Your browser is old and dusty. Try Google Chrome!

Details for slr1738

ORF slr1738
Accession NP_441097.1
Symbol
Category transcription regulator Fur family
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_1 Reverse -177 -196 7.68668 0.275
NP_442657.1_1 Forward -193 -176 9.50584 0.289
NP_440815.1_4 Forward -200 -182 19.1941 0.11
NP_442291.1_7 Reverse -78 -92 12.6843 0.211
NP_441343.1_7 Reverse -98 -117 11.3075 0.113
NP_442272.1_2 Reverse -178 -197 13.7982 0.197
NP_442272.1_2 Reverse -272 -291 10.074 0.263
NP_442272.1_2 Reverse -179 -198 9.31004 0.29
NP_440150.1_2 Reverse -77 -96 5.99684 0.261
NP_442655.1_1 Forward -335 -316 -1.57384 0.278
NP_442752.1_4 Forward -272 -265 12.1338 0.0546
NP_443027.1_4 Forward -274 -264 5.87989 0.294
NP_440784.1_7 Reverse -89 -96 6.43063 0.218
NP_442405.1_3 Forward -133 -121 18.1313 0.252
NP_441054.1_1 Reverse -81 -95 15.9292 0.21
NP_442062.1_3 Forward -218 -199 4.03102 0.198
NP_442062.1_3 Forward -156 -137 3.93269 0.198
NP_442276.1_2 Forward -96 -77 11.8975 0.273
NP_440330.1_2 Forward -368 -349 8.94757 0.297
NP_441149.1_9 Forward -248 -229 0.588665 0.231
NP_441434.1_1 Reverse -183 -197 7.93745 0.26
NP_441738.1_2 Reverse -379 -386 6.52862 0.261
NP_441738.1_2 Reverse -29 -36 6.52862 0.261
NP_442889.1_1 Forward -77 -58 2.3594 0.145
NP_442889.1_1 Forward -97 -78 -11.9969 0.218
NP_442889.1_8 Forward -135 -121 5.1122 0.239
NP_442889.1_8 Forward -224 -210 4.42388 0.267
NP_442570.1_3 Forward -73 -54 -5.70374 0.248
NP_439953.1_4 Forward -157 -138 16.0274 0.205
NP_441327.1_1 Reverse -170 -189 6.42389 0.25
NP_440747.1_10 Reverse -85 -97 -12.1541 0.227
NP_440747.1_10 Forward -74 -62 -12.2524 0.254
NP_441854.1_10 Forward -99 -80 9.63589 0.139
NP_442330.1_4 Reverse -19 -38 14.263 0.286
NP_441014.1_5 Reverse -57 -75 11.6222 0.258
NP_442848.1_1 Forward -392 -378 -4.62196 0.298
NP_441012.1_4 Forward -393 -380 7.88576 0.272
NP_441634.1_8 Forward -102 -88 -3.83532 0.295
NP_440376.1_1 Forward -71 -62 1.86802 0.238
NP_442687.1_7 Reverse -61 -71 4.69992 0.238
NP_442687.1_7 Forward -317 -307 3.91327 0.278
NP_441077.1_2 Forward -213 -194 2.91208 0.254
NP_441077.1_6 Reverse -182 -198 16.106 0.0934
NP_441013.1_2 Reverse -376 -394 -2.24246 0.282
NP_442496.1_5 Forward -385 -367 17.1287 0.111
NP_440184.1_5 Forward -396 -377 9.93088 0.178
NP_440203.1_6 Reverse -175 -194 15.899 0.214
NP_442816.1_7 Forward -187 -168 7.20922 0.238
NP_439905.1_1 Reverse -83 -96 12.5073 0.194
NP_441162.1_3 Forward -396 -377 10.0292 0.22
NP_441097.1_1 Forward -230 -211 27.1388 0.0015
NP_441097.1_2 Forward -394 -377 28.3582 0.00014
NP_441097.1_3 Forward -366 -347 29.9904 0.000103
