Your browser is old and dusty. Try Google Chrome!

Details for slr1724

ORF slr1724
Accession NP_441235.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -113 -99 -1.67204 0.269
NP_440795.1_7 Forward -218 -211 14.6904 0.0123
NP_440795.1_7 Reverse -211 -218 14.6904 0.0123
NP_440795.1_7 Reverse -316 -323 10.6589 0.143
NP_441418.1_6 Forward -219 -200 -3.14714 0.0222
NP_441418.1_6 Reverse -210 -229 -30.6798 0.291
NP_442291.1_5 Reverse -209 -225 6.54838 0.0694
NP_442291.1_5 Forward -220 -204 -2.98973 0.232
NP_441453.1_4 Reverse -210 -218 16.539 0.00633
NP_441453.1_4 Forward -219 -211 16.539 0.00633
NP_441453.1_4 Reverse -104 -112 4.24765 0.259
NP_441453.1_7 Reverse -180 -187 12.1338 0.295
NP_442151.1_6 Forward -219 -205 5.89945 0.256
NP_441818.1_1 Reverse -105 -116 9.59626 0.232
NP_441818.1_1 Reverse -211 -222 8.90795 0.271
NP_440226.1_1 Forward -219 -200 10.0292 0.0665
NP_440226.1_1 Reverse -210 -229 9.3409 0.0734
NP_440931.1_7 Reverse -250 -268 11.6214 0.258
NP_442173.1_1 Forward -218 -210 15.4574 0.00633
NP_442173.1_1 Reverse -211 -219 15.4574 0.00633
NP_442752.1_4 Forward -219 -212 13.8055 0.0199
NP_442752.1_4 Reverse -210 -217 13.8055 0.0199
NP_443027.1_4 Forward -221 -211 11.8781 0.0872
NP_441812.1_3 Forward -103 -89 7.9644 0.254
NP_441225.1_5 Reverse -183 -202 8.16093 0.282
NP_440784.1_7 Forward -218 -211 15.9687 0.0123
NP_440784.1_7 Reverse -211 -218 15.9687 0.0123
NP_442909.1_7 Forward -218 -204 6.68548 0.242
NP_442289.1_4 Forward -227 -211 13.5299 0.203
NP_440061.1_9 Forward -221 -207 11.7987 0.105
NP_440061.1_9 Reverse -208 -222 5.30886 0.29
NP_441054.1_4 Forward -123 -105 6.50899 0.109
NP_442062.1_8 Reverse -210 -220 19.4496 0.000558
NP_442062.1_8 Forward -219 -209 17.6796 0.00193
NP_442062.1_8 Reverse -104 -114 9.91146 0.0554
NP_442062.1_8 Forward -260 -250 7.05986 0.11
NP_441859.1_3 Forward -220 -201 4.03023 0.228
NP_441859.1_3 Forward -167 -148 2.85027 0.254
NP_441802.1_1 Reverse -194 -213 10.7175 0.197
NP_440304.1_4 Reverse -208 -218 9.91146 0.051
NP_440304.1_4 Forward -115 -105 6.96153 0.137
NP_440304.1_4 Reverse -311 -321 3.22496 0.299
NP_440304.1_4 Forward -221 -211 1.84832 0.299
NP_442242.1_4 Forward -218 -211 14.3954 0.0124
NP_442242.1_4 Reverse -211 -218 14.3954 0.0124
NP_439918.1_2 Reverse -136 -155 -3.14714 0.251
NP_439923.1_5 Reverse -153 -172 9.24257 0.173
NP_441935.1_1 Reverse -211 -230 15.6341 0.126
NP_441208.1_9 Reverse -207 -221 15.3392 0.0867
NP_441594.1_6 Forward -366 -347 -0.197208 0.298
NP_440370.1_10 Reverse -201 -220 8.45592 0.241
NP_441083.1_5 Forward -219 -209 19.3512 0.000718
NP_441083.1_5 Reverse -210 -220 11.3864 0.0159
NP_441434.1_7 Reverse -212 -226 5.1128 0.225
NP_441738.1_2 Forward -217 -210 15.28 0.0102
NP_441738.1_2 Reverse -212 -219 15.28 0.0102
NP_441738.1_2 Reverse -253 -260 6.52862 0.261
NP_441738.1_2 Forward -160 -153 6.52862 0.261
NP_441558.1_5 Forward -221 -202 4.03102 0.293
NP_440209.1_1 Reverse -210 -218 18.1123 0.00295
NP_440209.1_1 Forward -219 -211 18.1123 0.00295
NP_442889.1_8 Forward -222 -208 5.40719 0.227
NP_440447.1_1 Forward -265 -247 9.65558 0.194
NP_441713.1_1 Reverse -147 -166 -0.0988766 0.0912
NP_441713.1_1 Reverse -204 -223 -11.4069 0.226
NP_440178.1_7 Reverse -209 -228 -1.7705 0.0315
NP_442570.1_3 Forward -237 -218 -6.09707 0.255
NP_441716.1_1 Forward -219 -205 6.09611 0.207
NP_441716.1_1 Reverse -210 -224 4.62115 0.254
NP_442111.1_4 Reverse -209 -223 15.4376 0.022
NP_442111.1_4 Forward -220 -206 1.67122 0.296
NP_441624.1_7 Reverse -307 -321 6.78443 0.275
NP_440906.1_5 Forward -218 -211 15.8704 0.0124
NP_440906.1_5 Reverse -211 -218 15.8704 0.0124
NP_440747.1_10 Reverse -207 -219 15.2803 0.0019
NP_440747.1_10 Forward -222 -210 7.31547 0.00577
NP_441130.1_10 Reverse -208 -222 9.73436 0.12
NP_441486.1_1 Forward -222 -208 14.3559 0.00654
NP_441486.1_1 Reverse -207 -221 -4.32697 0.194
NP_441880.2_10 Reverse -211 -229 20.8653 0.0368
NP_442634.1_4 Forward -221 -207 -1.37704 0.149
NP_442634.1_4 Forward -115 -101 -4.03198 0.179
NP_440403.1_4 Forward -228 -209 -6.88371 0.236
NP_442848.1_1 Forward -225 -211 -2.45868 0.263
NP_441012.1_4 Reverse -356 -369 13.3923 0.217
NP_441012.1_4 Reverse -341 -354 6.31247 0.282
NP_443018.1_3 Forward -218 -211 14.8871 0.0123
