Your browser is old and dusty. Try Google Chrome!

Details for slr1715

ORF slr1715
Accession NP_441221.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY100m: 1463383 - 1464328]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -381 -367 1.96621 0.179
NP_441061.1_2 Forward -375 -361 1.86788 0.181
NP_440557.1_1 Reverse -368 -387 -2.65548 0.297
NP_441418.1_6 Reverse -367 -386 -30.1882 0.262
NP_441453.1_4 Reverse -276 -284 4.93597 0.224
NP_441453.1_4 Reverse -335 -343 4.34598 0.257
NP_441453.1_4 Forward -376 -368 4.24765 0.259
NP_442151.1_6 Reverse -345 -359 8.25939 0.178
NP_442151.1_6 Forward -398 -384 7.47274 0.197
NP_440120.1_4 Forward -263 -249 13.3726 0.29
NP_441066.1_9 Forward -387 -368 19.2412 0.138
NP_442752.1_4 Forward -285 -278 5.25066 0.256
NP_440784.1_7 Forward -217 -210 7.21728 0.15
NP_441093.1_1 Forward -359 -340 21.6323 0.0726
NP_442000.2_1 Forward -271 -252 11.7992 0.226
NP_442062.1_3 Forward -123 -104 -2.45882 0.271
NP_442062.1_3 Reverse -107 -126 -2.45882 0.271
NP_442062.1_8 Forward -376 -366 10.2065 0.0504
NP_441900.1_1 Reverse -354 -373 9.97809 0.273
NP_440304.1_4 Reverse -365 -375 5.97822 0.185
NP_440304.1_4 Forward -184 -174 3.81494 0.292
NP_441492.1_1 Forward -21 -2 11.1109 0.148
NP_442097.1_9 Reverse -242 -260 12.7038 0.271
NP_442602.1_3 Forward -157 -138 8.75091 0.0877
NP_439918.1_2 Reverse -361 -380 -0.885524 0.236
NP_441365.1_5 Forward -21 -2 37.5619 0.000000115
NP_442375.1_6 Reverse -250 -269 19.2723 0.247
NP_440300.1_5 Reverse -30 -48 12.225 0.271
NP_441083.1_5 Reverse -276 -286 7.05986 0.067
NP_441434.1_1 Reverse -287 -301 8.03294 0.26
NP_441738.1_2 Reverse -278 -285 8.00357 0.235
NP_440056.1_1 Forward -381 -362 11.2092 0.191
NP_441713.1_8 Reverse -363 -381 7.39397 0.294
NP_442570.1_3 Forward -287 -268 1.67108 0.193
NP_442570.1_3 Reverse -364 -383 -8.94866 0.294
NP_441792.1_5 Forward -381 -365 17.0698 0.13
NP_441716.1_1 Forward -354 -340 7.9644 0.153
NP_441716.1_2 Reverse -53 -72 3.35565 0.229
NP_441163.1_9 Reverse -346 -365 11.8975 0.292
NP_440747.1_10 Reverse -206 -218 -12.3507 0.27
NP_440747.1_10 Forward -288 -276 -12.5474 0.297
NP_441486.1_1 Reverse -332 -346 -6.39192 0.294
NP_442145.1_4 Forward -125 -106 4.05798 0.283
NP_442634.1_4 Reverse -365 -379 5.01447 0.0671
NP_440842.1_10 Forward -400 -386 3.93283 0.254
NP_442848.1_5 Forward -383 -365 -2.3408 0.285
NP_442848.1_5 Forward -371 -353 -2.73412 0.286
NP_441012.1_4 Reverse -363 -376 5.72248 0.291
NP_443018.1_3 Forward -375 -368 10.7572 0.0907
NP_443018.1_3 Reverse -390 -397 9.38056 0.128
NP_443018.1_3 Reverse -368 -375 4.56234 0.241
NP_443018.1_3 Forward -343 -336 4.26735 0.267
NP_443018.1_3 Reverse -336 -343 4.07068 0.299