NP_441097.1_6 Forward -208 -191 23.6488 0.00534
NP_441097.1_7 Forward -77 -62 22.3994 0.0581
NP_442690.1_1 Forward -212 -193 -14.3569 0.272
NP_442690.1_1 Forward -192 -173 -14.6519 0.273
NP_442690.1_1 Forward -194 -175 -15.1435 0.278
NP_442911.1_2 Reverse -281 -300 -8.85033 0.244
NP_440153.1_5 Reverse -338 -352 5.80112 0.191
NP_440153.1_8 Reverse -307 -320 1.78924 0.22
NP_443055.1_6 Reverse -255 -273 2.47668 0.209
NP_440934.1_4 Forward -108 -89 7.17762 0.267
NP_442002.1_9 Reverse -61 -68 12.2322 0.185
NP_440377.1_1 Forward -43 -26 14.6559 0.19
NP_442996.1_1 Forward -199 -180 8.06865 0.21
NP_439966.1_7 Reverse -375 -385 8.14104 0.14
NP_441514.1_6 Reverse -240 -247 12.7238 0.29
NP_441079.1_7 Reverse -180 -199 10.4217 0.091
NP_441079.1_7 Forward -201 -182 -3.44288 0.236
NP_441079.1_7 Forward -198 -179 -7.08111 0.286
NP_442049.1_6 Forward -394 -375 3.44104 0.272
NP_443049.1_6 Forward -273 -263 14.1783 0.131
NP_442215.1_2 Forward -93 -77 -2.20308 0.193
NP_442215.1_2 Forward -345 -329 -2.69473 0.202
NP_440780.1_1 Forward -209 -190 9.40553 0.274
NP_442933.1_1 Forward -193 -174 11.1244 0.249
NP_442933.1_1 Forward -184 -165 6.34979 0.27
NP_442933.1_6 Reverse -192 -211 13.1297 0.287
NP_441751.2_8 Forward -96 -82 -6.98191 0.294
NP_442075.1_3 Forward -117 -98 17.0107 0.232
NP_442970.1_3 Forward -189 -171 11.4544 0.29
NP_443009.1_2 Forward -82 -63 -4.32711 0.248
NP_440881.1_4 Reverse -49 -68 8.45592 0.226
NP_440835.1_1 Reverse -66 -85 -8.35868 0.186
NP_441020.2_6 Forward -274 -257 7.02034 0.245
NP_441015.1_10 Reverse -286 -305 -5.99873 0.239
NP_441015.1_10 Forward -96 -77 -9.93197 0.282
NP_441731.1_1 Reverse -146 -164 16.6176 0.258
NP_441731.1_3 Reverse -80 -99 -6.1954 0.29
NP_441096.1_1 Reverse -215 -234 23.4535 0.0213
NP_441096.1_3 Reverse -194 -213 20.053 0.13
NP_442868.1_6 Reverse -375 -385 1.16001 0.205
NP_442719.1_2 Forward -250 -232 -10.5029 0.276
NP_441911.1_7 Forward -192 -173 -10.7193 0.218
NP_442808.1_1 Reverse -262 -272 2.73286 0.256
NP_442050.1_5 Reverse -321 -331 7.55106 0.251
NP_442050.1_5 Reverse -375 -385 7.0594 0.27
NP_442342.1_9 Reverse -261 -277 10.1866 0.137
NP_440601.1_10 Reverse -149 -168 13.6675 0.29
NP_440385.1_8 Forward -191 -172 13.1297 0.2
NP_440558.1_2 Reverse -304 -323 -3.73712 0.238
NP_440111.2_2 Forward -397 -378 -4.32711 0.291
NP_441878.1_6 Reverse -81 -91 9.7148 0.0237
NP_441878.1_6 Forward -98 -88 0.865012 0.132
NP_440084.1_8 Forward -197 -183 11.1842 0.251
NP_440084.1_8 Forward -198 -184 9.84729 0.271
NP_441914.1_5 Forward -361 -342 9.3409 0.298
NP_440101.1_10 Reverse -301 -320 1.76941 0.28
NP_441458.1_8 Forward -200 -181 21.8024 0.0189
NP_441458.1_10 Forward -309 -290 6.58763 0.197