NP_443018.1_3 Reverse -211 -218 14.8871 0.0123
NP_443018.1_3 Reverse -105 -112 10.7572 0.0907
NP_443018.1_3 Forward -112 -105 4.56234 0.241
NP_441634.1_8 Forward -27 -13 1.17956 0.205
NP_441634.1_8 Reverse -208 -222 -3.54032 0.295
NP_440376.1_1 Forward -219 -210 19.4693 0.000692
NP_440376.1_1 Reverse -210 -219 19.4693 0.000692
NP_440376.1_1 Forward -229 -220 1.67135 0.243
NP_442687.1_7 Reverse -209 -219 18.5646 0.0028
NP_442687.1_7 Forward -220 -210 15.8113 0.0125
NP_442191.1_4 Reverse -211 -225 11.9627 0.233
NP_442958.1_3 Forward -230 -211 -0.39387 0.267
NP_441422.1_7 Forward -221 -204 -1.23946 0.183
NP_440533.1_6 Reverse -245 -264 7.47261 0.297
NP_440667.1_2 Forward -321 -302 -5.21209 0.254
NP_440667.1_2 Reverse -148 -167 -6.88371 0.273
NP_441950.1_7 Reverse -148 -167 2.26107 0.175
NP_441950.1_7 Reverse -136 -155 -7.08038 0.278
NP_440360.1_10 Forward -142 -128 5.80112 0.227
NP_442658.1_1 Forward -221 -211 17.0891 0.00615
NP_442658.1_1 Reverse -208 -218 14.8275 0.0188
NP_441855.2_4 Reverse -267 -286 10.0051 0.267
NP_442782.1_2 Forward -113 -99 10.9143 0.173
NP_442782.1_2 Reverse -210 -224 0.196253 0.293
NP_441414.1_9 Reverse -210 -229 4.03102 0.0557
NP_441487.1_9 Reverse -209 -228 13.0775 0.0526
NP_441487.1_9 Reverse -356 -375 6.09597 0.131
NP_442937.1_5 Reverse -143 -162 6.29264 0.282
NP_441958.1_5 Reverse -209 -219 20.5312 0.000966
NP_441958.1_5 Forward -220 -210 12.2714 0.00183
NP_440203.1_5 Reverse -253 -263 11.4843 0.19
NP_440203.1_5 Forward -160 -150 9.22267 0.268
NP_439905.1_1 Reverse -211 -224 12.9006 0.178
NP_440984.1_7 Forward -224 -210 12.291 0.122
NP_440984.1_7 Reverse -205 -219 5.30946 0.259
NP_442911.1_2 Forward -229 -210 5.80098 0.0315
NP_442911.1_2 Reverse -200 -219 -3.14714 0.109
NP_440153.1_5 Reverse -211 -225 22.4191 0.0128
NP_443055.1_6 Reverse -202 -220 -1.06322 0.271
NP_440993.1_4 Reverse -220 -237 5.15205 0.263
NP_440827.1_5 Reverse -137 -156 18.3873 0.297
NP_440602.1_2 Forward -224 -205 1.67108 0.263
NP_441099.1_5 Reverse -200 -219 -7.57203 0.177
NP_442002.1_9 Reverse -209 -216 14.1004 0.074
NP_442002.1_9 Forward -285 -278 11.1505 0.185
NP_442002.1_9 Forward -220 -213 10.7572 0.185
NP_441294.1_7 Forward -223 -209 17.0257 0.0103
NP_440411.1_4 Forward -357 -338 8.45592 0.211
NP_441646.1_1 Reverse -203 -222 -0.590531 0.269
NP_442438.1_10 Forward -224 -210 13.3726 0.0352
NP_442431.1_10 Reverse -142 -160 -0.964162 0.298
NP_441000.1_6 Reverse -209 -223 23.6974 0.0119
NP_441000.1_6 Forward -220 -206 -5.31028 0.273
NP_440147.1_4 Reverse -208 -221 19.5871 0.00276
NP_440147.1_4 Forward -221 -208 10.344 0.0355
NP_441550.1_8 Reverse -208 -218 17.6791 0.00754
NP_441550.1_8 Forward -221 -211 8.82935 0.112
NP_441916.1_7 Reverse -210 -220 18.4663 0.00144
NP_441916.1_7 Forward -219 -209 16.893 0.00407
NP_441916.1_7 Forward -113 -103 4.40493 0.178
NP_441916.1_7 Reverse -214 -224 2.14332 0.263
NP_441041.1_4 Forward -219 -200 -10.522 0.233
NP_441041.1_4 Forward -119 -100 -11.8003 0.252
NP_441041.1_7 Reverse -207 -219 18.01 0.00663
NP_441041.1_7 Forward -222 -210 8.58373 0.133
NP_441725.1_5 Forward -218 -208 11.7798 0.0247
NP_441725.1_5 Reverse -105 -115 7.15819 0.103
NP_441725.1_5 Reverse -211 -221 2.04498 0.115
NP_439966.1_7 Forward -221 -211 17.9741 0.00631
NP_439966.1_9 Reverse -151 -160 3.83464 0.253
NP_439966.1_9 Forward -221 -212 0.884706 0.253
NP_440202.1_8 Forward -227 -208 17.2956 0.192
NP_442941.1_3 Reverse -211 -221 10.7964 0.0116
NP_442941.1_3 Forward -218 -208 2.53664 0.14
NP_442941.1_3 Reverse -105 -115 0.275027 0.222
NP_440289.1_2 Forward -222 -209 14.0806 0.012
NP_440289.1_2 Reverse -207 -220 -2.34066 0.254
NP_440260.1_8 Reverse -138 -156 -6.96235 0.295
NP_441514.1_1 Reverse -2 -12 14.1541 0.28
NP_442281.1_1 Reverse -205 -219 22.1234 0.00192
NP_442281.1_1 Forward -224 -210 2.75226 0.257
NP_442281.1_1 Reverse -99 -113 2.35894 0.269
NP_442256.1_2 Forward -221 -203 -7.94566 0.216
NP_001035871.2_7 Forward -262 -252 13.2547 0.219
NP_440437.1_1 Forward -225 -206 -3.54046 0.239
NP_442012.1_1 Forward -225 -206 6.88262 0.118
NP_441087.1_6 Reverse -267 -285 5.72158 0.258
NP_441457.1_7 Reverse -208 -227 0.0977854 0.288
NP_441556.1_10 Reverse -215 -229 15.0887 0.154
NP_440498.1_1 Forward -228 -210 -3.02911 0.255