NP_440376.1_1 Forward -285 -276 3.34298 0.206
NP_440376.1_1 Forward -398 -389 2.65466 0.216
NP_442687.1_7 Reverse -366 -376 8.1415 0.113
NP_442687.1_7 Forward -399 -389 5.19158 0.217
NP_441077.1_6 Reverse -100 -116 1.64498 0.299
NP_442485.1_3 Reverse -356 -375 -3.44213 0.274
NP_442658.1_1 Reverse -365 -375 12.3692 0.0569
NP_442782.1_2 Reverse -367 -381 9.34103 0.198
NP_441414.1_9 Reverse -276 -295 4.22769 0.0552
NP_441414.1_9 Forward -398 -379 -8.16202 0.23
NP_442937.1_5 Reverse -356 -375 7.27595 0.258
NP_441958.1_5 Reverse -366 -376 -0.216628 0.186
NP_441958.1_5 Forward -399 -389 -1.29827 0.236
NP_440203.1_5 Forward -373 -363 14.3359 0.0886
NP_440984.1_7 Reverse -384 -398 6.09611 0.227
NP_439990.1_5 Forward -290 -277 5.72248 0.278
NP_442690.1_1 Reverse -107 -126 -13.3736 0.26
NP_442690.1_1 Reverse -175 -194 -16.5201 0.289
NP_442911.1_2 Forward -295 -276 -5.80207 0.167
NP_442536.1_4 Forward -394 -376 5.91901 0.3
NP_440138.1_6 Forward -380 -361 8.55343 0.19
NP_441646.1_1 Reverse -360 -379 1.47442 0.231
NP_441000.1_1 Forward -22 -4 13.3937 0.184
NP_440147.1_4 Reverse -333 -346 0.510939 0.252
NP_441916.1_7 Reverse -367 -377 4.40493 0.178
NP_440345.1_5 Reverse -182 -196 14.525 0.276
NP_440345.1_5 Reverse -295 -309 13.7611 0.276
NP_441041.1_4 Reverse -361 -380 -3.44213 0.122
NP_441041.1_4 Forward -285 -266 -8.26035 0.199
NP_441041.1_4 Reverse -355 -374 -11.0136 0.239
NP_441369.1_1 Forward -56 -37 38.7419 0.000000157
NP_441369.1_2 Forward -26 -7 38.9385 0.0000000955
NP_441369.1_3 Forward -73 -59 28.5156 0.00021
NP_442996.1_1 Forward -128 -109 10.4559 0.21
NP_441725.1_5 Forward -375 -365 7.64985 0.0904
NP_441725.1_5 Reverse -390 -400 -0.609952 0.265
NP_439966.1_7 Reverse -274 -284 11.2876 0.0688
NP_442941.1_3 Forward -284 -274 7.94484 0.0486
NP_442281.1_1 Reverse -362 -376 10.1271 0.0622
NP_442281.1_1 Forward -381 -367 5.89884 0.142
NP_442281.1_1 Forward -187 -173 2.65393 0.26
NP_442281.1_1 Reverse -271 -285 1.86729 0.285
NP_441079.1_7 Forward -324 -305 1.37531 0.179
NP_442575.1_8 Reverse -355 -374 -6.39206 0.281
NP_440437.1_1 Reverse -333 -352 0.392778 0.172
NP_442012.1_1 Forward -382 -363 0.491109 0.237
NP_442012.1_5 Reverse -360 -379 4.52268 0.261
NP_441087.1_6 Reverse -242 -260 0.0184138 0.258
NP_442288.1_5 Forward -58 -44 16.7159 0.12
NP_441860.1_1 Forward -388 -374 14.095 0.288
NP_441556.1_6 Forward -54 -36 12.4797 0.296
NP_441644.1_6 Reverse -389 -399 11.9759 0.0408
NP_441644.1_6 Forward -376 -366 7.64939 0.121
NP_441644.1_6 Reverse -276 -286 4.99446 0.216
NP_441644.1_6 Forward -398 -388 4.30615 0.242
NP_442029.1_1 Forward -356 -337 -10.1286 0.219
NP_442247.1_5 Reverse -29 -43 14.4865 0.234
NP_440929.1_8 Reverse -276 -285 4.81794 0.176