NP_441819.1_5 Reverse -169 -188 9.59652 0.262
NP_441819.1_5 Forward -193 -174 9.31004 0.27
NP_442632.1_1 Reverse -265 -284 11.405 0.254
NP_442347.1_2 Reverse -372 -381 4.0313 0.284
NP_442888.1_6 Reverse -64 -83 1.27776 0.295
NP_442998.1_5 Forward -372 -362 10.0098 0.231
NP_442998.1_10 Forward -130 -123 10.4622 0.0819
NP_442998.1_10 Reverse -293 -300 9.28223 0.117
NP_440299.1_1 Reverse -119 -132 2.96866 0.265
NP_441799.1_9 Forward -26 -7 -2.45882 0.213
NP_441559.1_8 Forward -76 -62 -7.2769 0.289
NP_442860.1_7 Reverse -171 -189 7.54704 0.283
NP_440915.1_6 Forward -276 -262 7.07942 0.0757
NP_442158.1_4 Forward -282 -272 10.8948 0.283
NP_441464.1_8 Reverse -88 -102 7.47274 0.206
NP_440026.1_8 Forward -102 -84 17.0304 0.147
NP_440695.1_6 Forward -151 -137 13.3201 0.24
NP_442993.1_1 Forward -356 -340 -13.0195 0.283
NP_442386.1_9 Reverse -376 -385 5.50585 0.25
NP_442327.1_3 Reverse -179 -198 4.63094 0.283
NP_443028.1_4 Forward -209 -190 15.7475 0.252
NP_440251.1_4 Reverse -40 -57 17.8367 0.0992
NP_440251.1_6 Forward -196 -178 19.0031 0.0957
NP_442240.1_6 Reverse -337 -356 14.5524 0.236
NP_440586.1_8 Reverse -318 -325 7.31526 0.265
NP_440586.1_8 Forward -49 -42 7.02027 0.279
NP_440027.1_3 Reverse -307 -325 8.27817 0.195
NP_439937.1_9 Reverse -262 -279 -9.20492 0.183
NP_439977.1_7 Reverse -252 -271 14.6499 0.262
NP_440163.1_10 Forward -359 -349 7.94484 0.297
NP_442917.1_1 Reverse -175 -194 10.0284 0.181
NP_441060.1_4 Reverse -267 -285 2.67408 0.252
NP_441965.1_10 Forward -100 -84 6.25339 0.183
NP_442065.1_7 Reverse -308 -326 1.10079 0.251
NP_442280.1_10 Forward -74 -56 5.35702 0.287
NP_441592.1_4 Reverse -82 -101 2.94938 0.186
NP_440888.1_2 Reverse -263 -277 5.01387 0.298
NP_440491.1_1 Forward -316 -297 9.4509 0.214
NP_442277.1_7 Reverse -168 -184 7.83714 0.196
NP_442277.1_7 Reverse -179 -195 -1.1391 0.266
NP_441123.1_6 Reverse -367 -385 12.1139 0.147
NP_441949.1_5 Forward -148 -129 16.0787 0.115
NP_440089.1_1 Forward -72 -54 11.1305 0.3
NP_442710.1_7 Reverse -181 -200 -0.0145083 0.197
NP_442710.1_7 Forward -198 -179 -2.22503 0.233
NP_442710.1_7 Reverse -179 -198 -5.10833 0.279
NP_443064.1_6 Forward -57 -47 8.97947 0.254
NP_440148.1_6 Forward -116 -102 15.2817 0.3
NP_440911.1_3 Reverse -2 -16 19.6651 0.205
NP_442780.1_3 Forward -194 -175 9.7875 0.226
NP_441032.1_2 Reverse -15 -34 10.6192 0.179
NP_441443.1_7 Forward -87 -68 -2.55715 0.27
NP_441052.1_2 Reverse -82 -92 1.94665 0.221
NP_441052.1_2 Forward -362 -352 -0.806614 0.299
NP_441669.1_2 Reverse -28 -42 16.6169 0.279
NP_439949.1_7 Forward -268 -254 11.6026 0.284
NP_441115.1_2 Forward -396 -377 9.93006 0.243
NP_442694.1_9 Reverse -225 -244 10.4225 0.24