NP_440375.1_8 Reverse -211 -230 5.99764 0.168
NP_443030.1_4 Forward -120 -101 -1.57384 0.231
NP_441644.1_6 Forward -219 -209 15.7125 0.0048
NP_441644.1_6 Reverse -210 -220 10.1076 0.0628
NP_441644.1_6 Reverse -104 -114 9.321 0.0799
NP_440867.1_10 Reverse -357 -376 9.73422 0.25
NP_442215.1_2 Forward -221 -205 -0.728113 0.171
NP_442215.1_2 Reverse -247 -263 -6.7263 0.278
NP_442029.1_6 Reverse -205 -224 3.14605 0.283
NP_440929.1_8 Forward -219 -210 19.2726 0.000701
NP_440929.1_8 Reverse -210 -219 19.2726 0.000701
NP_442933.1_10 Forward -219 -210 17.601 0.00325
NP_442933.1_10 Reverse -210 -219 17.601 0.00325
NP_442933.1_10 Forward -113 -104 4.52295 0.24
NP_441751.2_8 Forward -218 -204 -1.77037 0.13
NP_442554.1_8 Forward -218 -208 14.238 0.0144
NP_442554.1_8 Reverse -211 -221 14.1397 0.0144
NP_442554.1_8 Reverse -105 -115 5.5849 0.145
NP_441762.1_7 Reverse -209 -221 11.5437 0.0142
NP_441762.1_7 Forward -220 -208 9.47875 0.0142
NP_442142.1_4 Reverse -207 -220 14.4733 0.0311
NP_442142.1_4 Reverse -101 -114 2.28034 0.295
NP_442292.1_1 Reverse -211 -220 9.63616 0.0183
NP_442292.1_1 Forward -218 -209 9.53783 0.0183
NP_442292.1_1 Reverse -105 -114 5.70292 0.135
NP_442476.1_6 Reverse -211 -225 19.1741 0.0268
NP_442381.1_8 Forward -222 -203 -6.49039 0.16
NP_443009.1_5 Reverse -209 -220 20.6093 0.001
NP_443009.1_5 Forward -220 -209 9.10461 0.0965
NP_443009.1_5 Forward -163 -152 6.64635 0.154
NP_441715.1_4 Reverse -211 -221 18.8596 0.00741
NP_440730.1_4 Forward -195 -176 -4.13045 0.298
NP_441448.1_1 Forward -293 -274 9.24257 0.198
NP_440183.1_9 Reverse -212 -231 -20.1584 0.282
NP_441198.1_8 Reverse -208 -218 12.5877 0.12
NP_441198.1_8 Reverse -102 -112 11.2205 0.217
NP_441468.1_1 Forward -218 -211 15.8704 0.0124
NP_441468.1_1 Reverse -211 -218 15.8704 0.0124
NP_441468.1_1 Forward -112 -105 4.07068 0.263
NP_441020.2_6 Forward -221 -204 11.3469 0.123
NP_441015.1_10 Reverse -205 -224 -7.37537 0.266
NP_441015.1_10 Reverse -99 -118 -7.37537 0.266
NP_441673.1_1 Forward -219 -210 20.8459 0.000698
NP_441673.1_1 Reverse -210 -219 20.8459 0.000698
NP_441956.1_9 Forward -226 -207 5.11266 0.276
NP_441826.1_2 Forward -225 -211 9.43936 0.0597
NP_441826.1_2 Reverse -204 -218 1.17956 0.161
NP_441826.1_5 Forward -327 -308 2.16274 0.276
NP_442868.1_6 Forward -221 -211 10.3048 0.038
NP_442868.1_6 Reverse -208 -218 9.12481 0.0539
NP_441056.1_1 Forward -219 -200 -9.34199 0.299
NP_442427.1_3 Reverse -99 -117 -0.275845 0.295
NP_442808.1_1 Forward -220 -210 18.4657 0.00201
NP_442808.1_1 Reverse -209 -219 8.73102 0.0481
NP_440145.1_3 Forward -229 -210 -5.70374 0.275
NP_440145.1_3 Reverse -200 -219 -5.9004 0.282
NP_442542.1_2 Forward -221 -208 8.27909 0.158
NP_442113.1_10 Reverse -311 -330 -7.27704 0.265
NP_442050.1_5 Forward -221 -211 6.96107 0.27
NP_442050.1_5 Reverse -208 -218 6.96107 0.27
NP_441493.2_10 Reverse -199 -218 13.0775 0.249
NP_440558.1_2 Reverse -216 -235 1.57275 0.178
NP_440558.1_2 Forward -166 -147 0.0977854 0.194
NP_441878.1_6 Reverse -209 -219 20.2362 0.0046
NP_441878.1_6 Forward -220 -210 10.4031 0.0176
NP_441878.1_6 Forward -114 -104 -7.59145 0.245
NP_441036.1_8 Forward -220 -210 17.7779 0.000554
NP_441036.1_8 Reverse -209 -219 8.4365 0.174
NP_441557.1_5 Forward -219 -210 19.9609 0.000699
NP_441557.1_5 Reverse -210 -219 19.9609 0.000699
NP_441557.1_5 Forward -113 -104 -0.786921 0.239
NP_441445.1_1 Forward -375 -356 5.70265 0.165
NP_441445.1_1 Reverse -201 -220 4.81767 0.187
NP_441445.1_1 Forward -228 -209 -0.688862 0.3
NP_441433.1_3 Reverse -205 -224 20.354 0.0733
NP_440101.1_3 Forward -224 -205 1.67108 0.269
NP_442830.1_5 Reverse -219 -233 4.32555 0.239
NP_442192.1_5 Reverse -220 -239 8.84924 0.263
NP_442183.1_1 Forward -219 -205 7.47274 0.141
NP_441574.1_1 Reverse -345 -364 -5.60541 0.265
NP_442347.1_2 Reverse -211 -220 11.1111 0.056
NP_442347.1_2 Reverse -330 -339 6.09625 0.191
NP_442347.1_2 Forward -218 -209 3.34298 0.284
NP_442645.1_2 Forward -227 -208 7.07928 0.0177
NP_442645.1_2 Reverse -202 -221 -13.0786 0.145
NP_442888.1_8 Reverse -137 -156 13.9625 0.179
NP_441037.1_4 Reverse -208 -218 17.3558 0.0127
NP_441037.1_4 Forward -221 -211 6.92787 0.237
NP_441633.1_3 Forward -221 -208 15.1623 0.0109
NP_441633.1_3 Reverse -208 -221 1.39592 0.109