NP_442933.1_10 Forward -344 -335 10.6195 0.0484
NP_442933.1_10 Reverse -339 -348 9.63616 0.0616
NP_442933.1_10 Reverse -367 -376 4.52295 0.24
NP_442671.1_2 Forward -48 -29 24.6829 0.000359
NP_442671.1_2 Reverse -148 -167 -0.281761 0.294
NP_442926.1_3 Reverse -356 -375 6.4893 0.206
NP_442554.1_8 Forward -397 -387 10.7964 0.043
NP_442554.1_8 Forward -284 -274 5.19158 0.157
NP_442554.1_8 Forward -375 -365 3.91327 0.203
NP_442554.1_8 Reverse -390 -400 2.83163 0.253
NP_442970.1_1 Forward -46 -32 9.56081 0.269
NP_442142.1_4 Forward -351 -338 2.37867 0.294
NP_442143.1_8 Reverse -242 -261 15.0432 0.223
NP_443009.1_5 Forward -377 -366 7.03967 0.141
NP_443009.1_5 Reverse -334 -345 5.76138 0.189
NP_443009.1_5 Reverse -366 -377 5.07306 0.218
NP_441715.1_4 Forward -217 -207 6.17489 0.157
NP_442076.1_5 Forward -52 -33 9.93088 0.186
NP_440183.1_9 Reverse -353 -372 -12.2919 0.256
NP_440183.1_9 Forward -374 -355 -15.8318 0.273
NP_441198.1_8 Reverse -365 -375 10.6345 0.254
NP_440379.1_5 Forward -379 -360 -9.83364 0.267
NP_441468.1_1 Reverse -368 -375 4.07068 0.263
NP_441468.1_1 Forward -343 -336 3.97235 0.277
NP_442099.1_1 Forward -375 -357 15.7521 0.274
NP_441015.1_10 Forward -359 -340 -11.7019 0.3
NP_440265.1_7 Reverse -367 -381 17.2068 0.158
NP_441826.1_2 Forward -382 -368 -1.08205 0.234
NP_441330.1_1 Forward -381 -362 -8.45701 0.183
NP_441056.1_1 Forward -376 -357 -8.45701 0.282
NP_441612.1_2 Forward -392 -382 11.7441 0.21
NP_442227.1_4 Reverse -144 -163 18.5831 0.111
NP_442227.1_4 Forward -383 -364 10.7167 0.285
NP_441911.1_10 Forward -93 -74 10.3907 0.226
NP_441176.1_3 Reverse -326 -345 13.9625 0.233
NP_440871.1_3 Reverse -52 -66 15.905 0.166
NP_440145.1_3 Reverse -266 -285 -4.13045 0.221
NP_442050.1_5 Reverse -274 -284 12.9592 0.0477
NP_442903.1_2 Forward -211 -192 8.16414 0.165
NP_441114.1_3 Forward -374 -365 17.1093 0.113
NP_440558.1_2 Forward -379 -360 7.86593 0.117
NP_440558.1_2 Forward -373 -354 5.211 0.147
NP_441878.1_6 Forward -399 -389 10.5014 0.0176
NP_441878.1_6 Reverse -366 -376 2.24165 0.0462
NP_441878.1_6 Reverse -388 -398 0.57002 0.14
NP_441036.1_8 Forward -286 -276 5.28991 0.295
NP_441557.1_5 Reverse -367 -376 -0.786921 0.239
NP_441445.1_1 Reverse -380 -399 -0.295539 0.289
NP_442267.1_4 Reverse -359 -378 2.65439 0.223
NP_442066.2_9 Forward -371 -358 6.80412 0.267
NP_441433.1_8 Forward -368 -349 -4.42544 0.294
NP_441739.1_2 Reverse -139 -155 3.10612 0.285
NP_441308.1_8 Reverse -274 -284 13.4514 0.218
NP_440101.1_10 Reverse -361 -380 11.5042 0.146
NP_441458.1_10 Reverse -380 -399 1.0811 0.298
NP_441819.1_5 Forward -131 -112 8.35512 0.295
NP_441574.1_1 Reverse -367 -386 -3.63879 0.241