NP_441555.1_2 Reverse -218 -237 10.8379 0.299
NP_442515.1_1 Reverse -87 -101 4.91614 0.107
NP_440593.1_3 Reverse -302 -321 -2.75381 0.228
NP_440338.1_4 Forward -198 -179 11.7983 0.15
NP_442689.1_8 Forward -188 -171 1.12048 0.191
NP_442024.1_9 Reverse -29 -42 17.5222 0.18
NP_442843.1_1 Forward -394 -375 -9.34199 0.265
NP_442450.1_5 Reverse -261 -271 10.8948 0.115
NP_440588.1_2 Reverse -79 -98 -5.21209 0.243
NP_442243.1_1 Reverse -347 -365 -1.45654 0.279
NP_441078.1_4 Forward -132 -123 5.80125 0.104
NP_441078.1_4 Reverse -123 -132 5.70292 0.111
NP_441094.1_7 Reverse -54 -73 17.9024 0.126
NP_442353.1_4 Reverse -295 -314 0.686995 0.267
NP_440913.1_1 Forward -274 -256 3.3624 0.299
NP_442913.1_10 Reverse -73 -92 4.12936 0.0936
NP_442346.1_5 Forward -317 -307 9.7148 0.118
NP_440025.1_3 Reverse -120 -134 10.7076 0.29
NP_440010.1_4 Reverse -297 -316 1.27698 0.24
NP_442551.1_4 Forward -93 -78 2.43817 0.245
NP_442900.1_1 Forward -103 -84 -6.98204 0.251
NP_442828.1_2 Reverse -180 -199 13.9891 0.242
NP_441329.1_1 Forward -211 -192 6.06331 0.265
NP_441329.1_6 Reverse -170 -189 7.30471 0.179
NP_440772.1_10 Reverse -171 -190 11.2603 0.273
NP_442045.1_5 Reverse -3 -22 -2.55715 0.294
NP_442140.1_3 Forward -83 -73 6.17489 0.184
NP_442028.1_1 Forward -195 -182 9.32449 0.251
NP_442028.1_1 Forward -194 -181 7.70113 0.289
NP_442028.1_1 Forward -191 -178 7.70113 0.289
NP_441239.1_9 Forward -99 -87 3.38223 0.285
NP_441951.1_4 Reverse -69 -88 0.491109 0.297
NP_441951.1_4 Forward -90 -71 0.392778 0.297
NP_441892.1_4 Forward -92 -73 1.17943 0.266
NP_441017.1_8 Forward -60 -45 6.86307 0.287
NP_440212.1_9 Forward -199 -180 7.48109 0.158
NP_440212.1_9 Forward -200 -181 3.73283 0.214
NP_440212.1_9 Reverse -181 -200 1.71454 0.262
NP_440949.1_7 Reverse -89 -108 11.11 0.233
NP_440546.1_4 Forward -84 -74 8.39772 0.192
NP_440546.1_6 Reverse -17 -36 20.2556 0.0493
NP_440462.1_6 Forward -274 -264 4.69992 0.187
NP_440868.1_4 Forward -330 -318 3.38223 0.136
NP_441848.1_4 Reverse -173 -189 16.1449 0.151
NP_441848.1_4 Reverse -247 -263 7.64616 0.288
NP_440696.1_3 Forward -316 -298 -1.75081 0.265
NP_440696.1_6 Forward -96 -77 4.62101 0.285
NP_442679.1_1 Reverse -165 -184 -2.36049 0.24
NP_442679.1_1 Reverse -156 -175 -3.83545 0.264
NP_442894.1_2 Forward -232 -213 11.8975 0.154
NP_442360.1_5 Reverse -56 -66 14.4347 0.228
NP_440914.1_7 Forward -187 -168 6.15881 0.288
NP_442533.1_6 Forward -91 -82 11.3078 0.0442
NP_442533.1_6 Reverse -88 -97 2.94966 0.232
NP_442541.1_10 Reverse -82 -96 4.8172 0.248
NP_442232.1_5 Forward -114 -95 16.4207 0.133
NP_440854.1_1 Reverse -174 -193 18.5728 0.0256
NP_440854.1_5 Reverse -180 -194 15.5768 0.274