NP_440136.1_2 Forward -218 -211 15.9687 0.0123
NP_440136.1_2 Reverse -211 -218 15.9687 0.0123
NP_442590.1_10 Forward -226 -207 5.70265 0.258
NP_442998.1_5 Forward -286 -276 13.1564 0.158
NP_442998.1_10 Forward -217 -210 15.5754 0.0102
NP_442998.1_10 Reverse -212 -219 15.5754 0.0102
NP_440299.1_1 Forward -223 -210 12.0151 0.0427
NP_440299.1_1 Reverse -206 -219 9.45847 0.0709
NP_441799.1_1 Reverse -206 -220 18.9768 0.00745
NP_441799.1_1 Forward -223 -209 8.45543 0.114
NP_441799.1_9 Reverse -209 -228 -1.37718 0.213
NP_441007.1_10 Reverse -130 -143 0.117615 0.25
NP_441007.1_10 Reverse -205 -218 -0.570702 0.287
NP_442201.1_10 Forward -230 -211 -5.11376 0.156
NP_442333.2_5 Forward -155 -136 -15.4385 0.294
NP_440256.1_1 Reverse -207 -226 11.3075 0.0152
NP_440256.1_1 Reverse -101 -120 -7.08038 0.228
NP_440087.1_1 Forward -228 -209 11.2092 0.0733
NP_441559.1_8 Forward -224 -210 9.93102 0.0624
NP_441559.1_8 Reverse -215 -229 6.98109 0.0752
NP_441559.1_8 Reverse -136 -150 -7.08024 0.283
NP_440915.1_6 Forward -223 -209 9.73436 0.039
NP_442158.1_4 Reverse -145 -155 12.7631 0.242
NP_442785.1_7 Reverse -208 -222 14.1593 0.228
NP_440749.1_1 Reverse -129 -148 0.786102 0.257
NP_442866.1_1 Forward -224 -205 -0.000545616 0.19
NP_441464.1_8 Forward -219 -205 7.17775 0.217
NP_440787.1_5 Reverse -202 -216 11.8976 0.256
NP_441199.1_6 Reverse -322 -341 1.17943 0.224
NP_441494.1_6 Reverse -99 -112 9.36073 0.227
NP_442993.1_1 Forward -265 -249 -12.3312 0.27
NP_442386.1_9 Forward -220 -211 15.7322 0.0144
NP_442386.1_9 Forward -114 -105 8.06244 0.209
NP_442386.1_9 Reverse -209 -218 6.39082 0.219
NP_441340.1_5 Forward -218 -211 15.6737 0.0124
NP_441340.1_5 Reverse -211 -218 15.6737 0.0124
NP_441340.1_5 Reverse -105 -112 3.97235 0.274
NP_442240.1_2 Reverse -211 -230 -14.5535 0.182
NP_440161.1_3 Forward -221 -202 14.1591 0.123
NP_440586.1_8 Forward -218 -211 13.2151 0.026
NP_440586.1_8 Reverse -211 -218 13.2151 0.026
NP_442251.1_6 Forward -218 -211 15.2804 0.0124
NP_442251.1_6 Reverse -211 -218 15.2804 0.0124
NP_440684.1_9 Reverse -204 -218 7.27608 0.272
NP_441262.1_3 Reverse -210 -217 14.7888 0.0223
NP_441262.1_3 Forward -219 -212 14.7888 0.0223
NP_440027.1_3 Forward -229 -211 18.8979 0.0682
NP_440027.1_3 Forward -150 -132 7.09821 0.214
NP_440027.1_3 Reverse -210 -228 7.09821 0.214
NP_443051.1_1 Reverse -209 -218 18.0926 0.00402
NP_443051.1_1 Forward -220 -211 10.4228 0.00754
NP_439984.1_2 Reverse -211 -224 14.5723 0.147
NP_439984.1_3 Reverse -203 -217 16.4202 0.122
NP_439937.1_9 Reverse -209 -226 -6.84499 0.157
NP_440398.1_6 Forward -302 -283 2.85105 0.294
NP_443039.1_7 Forward -162 -148 4.32555 0.266
NP_440439.1_1 Forward -222 -209 21.6521 0.00844
NP_440439.1_1 Reverse -207 -220 0.412608 0.192
NP_440372.1_2 Forward -218 -211 16.3621 0.0124
NP_440372.1_2 Reverse -211 -218 16.3621 0.0124
NP_440271.1_2 Forward -238 -219 3.24438 0.28
NP_440139.1_1 Forward -225 -206 4.12856 0.19
NP_441572.1_7 Forward -225 -206 -2.36049 0.193
NP_441572.1_7 Reverse -204 -223 -5.11376 0.25
NP_440267.1_2 Reverse -205 -219 9.6354 0.156
NP_442384.1_10 Reverse -210 -223 19.7838 0.00338
NP_442384.1_10 Forward -219 -206 9.06573 0.0574
NP_442114.1_4 Reverse -210 -221 9.20345 0.17
NP_440364.1_6 Reverse -366 -379 13.3917 0.282
NP_442262.1_10 Forward -218 -211 14.1988 0.0123
NP_442262.1_10 Reverse -211 -218 14.1988 0.0123
NP_442262.1_10 Reverse -105 -112 9.87221 0.164
NP_440344.1_10 Reverse -203 -220 -12.7442 0.264
NP_440531.1_6 Forward -227 -208 -4.72043 0.286
NP_442910.1_1 Forward -236 -217 -0.885524 0.227
NP_442910.1_1 Reverse -203 -222 -2.36049 0.254
NP_441965.1_10 Forward -222 -206 3.20513 0.271
NP_442065.1_5 Reverse -258 -277 -3.73712 0.28
NP_440297.1_9 Forward -218 -208 9.61647 0.0917
NP_440297.1_9 Reverse -105 -115 7.05986 0.15
NP_440297.1_9 Reverse -211 -221 -0.118297 0.282
NP_440297.1_9 Reverse -257 -267 -0.314959 0.282
NP_441896.1_5 Forward -343 -336 15.3787 0.268
NP_440999.1_9 Forward -223 -209 7.17775 0.0896
NP_440888.1_2 Reverse -210 -224 18.0918 0.00261
NP_440888.1_2 Reverse -104 -118 13.8636 0.0231
NP_440888.1_2 Forward -194 -180 9.04542 0.139
NP_440792.1_5 Reverse -105 -124 5.50599 0.246
NP_442077.1_9 Forward -215 -196 0.687771 0.218
NP_441543.1_2 Reverse -211 -220 18.486 0.00236