NP_442347.1_2 Reverse -277 -286 11.2095 0.056
NP_442645.1_2 Reverse -327 -346 -16.9135 0.245
NP_441037.1_4 Reverse -365 -375 6.44058 0.263
NP_442594.1_8 Reverse -377 -396 3.24438 0.286
NP_441633.1_3 Reverse -207 -220 -3.32397 0.177
NP_440136.1_2 Forward -284 -277 3.97235 0.288
NP_442998.1_5 Forward -150 -140 14.0414 0.151
NP_442998.1_5 Forward -25 -15 8.53483 0.261
NP_440899.1_8 Reverse -33 -52 -9.14533 0.258
NP_440256.1_1 Forward -367 -348 -1.96717 0.111
NP_440256.1_1 Reverse -363 -382 -6.09707 0.201
NP_440256.1_1 Reverse -348 -367 -10.1286 0.295
NP_441362.1_2 Forward -50 -31 5.55684 0.243
NP_441090.1_6 Forward -398 -384 8.75105 0.262
NP_441559.1_8 Reverse -271 -285 -6.58858 0.279
NP_440915.1_6 Forward -289 -275 -2.45868 0.272
NP_440717.1_2 Forward -363 -344 -10.522 0.245
NP_442866.1_1 Reverse -349 -368 -6.39206 0.255
NP_440748.1_5 Forward -379 -360 0.491109 0.25
NP_440748.1_5 Forward -373 -354 -1.47551 0.267
NP_440657.1_1 Reverse -150 -169 11.4058 0.143
NP_440537.1_7 Forward -72 -53 16.6629 0.0599
NP_441464.1_1 Forward -368 -349 9.24257 0.24
NP_441464.1_1 Reverse -272 -291 7.07928 0.27
NP_440702.1_1 Reverse -254 -273 8.35759 0.235
NP_442386.1_9 Reverse -388 -397 6.48915 0.219
NP_440570.1_5 Forward -380 -361 6.68596 0.183
NP_441340.1_5 Forward -375 -368 3.97235 0.274
NP_441340.1_9 Forward -120 -110 7.29115 0.289
NP_443028.1_4 Reverse -274 -293 10.2692 0.293
NP_441248.1_10 Reverse -285 -295 14.6181 0.282
NP_441776.1_5 Reverse -363 -382 11.0125 0.282
NP_440161.1_3 Reverse -171 -190 10.3242 0.23
NP_440586.1_8 Forward -343 -336 7.70858 0.227
NP_441262.1_3 Forward -285 -278 5.15232 0.265
NP_443051.1_1 Reverse -275 -284 -0.0986038 0.256
NP_439996.1_6 Forward -275 -256 6.55281 0.296
NP_439996.1_9 Reverse -363 -382 8.55343 0.284
NP_440836.1_6 Reverse -379 -393 7.37441 0.263
NP_440408.1_7 Forward -376 -357 9.63589 0.255
NP_440372.1_2 Forward -284 -277 4.07068 0.262
NP_440372.1_3 Forward -45 -31 15.0039 0.165
NP_440171.1_3 Forward -263 -244 7.37428 0.259
NP_440316.1_10 Forward -399 -389 8.04317 0.24
NP_440316.1_10 Reverse -366 -376 6.8632 0.251
NP_442493.1_6 Reverse -292 -310 14.7688 0.261
NP_440267.1_2 Forward -381 -367 7.47213 0.196
NP_442384.1_10 Forward -218 -205 4.8375 0.145
NP_442384.1_10 Reverse -276 -289 4.44418 0.157
NP_441018.1_3 Reverse -371 -390 12.4867 0.286
NP_441018.1_7 Reverse -357 -376 11.8975 0.173
NP_442262.1_10 Forward -375 -368 9.87221 0.164
NP_442262.1_10 Reverse -390 -397 9.47889 0.187
NP_441689.1_5 Reverse -274 -284 13.0576 0.0844
NP_440531.1_6 Forward -362 -343 2.16274 0.161
NP_441640.1_8 Forward -264 -245 -2.95047 0.245
NP_440297.1_9 Reverse -390 -400 9.22315 0.0917
NP_440297.1_9 Forward -375 -365 7.35486 0.126