NP_442203.1_1 Reverse -179 -193 17.5821 0.15
NP_442269.1_10 Forward -318 -299 5.211 0.238
NP_441697.1_5 Forward -200 -181 2.05265 0.178
NP_441697.1_5 Reverse -180 -199 -2.24448 0.207
NP_441697.1_5 Forward -199 -180 -10.5523 0.28
NP_441697.1_5 Forward -198 -179 -10.7433 0.284
NP_440816.1_2 Reverse -178 -197 5.56364 0.297
NP_441527.1_4 Reverse -170 -189 -4.82277 0.189
NP_441527.1_4 Forward -213 -194 -12.5576 0.291
NP_441527.1_4 Reverse -166 -185 -12.9396 0.296
NP_441527.1_5 Reverse -60 -79 13.765 0.287
NP_440007.1_9 Reverse -383 -397 2.5562 0.277
NP_442588.1_1 Forward -328 -309 5.211 0.296
NP_441001.1_10 Forward -107 -88 6.68596 0.249
NP_440799.1_10 Forward -217 -198 11.0125 0.267
NP_440634.1_10 Reverse -97 -116 4.42355 0.3
NP_440358.1_8 Forward -117 -98 5.01433 0.2
NP_440082.1_5 Forward -187 -168 16.852 0.256
NP_441425.1_2 Forward -199 -180 14.6558 0.237
NP_441421.1_6 Reverse -179 -196 11.0337 0.279
NP_440457.1_1 Forward -276 -264 0.0389777 0.25
NP_441332.1_6 Reverse -262 -272 11.7436 0.252
NP_441159.1_1 Reverse -124 -143 -3.73712 0.286
NP_441159.1_8 Forward -188 -169 2.16195 0.236
NP_441885.1_5 Forward -132 -122 0.176696 0.177
NP_440478.1_9 Reverse -85 -104 8.65258 0.268
NP_442451.1_2 Reverse -247 -266 -9.63698 0.259
NP_441635.1_1 Forward -199 -180 15.135 0.172
NP_441122.1_1 Reverse -119 -134 4.30646 0.28
NP_441207.1_7 Reverse -170 -184 9.64265 0.275
NP_440175.1_4 Forward -99 -80 -11.3086 0.186
NP_442015.1_3 Reverse -261 -280 9.53674 0.296
NP_441226.1_7 Forward -395 -388 6.52862 0.253
NP_442564.1_9 Forward -316 -302 14.5086 0.227
NP_440988.1_10 Reverse -375 -389 8.4809 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCTTCCCAACGGTAGGGATTGGGACCAGGTACAGATTCGTCACGGACACGGGTTTTGAACACTACACTGGGAACTCGTTCGGGGGTCATGGTTACCTCTGGCTATCTAAACGACTAAATTTTTCTGAGGGGATGGAGCATTTTTCATCAATGCTTGCCCTCTTTTCTCAGAATAGTTCTGAGATAGAAATAAGTCAAGCTTAAAAATTAATATTTTTTTTATAATTATTCTATCTAATAGTCCTTCTAGAAAATGTTAAGCTAGATAGACTATAGCCAAACAGTGCGGATCATTATCATTGGTGTGCTGGCCAGGACCCATGGTTCCTGAGGTTTGCCCAGAGGGACTTACCCATCAAAAATCAGCGAATGTTGCCGCACCGATGTTAGGAGGAACAGT

CDS

ATGCCCTTAAACAGAGAAGAAATTATTCAAACGCTGAAGGAGCGGGGGCTGCGGGTTACTCCCCAGCGCTATGGGGTCTATGCCAATCTACTCCAACGTCGGGATCATCCCAGCGCAGAACAGTTATTGTTTGACCTTAATCAAGCTGCCCCCACGTCTTCCCAGGCCACGGTGTACAGTTCCCTCAAGGCTTTGCAATCTGTGGGATTAATCCGGGAAGTTCTATTGGAAGAAGGGGTCTGTCGCTACGATGCCAATGTGGAGCCCCACCATCATTTTTGTTGTCGTCATTGCGGGGCGATAGAGGATGTGGATTGGGAGGAGTTACCAGCGGTGGACCTAGGCAAACTCAGGGTGGGACTCAAGGCGGAACGTTATGAAATTACCGTCCATGGGGTCTGTGAAAACTGCGGCGATTAG

Protein

MPLNREEIIQTLKERGLRVTPQRYGVYANLLQRRDHPSAEQLLFDLNQAAPTSSQATVYSSLKALQSVGLIREVLLEEGVCRYDANVEPHHHFCCRHCGAIEDVDWEELPAVDLGKLRVGLKAERYEITVHGVCENCGD