NP_441543.1_2 Forward -218 -209 9.34117 0.0818
NP_441543.1_2 Reverse -105 -114 5.01461 0.209
NP_442845.1_2 Forward -119 -105 4.42448 0.259
NP_441551.1_5 Forward -223 -207 11.3659 0.174
NP_441319.1_5 Reverse -211 -230 10.5209 0.25
NP_441918.1_7 Forward -220 -201 -1.27885 0.297
NP_441469.1_8 Forward -220 -211 16.126 0.00797
NP_441469.1_8 Reverse -209 -218 13.3727 0.073
NP_443064.1_6 Forward -219 -209 13.8273 0.0796
NP_442578.1_7 Forward -218 -211 14.5921 0.026
NP_442578.1_7 Reverse -211 -218 14.5921 0.026
NP_440710.1_1 Forward -227 -209 -0.374176 0.163
NP_441462.1_2 Forward -219 -209 20.1379 0.000967
NP_441462.1_2 Reverse -210 -220 11.5831 0.00406
NP_441462.1_2 Forward -113 -103 -0.216628 0.192
NP_441621.1_7 Forward -221 -207 -3.34366 0.188
NP_441621.1_7 Reverse -208 -222 -5.31028 0.25
NP_443062.1_1 Reverse -210 -228 9.13097 0.14
NP_443062.1_6 Reverse -202 -221 11.9958 0.0996
NP_442204.1_1 Forward -223 -212 0.0586712 0.284
NP_441560.1_10 Reverse -202 -221 6.39097 0.291
NP_442537.1_3 Reverse -276 -295 13.2741 0.239
NP_440516.1_2 Reverse -204 -222 3.95239 0.142
NP_440516.1_8 Forward -219 -210 16.9127 0.00442
NP_440516.1_8 Reverse -210 -219 16.9127 0.00442
NP_442428.1_5 Forward -218 -211 15.8704 0.0124
NP_442428.1_5 Reverse -211 -218 15.8704 0.0124
NP_442428.1_5 Forward -112 -105 4.46401 0.267
NP_442120.1_10 Forward -321 -302 -6.88371 0.217
NP_442120.1_10 Forward -113 -94 -8.45701 0.237
NP_441867.1_2 Forward -292 -273 -20.65 0.292
NP_440673.1_3 Forward -217 -210 12.4288 0.0426
NP_440673.1_3 Reverse -212 -219 12.4288 0.0426
NP_440673.1_3 Reverse -106 -113 8.98723 0.203
NP_441052.1_2 Reverse -210 -220 10.5014 0.0285
NP_441052.1_2 Forward -219 -209 10.4031 0.0285
NP_442219.1_9 Reverse -211 -220 8.35786 0.0681
NP_442219.1_9 Forward -218 -209 8.25953 0.0681
NP_440436.1_4 Reverse -211 -220 18.1905 0.00233
NP_440436.1_4 Forward -218 -209 15.9289 0.00508
NP_440436.1_4 Reverse -105 -114 11.0124 0.0655
NP_441884.1_8 Reverse -209 -228 -9.93197 0.268
NP_440314.1_9 Forward -218 -199 -9.34199 0.264
NP_441719.1_4 Forward -218 -211 16.3621 0.0124
NP_441719.1_4 Reverse -211 -218 16.3621 0.0124
NP_441733.1_10 Reverse -207 -220 7.09911 0.156
NP_441004.1_4 Forward -286 -276 9.32148 0.259
NP_442366.1_3 Forward -220 -202 -3.32411 0.246
NP_442366.1_5 Reverse -207 -217 14.0409 0.0497
NP_442854.1_6 Reverse -210 -229 5.11266 0.249
NP_440328.1_4 Forward -225 -206 13.1758 0.0472
NP_443054.1_2 Forward -221 -207 7.07942 0.169
NP_441851.1_10 Reverse -209 -219 17.4829 0.0027
NP_441851.1_10 Forward -220 -210 16.008 0.00552
NP_441851.1_10 Forward -114 -104 5.78156 0.2
NP_441851.1_10 Reverse -152 -162 4.40493 0.271
NP_442856.1_7 Forward -369 -350 -4.03212 0.254
NP_441668.1_4 Reverse -200 -219 9.53756 0.121
NP_442515.1_1 Reverse -209 -223 2.2612 0.14
NP_442515.1_1 Forward -358 -344 -2.95034 0.284
NP_442515.1_1 Forward -220 -206 -3.04867 0.285
NP_442709.1_3 Reverse -203 -222 12.3892 0.109
NP_441349.1_10 Forward -229 -210 2.26107 0.0753
NP_440432.1_9 Forward -218 -203 6.86307 0.045
NP_440432.1_9 Reverse -211 -226 -5.42831 0.248
NP_442843.1_1 Forward -218 -199 -2.36049 0.203
NP_442843.1_1 Reverse -136 -155 -3.54046 0.223
NP_442843.1_1 Reverse -149 -168 -6.49039 0.245
NP_442843.1_1 Forward -283 -264 -11.0136 0.285
NP_442450.1_5 Reverse -208 -218 17.3846 0.0267
NP_440588.1_2 Forward -228 -209 -7.08038 0.299
NP_440954.1_1 Reverse -148 -167 -10.9153 0.289
NP_442006.1_2 Forward -284 -267 -17.8574 0.283
NP_441570.1_1 Reverse -210 -228 -7.94566 0.0989
NP_441570.1_1 Forward -219 -201 -17.4838 0.278
NP_441078.1_4 Forward -219 -210 19.6659 0.0007
NP_441078.1_4 Reverse -210 -219 19.6659 0.0007
NP_441078.1_4 Forward -113 -104 -1.6719 0.266
NP_442388.1_4 Forward -142 -123 11.5033 0.23
NP_442348.1_2 Reverse -140 -149 13.8644 0.175
NP_440707.1_6 Forward -227 -208 13.175 0.189
NP_440526.1_3 Forward -161 -150 11.7595 0.0646
NP_440526.1_3 Forward -218 -207 8.71129 0.116
NP_441432.1_5 Forward -257 -243 11.8976 0.271
NP_441432.1_8 Forward -114 -105 15.0444 0.0182
NP_441432.1_8 Reverse -209 -218 8.35786 0.0755
NP_441432.1_8 Forward -220 -211 8.25953 0.0755
NP_442320.1_8 Forward -119 -105 1.96621 0.0801
NP_441732.1_2 Reverse -206 -222 -7.31629 0.0807
NP_440497.1_6 Forward -381 -362 -1.47551 0.264