NP_442280.1_10 Reverse -351 -369 7.98684 0.268
NP_442280.1_10 Reverse -246 -264 5.64923 0.283
NP_441592.1_4 Forward -344 -325 7.17762 0.124
NP_443036.1_1 Reverse -359 -378 14.2566 0.224
NP_442129.1_6 Forward -47 -28 13.9464 0.246
NP_440999.1_9 Reverse -341 -355 5.1128 0.113
NP_440999.1_9 Forward -222 -208 -2.26202 0.264
NP_440888.1_2 Reverse -345 -359 9.04542 0.139
NP_442710.1_7 Forward -49 -30 -7.22274 0.294
NP_441469.1_8 Reverse -366 -375 9.63616 0.227
NP_440148.1_1 Reverse -188 -207 -5.70374 0.235
NP_441462.1_2 Reverse -367 -377 -0.216628 0.192
NP_441462.1_2 Forward -285 -275 -1.10161 0.281
NP_443062.1_1 Forward -285 -267 8.15589 0.159
NP_440519.1_8 Reverse -367 -383 6.35172 0.21
NP_440519.1_8 Forward -274 -258 2.22182 0.267
NP_442204.1_1 Reverse -363 -374 0.0586712 0.284
NP_442204.1_1 Reverse -272 -283 -0.0396598 0.285
NP_442872.1_1 Forward -332 -313 -11.8003 0.252
NP_442080.1_7 Reverse -362 -381 -4.42544 0.296
NP_442428.1_5 Reverse -368 -375 4.46401 0.267
NP_442428.1_5 Forward -343 -336 4.36568 0.271
NP_442120.1_10 Reverse -361 -380 -12.9802 0.279
NP_440603.1_9 Forward -375 -356 10.9142 0.197
NP_440673.1_3 Reverse -337 -344 13.2155 0.0426
NP_440673.1_3 Forward -374 -367 8.98723 0.203
NP_441052.1_2 Reverse -345 -355 5.87989 0.0998
NP_441052.1_2 Forward -398 -388 4.20827 0.163
NP_440436.1_4 Forward -375 -366 9.73406 0.0871
NP_440436.1_4 Reverse -336 -345 8.45576 0.105
NP_441004.1_1 Reverse -361 -380 0.58944 0.116
NP_441004.1_2 Reverse -356 -375 0.786102 0.23
NP_442366.1_3 Forward -377 -359 -4.40575 0.271
NP_442694.1_8 Reverse -32 -50 12.3105 0.191
NP_442694.1_9 Reverse -188 -207 8.25926 0.277
NP_442206.1_10 Reverse -367 -382 9.32134 0.167
NP_441851.1_10 Reverse -366 -376 7.45319 0.14
NP_441542.1_4 Forward -153 -139 4.52282 0.264
NP_441668.1_4 Reverse -379 -398 6.78429 0.157
NP_441668.1_4 Reverse -357 -376 4.03102 0.183
NP_442515.1_1 Forward -392 -378 -4.03198 0.298
NP_440593.1_3 Reverse -356 -375 -4.42544 0.248
NP_441982.1_6 Forward -393 -384 13.5358 0.274
NP_441982.1_10 Reverse -4 -23 8.55343 0.143
NP_442689.1_8 Reverse -179 -196 -6.54933 0.285
NP_442689.1_8 Reverse -32 -49 -8.61428 0.294
NP_441409.1_6 Reverse -270 -289 -8.752 0.174
NP_441124.1_5 Forward -53 -43 12.7217 0.215
NP_441124.1_5 Forward -121 -111 10.8118 0.283
NP_440431.1_3 Forward -377 -358 2.3594 0.0969
NP_440431.1_3 Reverse -274 -293 -10.817 0.278
NP_441003.1_9 Forward -379 -360 5.01433 0.271
NP_441570.1_1 Reverse -345 -363 -10.5023 0.171
NP_441078.1_4 Reverse -367 -376 -1.6719 0.266
NP_441078.1_4 Forward -398 -389 -1.6719 0.266
NP_441078.1_4 Reverse -389 -398 -1.77023 0.266
NP_442729.1_8 Reverse -325 -338 6.4108 0.197
NP_442348.1_2 Reverse -138 -147 9.53783 0.28
