVELKSIDPSVFFSGDPANPDTLERFQGDLSMFTTGNTNPDPSKYMQTFTCGAIPTAENQWSGDNYGRYCSAEYDQLWQKAVAELDPEKRQQLFIQMNDLLVDDYILVPVVHRASVVGVGDRLDGVALTPWDRPTWNIKDWQPKAK