NP_440760.1_1 Reverse -210 -229 -19.9617 0.22
NP_440760.1_1 Forward -219 -200 -20.2567 0.222
NP_442751.1_2 Reverse -209 -228 6.78348 0.214
NP_441072.1_5 Forward -277 -259 14.8671 0.287
NP_442489.1_7 Forward -219 -210 20.1576 0.000695
NP_442489.1_7 Reverse -210 -219 20.1576 0.000695
NP_442489.1_7 Forward -113 -104 -1.6719 0.235
NP_442489.1_7 Reverse -104 -113 -1.96689 0.28
NP_440559.1_1 Forward -218 -209 17.306 0.00658
NP_440559.1_1 Reverse -211 -220 8.75118 0.0586
NP_441659.2_8 Forward -219 -209 19.3512 0.000966
NP_441659.2_8 Reverse -210 -220 11.9764 0.0147
NP_441659.2_8 Reverse -104 -114 4.0116 0.146
NP_440860.1_8 Reverse -155 -174 16.0274 0.209
NP_442913.1_1 Forward -156 -137 6.68596 0.245
NP_442913.1_10 Forward -228 -209 6.88262 0.0577
NP_441040.1_2 Reverse -162 -181 -3.44213 0.144
NP_441040.1_2 Reverse -247 -266 -15.2418 0.286
NP_442008.1_2 Reverse -207 -226 8.75091 0.195
NP_441800.1_3 Reverse -257 -275 4.14905 0.289
NP_442346.1_5 Reverse -209 -219 17.9746 0.00128
NP_442346.1_5 Forward -114 -104 12.6647 0.0375
NP_442346.1_5 Forward -220 -210 9.02648 0.118
NP_440545.1_3 Reverse -206 -223 18.6234 0.0102
NP_440545.1_3 Forward -233 -216 -2.81276 0.193
NP_440545.1_3 Forward -53 -36 -5.07437 0.24
NP_440545.1_3 Forward -223 -206 -7.04099 0.295
NP_441629.1_3 Reverse -275 -294 -4.1312 0.29
NP_441923.1_8 Reverse -38 -52 12.3893 0.286
NP_441653.1_2 Reverse -199 -218 5.84883 0.235
NP_440010.1_10 Reverse -259 -278 9.14423 0.211
NP_441888.1_7 Forward -224 -210 4.12949 0.225
NP_441050.1_5 Forward -268 -250 -2.43913 0.283
NP_441948.1_4 Reverse -203 -221 6.90232 0.0633
NP_441948.1_4 Forward -226 -208 -1.35749 0.146
NP_441833.1_4 Forward -218 -211 15.9687 0.0124
NP_441833.1_4 Reverse -211 -218 15.9687 0.0124
NP_442162.1_9 Forward -218 -211 16.2637 0.0124
NP_442162.1_9 Reverse -211 -218 16.2637 0.0124
NP_440671.1_4 Reverse -204 -218 6.78443 0.235
NP_442073.1_6 Forward -280 -261 -2.16383 0.286
NP_442140.1_3 Reverse -211 -221 14.238 0.0486
NP_442140.1_3 Forward -218 -208 13.5497 0.0542
NP_442723.1_1 Reverse -357 -376 3.63691 0.278
NP_440875.1_9 Reverse -212 -222 14.3096 0.0453
NP_440875.1_9 Forward -111 -101 9.73475 0.233
NP_441813.1_5 Forward -221 -211 19.4496 0.00647
NP_441813.1_5 Reverse -208 -218 8.82982 0.0367
NP_440590.1_4 Reverse -211 -224 12.2123 0.0156
NP_440567.1_1 Reverse -211 -225 5.01447 0.108
NP_442497.1_10 Forward -218 -209 19.8626 0.00532
NP_442497.1_10 Reverse -211 -220 10.4228 0.0087
NP_440821.1_4 Reverse -208 -218 10.9931 0.0146
NP_440821.1_4 Forward -221 -211 10.2065 0.0163
NP_441239.1_9 Forward -221 -209 17.7386 0.0146
NP_441239.1_9 Reverse -208 -220 13.3137 0.037
NP_441239.1_9 Reverse -254 -266 5.44718 0.221
NP_441239.1_9 Reverse -102 -114 4.8572 0.239
NP_441009.1_4 Forward -113 -94 12.5858 0.232
NP_441727.1_3 Reverse -97 -116 12.1925 0.136
NP_441892.1_1 Reverse -201 -218 2.89044 0.133
NP_442105.1_9 Forward -274 -260 15.5167 0.283
NP_442772.1_3 Forward -239 -220 16.7157 0.0242
NP_442083.1_9 Forward -339 -320 9.93088 0.255
NP_442052.1_8 Reverse -208 -218 12.7631 0.253
NP_440546.1_4 Forward -219 -209 12.8578 0.0572
NP_440546.1_4 Reverse -210 -220 11.8882 0.0679
NP_440675.1_3 Forward -219 -200 5.30933 0.287
NP_440462.1_6 Forward -221 -211 17.2863 0.00752
NP_440462.1_6 Forward -262 -252 3.22496 0.255
NP_440462.1_6 Reverse -208 -218 1.455 0.294
NP_441184.1_4 Forward -263 -244 16.9124 0.239
NP_440868.1_4 Forward -223 -211 20.1968 0.00865
NP_440868.1_4 Reverse -206 -218 6.23383 0.0878
NP_441474.1_5 Forward -400 -381 5.80098 0.196
NP_441672.1_10 Reverse -212 -231 14.0608 0.244
NP_442402.1_4 Forward -312 -293 -7.27777 0.272
NP_442402.1_6 Forward -362 -353 13.2744 0.289
NP_442402.1_10 Reverse -351 -361 13.2542 0.204
NP_441848.1_7 Forward -211 -192 3.24359 0.217
NP_441084.1_6 Reverse -102 -116 13.1254 0.145
NP_440696.1_3 Reverse -210 -228 13.9821 0.0874
NP_440696.1_3 Forward -229 -211 0.0191479 0.237
NP_442039.1_4 Forward -218 -211 15.1821 0.0124
NP_442039.1_4 Reverse -211 -218 15.1821 0.0124
NP_442039.1_7 Reverse -181 -191 11.7798 0.257
NP_441811.1_8 Reverse -151 -165 9.14437 0.227
NP_442679.1_1 Forward -182 -163 -1.96717 0.24
NP_440825.1_7 Forward -218 -208 11.8361 0.2
NP_442837.1_3 Forward -218 -211 15.7721 0.0124