NP_441432.1_8 Reverse -366 -375 6.5879 0.112
NP_441333.1_1 Reverse -378 -388 12.4479 0.235
NP_441333.1_1 Reverse -184 -194 11.9712 0.241
NP_442815.1_2 Reverse -356 -374 2.47742 0.295
NP_440760.1_1 Reverse -276 -295 -6.68705 0.0622
NP_440199.1_10 Forward -357 -347 10.2065 0.185
NP_441945.1_10 Forward -370 -351 12.6841 0.211
NP_441057.1_4 Forward -275 -257 -0.275845 0.26
NP_442489.1_7 Reverse -389 -398 -1.57357 0.213
NP_442489.1_7 Forward -398 -389 -1.6719 0.235
NP_442489.1_7 Reverse -367 -376 -1.6719 0.235
NP_442489.1_7 Forward -376 -367 -1.96689 0.28
NP_440559.1_1 Reverse -336 -345 4.52295 0.26
NP_441659.2_8 Forward -376 -366 5.19158 0.113
NP_441659.2_8 Reverse -389 -399 4.40493 0.136
NP_441659.2_8 Reverse -276 -286 1.84832 0.224
NP_442849.1_1 Forward -262 -248 10.816 0.203
NP_439956.1_7 Reverse -349 -368 15.5357 0.14
NP_439956.1_7 Forward -291 -272 1.0811 0.292
NP_441800.1_3 Forward -375 -357 5.72234 0.286
NP_442776.1_1 Forward -375 -356 11.3075 0.159
NP_442346.1_5 Reverse -366 -376 13.943 0.0183
NP_442346.1_5 Forward -345 -335 13.1564 0.029
NP_442346.1_5 Forward -399 -389 6.8632 0.188
NP_442346.1_5 Reverse -388 -398 4.89658 0.269
NP_440545.1_3 Reverse -363 -380 1.61214 0.116
NP_441629.1_1 Forward -352 -333 14.8474 0.147
NP_442603.1_7 Reverse -345 -359 11.4053 0.117
NP_442603.1_7 Forward -218 -204 5.80051 0.273
NP_441888.1_7 Forward -381 -367 1.57289 0.245
NP_439970.1_3 Forward -343 -324 10.5209 0.126
NP_440671.1_4 Forward -382 -368 7.57108 0.214
NP_440671.1_4 Reverse -270 -284 5.50613 0.281
NP_440204.1_4 Reverse -312 -331 4.22769 0.209
NP_442140.1_3 Forward -343 -333 7.55152 0.135
NP_442021.1_3 Reverse -361 -380 -3.24547 0.251
NP_440875.1_9 Forward -346 -336 7.69067 0.255
NP_442547.1_7 Reverse -357 -376 10.6116 0.277
NP_441813.1_5 Reverse -274 -284 2.92996 0.181
NP_440590.1_4 Forward -284 -271 -3.91395 0.256
NP_442497.1_10 Forward -375 -366 0.196389 0.208
NP_441239.1_9 Reverse -387 -399 5.74217 0.21
NP_441239.1_9 Forward -378 -366 5.64384 0.213
NP_441239.1_9 Reverse -365 -377 4.26721 0.256
NP_441892.1_1 Reverse -358 -375 4.3654 0.111
NP_441892.1_1 Forward -385 -368 -5.86102 0.29
NP_442399.1_3 Forward -396 -377 16.9959 0.136
NP_442270.1_9 Reverse -362 -381 -11.7019 0.277
NP_441541.1_1 Forward -36 -18 -3.43572 0.264
NP_442052.1_8 Reverse -365 -375 15.3197 0.253
NP_440546.1_4 Forward -344 -334 9.85209 0.118
NP_440546.1_4 Forward -398 -388 8.78555 0.171
NP_440546.1_4 Reverse -389 -399 8.00989 0.209
NP_441656.1_6 Reverse -348 -367 19.0757 0.0732
NP_440462.1_6 Reverse -274 -284 4.10993 0.216
NP_442402.1_4 Reverse -244 -263 -4.03287 0.22
NP_442402.1_10 Reverse -141 -151 10.9926 0.272
NP_441848.1_4 Forward -97 -81 7.74165 0.288