NP_442837.1_3 Reverse -211 -218 15.7721 0.0124
NP_442837.1_3 Reverse -330 -337 7.11894 0.173
NP_442053.1_1 Forward -219 -210 18.3876 0.0007
NP_442053.1_1 Reverse -210 -219 18.3876 0.0007
NP_440505.1_3 Forward -221 -211 15.9097 0.00857
NP_440505.1_3 Forward -115 -105 5.5849 0.222
NP_441959.1_10 Forward -231 -213 9.78924 0.299
NP_442255.1_5 Reverse -293 -312 10.1275 0.241
NP_441408.2_7 Reverse -298 -317 -2.0655 0.264
NP_440914.1_1 Reverse -210 -220 8.6151 0.186
NP_440914.1_1 Forward -219 -209 8.51751 0.186
NP_440914.1_1 Reverse -99 -109 7.63919 0.228
NP_441011.1_8 Reverse -211 -220 16.9127 0.00602
NP_441011.1_8 Forward -218 -209 14.356 0.0249
NP_442533.1_6 Forward -219 -210 17.2076 0.00137
NP_442533.1_6 Reverse -210 -219 17.2076 0.00137
NP_442533.1_6 Forward -113 -104 5.60459 0.137
NP_442533.1_6 Reverse -220 -229 4.91628 0.165
NP_442232.1_3 Reverse -202 -221 -13.4719 0.282
NP_442229.1_1 Forward -221 -207 9.73373 0.184
NP_441482.1_7 Reverse -204 -218 8.25939 0.0181
NP_441482.1_7 Forward -225 -211 -10.2268 0.209
NP_441235.1_2 Forward -176 -157 18.7798 0.0708
NP_441235.1_3 Forward -155 -136 22.4189 0.055
NP_441235.1_10 Forward -253 -234 24.1889 0.00818
NP_439944.1_9 Forward -218 -208 8.82982 0.101
NP_441749.1_7 Forward -171 -152 15.3391 0.205
NP_440116.1_4 Forward -399 -380 6.09597 0.296
NP_440116.1_8 Reverse -211 -230 -7.86702 0.24
NP_441527.1_7 Reverse -215 -234 8.35677 0.284
NP_440115.1_6 Reverse -207 -217 9.61647 0.115
NP_440115.1_6 Forward -222 -212 6.66654 0.172
NP_440007.1_9 Reverse -217 -231 13.1759 0.163
NP_440007.1_9 Reverse -101 -115 1.08123 0.29
NP_441680.1_4 Forward -299 -280 -0.4922 0.253
NP_441347.1_5 Forward -266 -252 8.55376 0.285
NP_441106.1_1 Forward -220 -211 18.191 0.0028
NP_441106.1_1 Reverse -209 -218 9.73449 0.0311
NP_441420.1_1 Forward -26 -7 -2.85214 0.288
NP_441216.1_6 Reverse -180 -199 13.0775 0.288
NP_442306.1_10 Forward -224 -205 -11.8986 0.154
NP_441286.1_1 Forward -220 -208 5.93884 0.0258
NP_441286.1_1 Reverse -209 -221 -3.40261 0.145
NP_440670.1_8 Forward -219 -210 18.3876 0.000699
NP_440670.1_8 Reverse -210 -219 18.3876 0.000699
NP_440886.1_7 Forward -220 -210 17.7774 0.0011
NP_440886.1_7 Reverse -209 -219 8.04271 0.0805
NP_440886.1_7 Reverse -366 -376 3.51951 0.279
NP_442614.1_2 Reverse -217 -231 8.16106 0.255
NP_442614.1_2 Reverse -210 -224 6.3911 0.291
NP_442072.1_9 Reverse -209 -227 5.23069 0.0167
NP_442072.1_9 Forward -220 -202 -22.302 0.229
NP_440907.2_8 Forward -218 -208 16.2041 0.0161
NP_440907.2_8 Reverse -211 -221 7.94438 0.117
NP_442264.1_2 Reverse -125 -142 6.33202 0.264
NP_441021.1_1 Forward -218 -199 -4.6221 0.172
NP_440841.1_4 Forward -115 -96 -7.67036 0.238
NP_441463.1_3 Reverse -94 -113 -6.98204 0.253
NP_442842.1_4 Forward -218 -199 1.57275 0.285
NP_441626.1_2 Forward -218 -211 15.7721 0.0124
NP_441626.1_2 Reverse -211 -218 15.7721 0.0124
NP_442238.1_1 Forward -113 -94 1.27776 0.255
NP_442238.1_1 Forward -321 -302 -0.0988766 0.298
NP_440107.1_2 Forward -235 -216 6.88262 0.299
NP_442794.1_1 Reverse -206 -218 2.79224 0.286
NP_442615.1_1 Reverse -201 -219 -1.35749 0.128
NP_441962.1_4 Forward -362 -343 -12.7836 0.265
NP_441962.1_4 Reverse -152 -171 -12.7836 0.265
NP_441962.1_4 Forward -143 -124 -15.1435 0.299
NP_440387.1_1 Reverse -210 -226 5.95839 0.0297
NP_440387.1_1 Forward -219 -203 4.87675 0.0377
NP_441431.1_2 Forward -222 -208 20.4518 0.00685
NP_441431.1_2 Reverse -207 -221 6.39049 0.272
NP_441993.1_1 Forward -119 -100 6.81956 0.177
NP_440814.1_8 Forward -369 -350 2.94938 0.269
NP_442805.1_5 Forward -148 -129 -4.91784 0.269
NP_440114.1_10 Reverse -210 -224 12.8809 0.0698
NP_440114.1_10 Forward -219 -205 8.06273 0.217
NP_440114.1_10 Forward -113 -99 5.99778 0.289
NP_440293.1_3 Forward -236 -217 -4.13045 0.258
NP_440422.1_10 Reverse -154 -173 12.631 0.16
NP_441237.1_9 Forward -218 -208 17.188 0.00445
NP_441237.1_9 Forward -259 -249 11.1898 0.196
NP_442743.1_4 Reverse -211 -230 -7.76869 0.28
NP_441133.1_1 Reverse -142 -161 14.9458 0.2
NP_439910.1_2 Reverse -202 -219 -13.6292 0.162
NP_440457.1_1 Forward -223 -211 10.7571 0.092
NP_440457.1_1 Reverse -206 -218 2.39892 0.212
NP_440798.1_6 Reverse -211 -224 14.9656 0.0423
NP_440798.1_6 Forward -218 -205 11.1307 0.0665
NP_441436.1_8 Forward -230 -211 7.7676 0.293