NP_441084.1_6 Forward -400 -386 16.1311 0.0704
NP_441084.1_6 Forward -346 -332 10.1198 0.254
NP_440653.1_10 Forward -375 -356 7.07928 0.203
NP_440843.1_8 Reverse -361 -380 12.6841 0.297
NP_442039.1_7 Forward -263 -253 7.45319 0.276
NP_440825.1_6 Reverse -101 -120 7.17762 0.287
NP_440160.1_2 Forward -382 -363 -9.047 0.293
NP_440160.1_2 Reverse -269 -288 -9.34199 0.293
NP_440505.1_3 Forward -287 -277 6.17489 0.192
NP_441959.1_8 Forward -46 -33 8.61288 0.286
NP_441408.2_7 Forward -378 -359 4.12936 0.191
NP_442174.1_9 Reverse -365 -384 6.68596 0.285
NP_440914.1_1 Reverse -276 -286 12.8115 0.0461
NP_442533.1_6 Reverse -389 -398 13.5694 0.021
NP_442533.1_6 Forward -398 -389 6.78456 0.103
NP_442533.1_6 Reverse -367 -376 5.60459 0.137
NP_442533.1_6 Reverse -276 -285 4.22796 0.186
NP_440854.1_1 Forward -127 -108 9.97848 0.152
NP_441482.1_7 Reverse -270 -284 -3.24533 0.115
NP_441482.1_7 Forward -382 -368 -4.13031 0.147
NP_441482.1_7 Reverse -361 -375 -9.04686 0.193
NP_439944.1_9 Reverse -374 -384 7.74818 0.131
NP_442203.1_3 Forward -304 -285 8.04414 0.257
NP_441697.1_5 Reverse -101 -120 -9.50187 0.268
NP_441028.1_6 Reverse -384 -394 6.86274 0.23
NP_442202.1_6 Reverse -228 -247 6.68596 0.265
NP_440116.1_8 Reverse -336 -355 -5.50708 0.194
NP_440007.1_9 Reverse -272 -286 20.5508 0.0702
NP_440007.1_9 Forward -140 -126 1.67122 0.285
NP_441544.1_4 Reverse -275 -294 21.4356 0.0827
NP_441972.1_5 Reverse -356 -375 -7.08038 0.241
NP_439903.1_6 Forward -379 -360 22.3197 0.0372
NP_441286.1_1 Reverse -388 -400 -5.46756 0.203
NP_441286.1_1 Forward -286 -274 -6.05754 0.245
NP_442674.1_2 Reverse -183 -202 8.94757 0.236
NP_440670.1_8 Forward -285 -276 5.11294 0.171
NP_440670.1_8 Reverse -276 -285 4.12963 0.204
NP_439940.1_1 Forward -74 -55 31.957 0.00000438
NP_442264.1_5 Forward -376 -362 16.1259 0.222
NP_441021.1_1 Forward -381 -362 -7.67036 0.187
NP_440841.1_4 Forward -400 -381 -6.68705 0.215
NP_441463.1_3 Reverse -163 -182 -2.55715 0.156
NP_441463.1_6 Forward -378 -364 8.44524 0.25
NP_442794.1_1 Reverse -363 -375 7.4138 0.138
NP_442615.1_1 Reverse -380 -398 -6.1757 0.237
NP_442467.1_3 Forward -290 -276 16.937 0.257
NP_441431.1_1 Reverse -31 -49 5.06306 0.245
NP_441431.1_2 Forward -379 -365 6.58715 0.266
NP_441065.1_2 Reverse -285 -304 11.2316 0.238
NP_441993.1_1 Forward -354 -335 3.89583 0.227
NP_441993.1_1 Reverse -361 -380 2.23906 0.261
NP_440467.1_3 Reverse -356 -375 12.1352 0.252
NP_441425.1_2 Reverse -307 -326 11.982 0.269
NP_442698.1_10 Forward -395 -376 3.53937 0.279
NP_442323.1_7 Forward -381 -362 4.52188 0.216
NP_441720.1_2 Forward -284 -265 3.83357 0.236
NP_440293.1_3 Reverse -359 -378 9.53756 0.184