NP_441436.1_8 Reverse -184 -203 6.78429 0.297
NP_442509.1_9 Forward -219 -209 17.3841 0.00128
NP_442509.1_9 Reverse -210 -220 16.2041 0.00739
NP_442509.1_9 Forward -230 -220 8.63269 0.192
NP_441253.1_8 Reverse -205 -219 18.9783 0.119
NP_440554.1_4 Reverse -211 -221 16.4996 0.0189
NP_442737.1_9 Forward -218 -199 17.6075 0.199
NP_441885.1_5 Reverse -210 -220 11.4848 0.00668
NP_441885.1_5 Forward -219 -209 11.3864 0.00668
NP_440478.1_9 Reverse -206 -225 9.53756 0.255
NP_441428.1_8 Reverse -127 -146 6.68596 0.216
NP_442341.1_7 Forward -220 -206 5.1128 0.167
NP_442341.1_9 Forward -221 -207 20.5501 0.00895
NP_440191.1_4 Reverse -353 -363 13.8268 0.282
NP_440423.1_6 Reverse -202 -221 -21.0434 0.279
NP_443000.1_7 Forward -221 -211 11.5831 0.0344
NP_443000.1_7 Reverse -208 -218 2.04498 0.226
NP_441842.1_1 Reverse -212 -225 11.2284 0.262
NP_440275.1_3 Forward -221 -211 15.418 0.0178
NP_440275.1_3 Reverse -208 -218 9.91146 0.046
NP_440275.1_3 Reverse -133 -143 6.37155 0.111
NP_440091.1_1 Forward -223 -211 10.1671 0.0498
NP_442354.1_8 Reverse -241 -260 8.25926 0.266
NP_442451.1_2 Forward -227 -208 4.71934 0.121
NP_439962.1_6 Reverse -126 -144 11.6222 0.204
NP_442495.1_4 Forward -377 -367 12.9597 0.204
NP_441105.1_3 Reverse -93 -112 -2.65548 0.165
NP_440216.1_1 Reverse -210 -224 27.5323 0.000481
NP_440216.1_1 Forward -219 -205 5.70279 0.0186
NP_440216.1_1 Forward -230 -216 -12.1934 0.247
NP_440172.1_1 Forward -219 -209 16.303 0.00854
NP_440172.1_1 Forward -113 -103 13.8447 0.0175
NP_440172.1_1 Reverse -210 -220 8.73149 0.0586
NP_442015.1_10 Forward -223 -210 12.114 0.0372
NP_442015.1_10 Reverse -206 -219 11.0324 0.0384
NP_442015.1_10 Forward -234 -221 -0.275709 0.259
NP_441226.1_7 Forward -218 -211 14.4934 0.0123
NP_441226.1_7 Reverse -211 -218 14.4934 0.0123
NP_441226.1_7 Forward -143 -136 8.59356 0.197
NP_441757.1_6 Forward -238 -219 9.24257 0.149
NP_441111.1_7 Forward -218 -210 18.7023 0.00294
NP_441111.1_7 Reverse -211 -219 18.7023 0.00294
NP_442379.1_10 Forward -226 -209 1.8088 0.223
NP_441766.1_2 Forward -219 -210 17.5026 0.00297
NP_441766.1_2 Reverse -210 -219 17.5026 0.00297
NP_440416.1_9 Forward -226 -207 -8.85033 0.122
NP_440416.1_9 Reverse -203 -222 -14.5535 0.178
NP_440416.1_9 Forward -230 -211 -17.5035 0.241
NP_443052.1_8 Forward -229 -210 2.45773 0.0551
NP_443052.1_9 Reverse -253 -272 -6.98204 0.291
NP_442552.1_1 Forward -217 -198 3.44104 0.203
NP_442403.1_8 Forward -281 -262 -1.37718 0.258
NP_442564.1_9 Forward -113 -99 14.7019 0.227
NP_440261.1_5 Reverse -211 -224 5.13249 0.0476
NP_440261.1_5 Forward -218 -205 -0.767364 0.0655
NP_440261.1_5 Forward -229 -216 -12.4687 0.297
NP_440988.1_10 Reverse -177 -191 6.44783 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCGGACTAGGGTTTCTCCATAAAGGGCATAGGGGCCGACTGTGGAAACCACAACTTTGGTTTGGGAGCACAGTGTAGTGACAGCGGCTTCGTCTTTGATATCAACCACAAAGGTGGGCAAATGGGCAGCTTGAGGGCCAAGGGATTGAACCAAACGGTCAAGTTTAGCTTGGGAACGGCCGGCGATCGCCCAGTTTTTTGCTGCTGCAGTTTCCCAGTGGGACAACAAATAGCGGCAAACAATCCCACCGACAAATCCCGTCGCACCCACAATTATCAGGTCATATGGCAATGGCTTCGTCATAGAGTTTAACGGTAGTTGAAAGGTTGAATGGGATACAAAGCTGACTATGGGATAGTCTGGATTGATATACTGACGGTCGAGTCTTAAATTTGCCTA

CDS

ATGTTATTTGCCCATGAGGCTTCCAGGATGATGTGCCCCCAGAAATGGTTTAAACGATTATTACCCATGGTTTTGGGTGTTTGCTGTTTGCTAACCGGCTGTGTGGATTATGACGTGGGCATTCGTTTTCCAGAGCAACATTATGGGGAAATTGTCCAACACATTACCCTGGGGGAACAACTAACTACCCTGAGCCAAGCAGAAGCCGATCGTTGGCTCAAAAGTTTAGACCAGCGGGCTAAGGACTTAAACGGTCACACGGATCGCCCGTCGGAGGAAACCCTTGTGATAACCATTCCTTTTGGTAGCGGCCAGGAGTTGGTGGAAAAGTTCAATCGCTTTTTTAATCCCCAACCCCCCAAAGGAAGGCGATCGCCAGAGCCAGACCAGTTGGATTTGCTTAATTTGAAAGCGGAACTCGCACTAGAGCAAAGTAATTGGTTATTAGCAGACCGCAATCATCTCAAGTTAACCGTTGACCTGCGGGCCCTAGGGGTTTTATCCAACCAAGGCAACATTATCCTTAGTCCCGGCTCCCTAATTAACCTCAATTTTGATTTGCAAACTCCCTTAACTCTCCAAACTCCCAATGCTCCGGGGGAAGAATTAGGCACAGAAGTGCCTGGGCAATGGCAGTTAAAACCTGGACAAATTAACGTTATTGAAACGACCTTTTTTGTGCCTAGTTATTTGGCGATCGGGACAATTTTAATTATCATCCTTTGTTTAGGGGGTTTTTATCTCAAATATGGCCGTTGGCCCGGAGTGCTTGATAGCAAAGTTGAGGGAGTTTAA

Protein

MLFAHEASRMMCPQKWFKRLLPMVLGVCCLLTGCVDYDVGIRFPEQHYGEIVQHITLGEQLTTLSQAEADRWLKSLDQRAKDLNGHTDRPSEETLVITIPFGSGQELVEKFNRFFNPQPPKGRRSPEPDQLDLLNLKAELALEQSNWLLADRNHLKLTVDLRALGVLSNQGNIILSPGSLINLNFDLQTPLTLQTPNAPGEELGTEVPGQWQLKPGQINVIETTFFVPSYLAIGTILIIILCLGGFYLKYGRWPGVLDSKVEGV