NP_440766.1_5 Forward -394 -382 14.5312 0.197
NP_441237.1_9 Forward -375 -365 14.0414 0.0535
NP_442743.1_5 Forward -381 -362 3.34271 0.273
NP_440643.1_6 Forward -381 -362 11.8975 0.107
NP_439910.1_2 Reverse -331 -348 -22.0856 0.207
NP_439910.1_2 Forward -226 -209 -22.2823 0.22
NP_440457.1_1 Forward -348 -336 -0.452677 0.263
NP_442297.1_3 Reverse -353 -372 10.0284 0.238
NP_442582.1_3 Forward -127 -113 15.0039 0.208
NP_441885.1_5 Reverse -276 -286 -0.314959 0.195
NP_441885.1_5 Forward -398 -388 -0.314959 0.195
NP_442341.1_9 Forward -287 -273 7.07881 0.204
NP_441173.1_9 Reverse -143 -151 14.3753 0.161
NP_441173.1_9 Reverse -385 -393 12.1137 0.21
NP_441173.1_9 Reverse -144 -152 10.2454 0.261
NP_440686.1_9 Forward -236 -222 19.4691 0.284
NP_440191.1_6 Reverse -31 -45 13.1895 0.294
NP_443000.1_7 Reverse -207 -217 4.89658 0.158
NP_440275.1_3 Forward -287 -277 2.92996 0.242
NP_440091.1_1 Forward -222 -210 2.0056 0.197
NP_440091.1_1 Reverse -331 -343 1.31728 0.198
NP_441397.1_8 Forward -395 -382 12.1892 0.269
NP_442451.1_2 Reverse -327 -346 -10.9153 0.28
NP_442451.1_7 Forward -51 -32 12.9791 0.113
NP_440149.1_8 Reverse -345 -364 -3.83545 0.198
NP_441105.1_3 Forward -387 -368 2.16274 0.107
NP_441105.1_3 Reverse -356 -375 -9.34199 0.288
NP_440172.1_1 Reverse -367 -377 13.8447 0.0175
NP_442329.1_8 Reverse -355 -374 11.6025 0.17
NP_441226.1_7 Reverse -277 -284 8.59356 0.197
NP_440416.1_9 Reverse -344 -363 -9.73531 0.134
NP_443052.1_9 Reverse -246 -265 -0.000545616 0.203
NP_443052.1_9 Reverse -249 -268 -0.885524 0.218
NP_443052.1_9 Reverse -344 -363 -4.52377 0.258
NP_442116.1_6 Reverse -30 -47 7.50051 0.254
NP_442154.1_1 Forward -273 -255 -17.6804 0.262
NP_440988.1_9 Reverse -337 -356 16.0265 0.146
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGGCCATGGGCAAAAATAACCAAAGCCATTGCCCAGGCCACTGATGGAGATGACGAGCGATGGTTAGTCCCGCAACATAAATACCTAGGTTTAAACCTAAAATAACTAATTTCTTGGGATCGGCTTGGAATGCTTCCGGTGGCAAAAGAGGACGGAGTTTTTTAACGTATTCAGATTGAGCAGTGAGCACCAGGAATAATCCCTAAAAGTTAAACAAAGCAATTTCAGTGTAAATGATTTTACCTGTTTTGGGAAAATTCCGAGCTGATGCAAAGTGTTAAGAAAATCTTAACTGCTTCCTTTGGTATATGAAAATAGTCAAATCTATAGTCATTTCAATTAACGATGAGAGAATTTAATGTAAAATTATGGAGTGTACAAAATGAACAGGTTTAAACA

CDS

ATGGCTTACAGTTTAGATTTAAGGCAAAGGGTAGTAGCTTATATAGAAGCTGGAGGAAAAATAACTGAGGCTTCCAAGATATATAAAATAGGAAAAGCCTCGATATACAGATGGTTAAATAGAGTAGATTTAAGCCCAACAAAAGTAGAGCGTCGCCATAGGAAATTAGACTGGGAAGCTCTAAAAAAAGACGTAGAAGAAAATCCCGATGCAAGATTGATAGACAGAGCCAAGAAATTTGGAGTGAGGCCGAGTGCCGTATATTACGCATTAAAGAAAATGAAAATAAACAGAAAAAAAAAGAACTACGTTATCGAGAAAGAAACCGGGAGGAACGAGTTAAGTACTATAGAATGTTAA

Protein

MAYSLDLRQRVVAYIEAGGKITEASKIYKIGKASIYRWLNRVDLSPTKVERRHRKLDWEALKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKNYVIEKETGRNELSTIEC