Your browser is old and dusty. Try Google Chrome!

Details for slr1686

ORF slr1686
Accession NP_441696.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -88 -74 10.9143 0.0562
NP_441061.1_2 Forward -119 -105 7.47274 0.102
NP_441061.1_2 Reverse -81 -95 -0.393733 0.228
NP_441061.1_2 Reverse -376 -390 -2.45868 0.293
NP_440557.1_1 Forward -255 -236 -2.0655 0.282
NP_440795.1_7 Forward -88 -81 14.6904 0.0123
NP_440795.1_7 Reverse -81 -88 14.6904 0.0123
NP_440795.1_7 Forward -383 -376 10.2655 0.154
NP_440795.1_7 Forward -148 -141 7.80726 0.232
NP_441418.1_6 Reverse -80 -99 -11.9969 0.0586
NP_441418.1_6 Reverse -375 -394 -20.4534 0.114
NP_442657.1_5 Reverse -124 -138 17.9617 0.175
NP_441343.1_3 Reverse -358 -377 10.8159 0.276
NP_442272.1_2 Reverse -298 -317 10.1695 0.258
NP_441453.1_1 Forward -96 -78 11.2281 0.118
NP_441453.1_4 Reverse -80 -88 16.539 0.00633
NP_441453.1_4 Forward -89 -81 16.539 0.00633
NP_441453.1_4 Reverse -353 -361 4.24765 0.259
NP_441453.1_4 Forward -296 -288 4.24765 0.259
NP_441453.1_4 Reverse -375 -383 4.05099 0.268
NP_441623.1_1 Reverse -142 -160 -5.19239 0.284
NP_442151.1_6 Reverse -80 -94 18.2892 0.00782
NP_442151.1_6 Forward -384 -370 17.5025 0.00997
NP_442151.1_6 Forward -89 -75 12.4876 0.0722
NP_442151.1_6 Forward -362 -348 10.0294 0.133
NP_443043.1_8 Forward -160 -141 14.3558 0.163
NP_440561.1_1 Forward -395 -376 13.2733 0.249
NP_440561.1_6 Forward -94 -75 15.0441 0.284
NP_441818.1_1 Reverse -81 -92 11.4645 0.177
NP_441818.1_9 Reverse -308 -327 0.491109 0.191
NP_440226.1_1 Reverse -80 -99 4.62101 0.184
NP_441630.1_3 Reverse -72 -91 7.57094 0.122
NP_442655.1_10 Reverse -62 -81 -2.45882 0.19
NP_442173.1_1 Forward -88 -80 15.4574 0.00633
NP_442173.1_1 Reverse -81 -89 15.4574 0.00633
NP_442752.1_4 Forward -89 -82 13.8055 0.0199
NP_442752.1_4 Reverse -80 -87 13.8055 0.0199
NP_443027.1_4 Reverse -78 -88 15.3197 0.0437
NP_443027.1_4 Forward -374 -364 7.74818 0.235
NP_443027.1_4 Forward -91 -81 6.46988 0.275
NP_441812.1_3 Forward -90 -76 6.88276 0.287
NP_442975.1_10 Forward -93 -79 11.602 0.0497
NP_442975.1_10 Reverse -76 -90 2.5556 0.273
NP_440784.1_7 Forward -88 -81 15.9687 0.0123
NP_440784.1_7 Reverse -81 -88 15.9687 0.0123
NP_440784.1_7 Reverse -158 -165 10.2655 0.0801
NP_442909.1_7 Forward -88 -74 11.2087 0.131
NP_441250.1_3 Forward -242 -223 2.75272 0.267
NP_440061.1_9 Reverse -78 -92 10.2254 0.126
NP_441054.1_2 Reverse -141 -160 10.4225 0.284
NP_442062.1_8 Reverse -80 -90 17.6796 0.00193
NP_442062.1_8 Forward -89 -79 10.3048 0.0493
NP_442062.1_8 Reverse -375 -385 5.87989 0.149
NP_440761.1_4 Reverse -75 -94 -13.2752 0.257
NP_441900.1_2 Forward -87 -69 -0.964891 0.27
NP_441859.1_3 Reverse -79 -98 10.1267 0.121
NP_440304.1_4 Reverse -78 -88 18.9579 0.00406
NP_440304.1_4 Forward -91 -81 17.9746 0.00654
NP_440304.1_4 Forward -168 -158 6.27322 0.167
NP_442242.1_4 Forward -88 -81 14.3954 0.0124
NP_442242.1_4 Reverse -81 -88 14.3954 0.0124
NP_440044.1_9 Reverse -74 -93 12.29 0.183
NP_441208.1_9 Forward -92 -78 10.0294 0.196
NP_441208.1_9 Reverse -77 -91 8.84938 0.219
NP_441594.1_6 Reverse -71 -90 4.62101 0.216
NP_441594.1_6 Forward -92 -73 -0.000545616 0.294
NP_442196.1_10 Reverse -78 -97 11.2092 0.225
NP_442110.1_7 Forward -89 -75 8.94771 0.0795
NP_440856.1_4 Reverse -73 -92 1.86774 0.157
NP_441083.1_3 Forward -385 -375 15.2208 0.138
NP_441083.1_5 Reverse -80 -90 19.3512 0.000718
NP_441083.1_5 Forward -89 -79 11.2881 0.0159
NP_441083.1_5 Forward -362 -352 -0.511621 0.269
NP_442827.1_8 Reverse -72 -91 16.0265 0.032
NP_442827.1_8 Forward -97 -78 11.7983 0.05
NP_441738.1_2 Forward -87 -80 15.28 0.0102
NP_441738.1_2 Reverse -82 -89 15.28 0.0102
NP_441558.1_5 Reverse -78 -97 12.5858 0.0675
NP_441558.1_5 Forward -168 -149 8.35759 0.153
NP_441558.1_5 Forward -91 -72 5.40766 0.251
NP_441942.1_6 Reverse -73 -92 15.4476 0.235
NP_440209.1_1 Reverse -80 -88 18.1123 0.00295
NP_440209.1_1 Forward -89 -81 18.1123 0.00295
NP_442889.1_1 Forward -337 -318 -13.4719 0.26
NP_440447.1_6 Forward -97 -79 18.3087 0.0347
NP_441713.1_1 Forward -95 -76 -2.65548 0.113
NP_441770.1_5 Reverse -72 -91 1.27776 0.238
NP_440178.1_7 Forward -90 -71 -2.55715 0.038
NP_440659.1_7 Reverse -115 -134 9.24257 0.243
NP_440538.1_10 Forward -364 -345 11.5042 0.253
NP_441716.1_1 Reverse -80 -94 10.7177 0.0936
NP_441327.1_3 Reverse -229 -248 14.4533 0.202
NP_442111.1_4 Reverse -79 -93 18.3875 0.00707
NP_442111.1_4 Forward -90 -76 8.16106 0.0794
NP_441163.1_1 Reverse -316 -333 5.93797 0.267
NP_440343.1_6 Forward -338 -319 9.73422 0.294
NP_440906.1_5 Forward -88 -81 15.8704 0.0124
NP_440906.1_5 Reverse -81 -88 15.8704 0.0124
NP_440012.1_10 Reverse -69 -88 16.5182 0.279
NP_440747.1_10 Reverse -77 -89 -1.92764 0.0192
NP_440747.1_10 Forward -92 -80 -2.02597 0.0196
NP_440747.1_10 Forward -169 -157 -11.7607 0.142
NP_441130.1_8 Forward -91 -72 19.3707 0.0719
NP_441130.1_10 Forward -91 -77 15.8309 0.0282
NP_441486.1_1 Reverse -350 -364 3.53951 0.0575
NP_441486.1_1 Reverse -372 -386 -0.000409212 0.147
NP_441486.1_1 Forward -299 -285 -1.5737 0.173
NP_441486.1_1 Reverse -154 -168 -1.67204 0.174
NP_441486.1_1 Reverse -77 -91 -2.85201 0.175
NP_441486.1_1 Reverse -284 -298 -5.11362 0.222
NP_441486.1_1 Forward -123 -109 -5.80194 0.26
NP_441486.1_1 Forward -365 -351 -6.19526 0.283
NP_442634.1_4 Forward -91 -77 12.3893 0.0401
NP_442634.1_4 Reverse -78 -92 4.22782 0.0819
NP_441265.1_3 Forward -95 -81 14.1593 0.059
NP_440842.1_10 Reverse -137 -151 3.53951 0.255
NP_441014.1_10 Reverse -156 -175 0.490334 0.243
NP_442848.1_1 Reverse -74 -88 -2.95034 0.263
NP_442848.1_5 Reverse -368 -386 1.10079 0.276
NP_442848.1_9 Reverse -134 -153 -0.197208 0.278
NP_441012.1_4 Reverse -377 -390 7.29578 0.272
NP_441012.1_4 Reverse -159 -172 7.19745 0.272
NP_443018.1_3 Forward -88 -81 14.8871 0.0123
NP_443018.1_3 Reverse -81 -88 14.8871 0.0123
NP_443018.1_3 Forward -361 -354 12.5271 0.0523
NP_443018.1_3 Reverse -354 -361 12.5271 0.0523
NP_443018.1_3 Reverse -288 -295 11.5438 0.0752
NP_443018.1_3 Forward -383 -376 4.36568 0.254
NP_443018.1_3 Forward -165 -158 4.26735 0.267
NP_443018.1_3 Reverse -158 -165 4.16902 0.278
NP_443018.1_3 Reverse -376 -383 4.07068 0.299
NP_441316.1_7 Forward -91 -76 14.3362 0.0486
NP_441634.1_8 Forward -91 -77 -3.54032 0.295
NP_440376.1_1 Forward -89 -80 19.4693 0.000692
NP_440376.1_1 Reverse -80 -89 19.4693 0.000692
NP_440376.1_1 Forward -331 -322 4.81794 0.149
NP_441588.1_4 Reverse -289 -299 8.1415 0.154
NP_441588.1_4 Forward -382 -372 7.74818 0.17
NP_442687.1_7 Forward -90 -80 18.5646 0.0028
NP_442687.1_7 Reverse -79 -89 9.02648 0.0994
NP_442687.1_7 Reverse -321 -331 4.60159 0.243
NP_441077.1_6 Reverse -301 -317 10.0324 0.164
NP_442485.1_3 Reverse -373 -392 -3.63879 0.277
NP_442485.1_3 Forward -395 -376 -3.83545 0.277
NP_442958.1_3 Reverse -69 -88 -0.787193 0.268
NP_441013.1_2 Forward -177 -159 0.904127 0.254
NP_441422.1_7 Forward -91 -74 2.30045 0.113
NP_440667.1_2 Forward -166 -147 -8.35868 0.289
NP_440360.1_10 Forward -87 -73 17.0108 0.0856
NP_442658.1_1 Forward -91 -81 17.6791 0.00565
NP_442658.1_1 Reverse -78 -88 15.9091 0.00966
NP_442198.1_7 Reverse -77 -96 16.5182 0.139
NP_440141.1_8 Forward -218 -199 4.22769 0.292
NP_440528.1_1 Forward -227 -214 21.5912 0.039
NP_442782.1_2 Forward -160 -146 1.08123 0.282
NP_442205.1_9 Reverse -74 -90 18.0531 0.0219
NP_441414.1_9 Reverse -80 -99 -4.22878 0.15
NP_441487.1_6 Reverse -72 -91 -1.18052 0.283
NP_442937.1_5 Forward -239 -220 7.37428 0.254
NP_442937.1_5 Forward -94 -75 6.68596 0.272
NP_442937.1_5 Reverse -152 -171 6.19431 0.286
NP_442321.1_4 Reverse -313 -332 -9.14533 0.293
NP_441958.1_5 Reverse -79 -89 21.2195 0.000805
NP_441958.1_5 Forward -90 -80 20.5312 0.000966
NP_440203.1_5 Forward -86 -76 9.51767 0.254
NP_439905.1_1 Forward -88 -75 19.0955 0.0201
NP_439905.1_1 Forward -361 -348 8.67241 0.232
NP_440984.1_7 Reverse -75 -89 12.9793 0.121
NP_440984.1_7 Reverse -348 -362 7.27608 0.178
NP_439990.1_5 Forward -94 -81 12.9006 0.105
NP_442376.1_2 Reverse -75 -94 -4.72043 0.253
NP_442911.1_2 Forward -99 -80 14.5524 0.0112
NP_442911.1_2 Forward -394 -375 6.39097 0.0289
NP_440153.1_5 Forward -88 -74 5.80112 0.191
NP_440153.1_10 Forward -148 -135 18.6038 0.145
NP_443055.1_6 Forward -398 -380 1.78836 0.224
NP_443055.1_6 Forward -89 -71 -2.53818 0.296
NP_440993.1_2 Reverse -75 -91 5.36841 0.234
NP_440993.1_2 Forward -94 -78 4.87675 0.249
NP_440993.1_3 Forward -99 -80 3.04693 0.19
NP_440993.1_3 Reverse -313 -332 1.47364 0.229
NP_440138.1_6 Forward -88 -69 2.75194 0.261
NP_441099.1_5 Forward -99 -80 8.06259 0.04
NP_441099.1_5 Reverse -312 -331 -9.34199 0.219
NP_442002.1_9 Forward -90 -83 14.1004 0.074
NP_441294.1_7 Reverse -290 -304 8.48272 0.298
NP_441646.1_1 Forward -96 -77 12.4875 0.0931
NP_442438.1_10 Forward -389 -375 5.40779 0.134
NP_442438.1_10 Reverse -75 -89 4.62115 0.144
NP_442431.1_10 Reverse -305 -323 0.0191479 0.284
NP_441000.1_6 Forward -90 -76 -4.7203 0.251
NP_442771.1_1 Reverse -78 -96 2.47742 0.0703
NP_442771.1_1 Forward -91 -73 -4.30741 0.166
NP_441674.1_6 Reverse -370 -389 4.03102 0.261
NP_440147.1_4 Reverse -78 -91 13.3923 0.0326
NP_440147.1_4 Forward -91 -78 12.8023 0.0326
NP_441550.1_8 Forward -91 -81 19.8424 0.00352
NP_441550.1_8 Reverse -78 -88 17.4824 0.00754
NP_441916.1_7 Forward -89 -79 18.9579 0.00144
NP_441916.1_7 Reverse -80 -90 16.893 0.00407
NP_441916.1_10 Forward -174 -155 1.17943 0.27
NP_440465.1_10 Forward -92 -73 9.43923 0.173
NP_441041.1_4 Reverse -80 -99 -10.9153 0.238
NP_441041.1_4 Forward -384 -365 -13.6686 0.293
NP_441041.1_7 Forward -92 -80 12.4708 0.0611
NP_441041.1_7 Reverse -77 -89 8.97244 0.125
NP_442004.1_6 Forward -89 -75 15.5359 0.0577
NP_441725.1_5 Reverse -81 -91 18.7612 0.0119
NP_441725.1_5 Forward -88 -78 8.92815 0.0553
NP_441725.1_5 Reverse -158 -168 -0.708283 0.267
NP_439966.1_7 Reverse -78 -88 13.8442 0.0234
NP_439966.1_7 Forward -91 -81 8.14104 0.14
NP_439966.1_9 Forward -91 -82 0.983037 0.253
NP_439966.1_9 Reverse -78 -87 0.983037 0.253
NP_442941.1_3 Forward -88 -78 10.9931 0.0116
NP_442941.1_3 Reverse -81 -91 2.43831 0.14
NP_442941.1_3 Reverse -158 -168 0.668351 0.19
NP_440289.1_2 Reverse -77 -90 5.13249 0.0636
NP_440289.1_2 Forward -92 -79 4.64084 0.0657
NP_440289.1_2 Forward -334 -321 3.06754 0.0811
NP_440260.1_8 Forward -371 -353 -3.52077 0.252
NP_440260.1_8 Reverse -148 -166 -4.99573 0.273
NP_442281.1_1 Reverse -106 -120 11.1104 0.0507
NP_442281.1_1 Reverse -75 -89 4.42388 0.195
NP_442281.1_1 Forward -171 -157 3.73557 0.221
NP_442281.1_1 Reverse -370 -384 3.44058 0.231
NP_442281.1_1 Forward -94 -80 1.5723 0.296
NP_441334.1_7 Reverse -78 -97 -9.63698 0.12
NP_441334.1_7 Forward -91 -72 -10.1286 0.12
NP_442256.1_2 Forward -91 -73 -7.749 0.215
NP_440437.1_1 Forward -95 -76 -0.39387 0.181
NP_442012.1_1 Reverse -74 -93 12.6841 0.0667
NP_441087.1_5 Reverse -315 -334 1.17865 0.267
NP_441457.1_7 Forward -91 -72 -0.000545616 0.288
NP_441644.1_6 Forward -89 -79 19.0557 0.000803
NP_441644.1_6 Reverse -80 -90 15.7125 0.0048
NP_441644.1_6 Forward -362 -352 11.2876 0.0524
NP_441644.1_6 Reverse -353 -363 10.206 0.0628
NP_441644.1_6 Forward -166 -156 3.91283 0.256
NP_441644.1_6 Forward -384 -374 3.71617 0.267
NP_442215.1_2 Forward -128 -112 0.156866 0.156
NP_442215.1_2 Forward -386 -370 -4.46469 0.233
NP_442215.1_2 Reverse -373 -389 -5.74299 0.256
NP_442215.1_2 Reverse -102 -118 -7.51295 0.297
NP_442177.1_5 Forward -381 -367 8.65272 0.276
NP_442029.1_6 Reverse -152 -171 4.03102 0.274
NP_440253.1_2 Reverse -80 -98 4.14905 0.106
NP_440253.1_2 Reverse -381 -399 0.412472 0.188
NP_440929.1_8 Forward -89 -80 19.2726 0.000701
NP_440929.1_8 Reverse -80 -89 19.2726 0.000701
NP_440929.1_8 Forward -166 -157 6.39124 0.0992
NP_442933.1_10 Forward -89 -80 17.601 0.00325
NP_442933.1_10 Reverse -80 -89 17.601 0.00325
NP_442933.1_10 Forward -166 -157 3.83464 0.283
NP_441751.2_8 Forward -88 -74 12.586 0.0191
NP_441751.2_8 Reverse -81 -95 -5.21195 0.199
NP_442554.1_8 Forward -88 -78 19.1546 0.00369
NP_442554.1_8 Reverse -81 -91 16.9913 0.0065
NP_442554.1_8 Forward -361 -351 13.1564 0.0193
NP_442554.1_8 Reverse -158 -168 5.38824 0.15
NP_442554.1_8 Forward -383 -373 4.79825 0.173
NP_442554.1_8 Forward -330 -320 3.71661 0.215
NP_442554.1_8 Reverse -354 -364 3.61828 0.218
NP_441762.1_7 Forward -90 -78 11.1504 0.0142
NP_441762.1_7 Reverse -79 -91 2.69391 0.0676
NP_442142.1_4 Forward -92 -79 4.54195 0.217
NP_442142.1_4 Forward -365 -352 4.14862 0.231
NP_442142.1_4 Reverse -284 -297 3.7553 0.246
NP_442292.1_1 Forward -88 -79 17.5026 0.00435
NP_442292.1_1 Reverse -81 -90 9.53783 0.0183
NP_442292.1_1 Reverse -158 -167 6.09625 0.116
NP_442292.1_1 Forward -361 -352 5.80125 0.129
NP_442292.1_1 Forward -383 -374 -0.68859 0.268
NP_442292.1_5 Reverse -76 -95 -0.197208 0.257
NP_442476.1_6 Forward -88 -74 6.19444 0.13
NP_443009.1_5 Reverse -79 -90 17.0694 0.00659
NP_443009.1_5 Forward -90 -79 16.7744 0.00677
NP_443009.1_5 Reverse -374 -385 5.76138 0.189
NP_441715.1_4 Forward -88 -78 7.25653 0.108
NP_440357.1_3 Forward -91 -72 7.96426 0.206
NP_441448.1_1 Reverse -379 -398 5.11266 0.266
NP_441198.1_8 Reverse -78 -88 15.4199 0.0427
NP_441198.1_8 Forward -91 -81 15.2245 0.0427
NP_441468.1_1 Forward -88 -81 15.8704 0.0124
NP_441468.1_1 Reverse -81 -88 15.8704 0.0124
NP_441468.1_1 Forward -165 -158 10.2655 0.0906
NP_441468.1_1 Forward -383 -376 4.46401 0.224
NP_441468.1_1 Reverse -288 -295 4.07068 0.263
NP_441468.1_1 Reverse -354 -361 3.97235 0.277
NP_441468.1_1 Forward -361 -354 3.97235 0.277
NP_441020.2_6 Reverse -78 -95 14.1002 0.0613
NP_441015.1_10 Reverse -75 -94 3.73603 0.133
NP_441015.1_10 Reverse -348 -367 -2.26216 0.178
NP_441015.1_10 Forward -383 -364 -9.44032 0.282
NP_441673.1_1 Forward -89 -80 20.8459 0.000698
NP_441673.1_1 Reverse -80 -89 20.8459 0.000698
NP_441826.1_2 Reverse -369 -383 -2.45868 0.271
NP_441826.1_2 Forward -95 -81 -3.24533 0.284
NP_441826.1_2 Reverse -74 -88 -4.03198 0.291
NP_442868.1_6 Forward -91 -81 16.7946 0.0131
NP_442868.1_6 Reverse -78 -88 8.63316 0.0555
NP_442868.1_6 Reverse -373 -383 0.766681 0.209
NP_442719.1_3 Forward -159 -146 15.555 0.292
NP_441251.1_7 Forward -249 -236 10.1474 0.294
NP_442808.1_1 Reverse -79 -89 8.73102 0.0481
NP_442808.1_1 Forward -90 -80 8.73102 0.0481
NP_440145.1_3 Forward -99 -80 2.16274 0.12
NP_440145.1_3 Reverse -312 -331 -3.54046 0.202
NP_440145.1_3 Forward -176 -157 -4.22878 0.226
NP_440145.1_3 Forward -372 -353 -5.31042 0.264
NP_442542.1_2 Forward -91 -78 4.64084 0.299
NP_442050.1_5 Reverse -78 -88 17.1874 0.00812
NP_442050.1_5 Forward -91 -81 14.9258 0.0175
NP_442342.1_9 Reverse -78 -94 9.39998 0.162
NP_442342.1_9 Forward -91 -75 4.18844 0.251
NP_442342.1_9 Forward -333 -317 2.22182 0.29
NP_441114.1_3 Reverse -370 -379 7.66954 0.231
NP_440558.1_2 Forward -365 -346 -0.787193 0.204
NP_440558.1_2 Reverse -319 -338 -3.54046 0.236
NP_440558.1_2 Forward -92 -73 -4.03212 0.241
NP_440558.1_2 Reverse -274 -293 -4.52377 0.246
NP_440558.1_2 Reverse -107 -126 -6.29373 0.273
NP_442789.1_4 Forward -383 -364 -7.37537 0.295
NP_442789.1_4 Forward -91 -72 -7.86702 0.299
NP_441518.1_3 Forward -176 -157 -15.1435 0.287
NP_441878.1_6 Forward -90 -80 20.2362 0.0046
NP_441878.1_6 Reverse -79 -89 10.5014 0.0176
NP_441878.1_6 Forward -332 -322 2.53664 0.0363
NP_441878.1_6 Forward -167 -157 0.963343 0.128
NP_441878.1_6 Reverse -352 -362 0.668351 0.139
NP_441878.1_6 Forward -363 -353 0.57002 0.14
NP_441878.1_6 Reverse -321 -331 -0.0199663 0.163
NP_441878.1_6 Forward -150 -140 -6.70647 0.194
NP_441878.1_6 Forward -385 -375 -7.29646 0.217
NP_441036.1_8 Reverse -79 -89 15.713 0.00724
NP_441036.1_8 Forward -90 -80 8.4365 0.174
NP_441036.1_8 Forward -385 -375 5.5849 0.271
NP_441557.1_5 Forward -89 -80 19.9609 0.000699
NP_441557.1_5 Reverse -80 -89 19.9609 0.000699
NP_441557.1_5 Forward -384 -375 -1.77023 0.299
NP_441557.1_8 Reverse -323 -333 11.8776 0.236
NP_441445.1_1 Reverse -344 -363 10.8159 0.0928
NP_441445.1_1 Reverse -71 -90 1.17943 0.259
NP_442066.2_4 Forward -89 -70 1.37609 0.151
NP_442066.2_9 Reverse -76 -89 12.409 0.154
NP_441308.1_8 Reverse -78 -88 12.4681 0.218
NP_441458.1_10 Forward -365 -346 3.34271 0.251
NP_442183.1_1 Forward -89 -75 16.9125 0.0129
NP_442183.1_1 Reverse -80 -94 10.816 0.0784
NP_442183.1_8 Forward -289 -272 15.7718 0.263
NP_441116.1_9 Reverse -64 -78 13.3726 0.236
NP_441819.1_7 Reverse -234 -253 16.6165 0.26
NP_441574.1_1 Forward -101 -82 2.94938 0.151
NP_441549.1_9 Forward -93 -75 -2.14413 0.19
NP_441549.1_9 Reverse -76 -94 -6.86402 0.206
NP_442170.1_5 Forward -89 -70 -3.14714 0.267
NP_442347.1_2 Forward -88 -79 3.34298 0.284
NP_442347.1_2 Reverse -81 -90 3.34298 0.284
NP_442347.1_8 Reverse -138 -157 6.78429 0.187
NP_442645.1_2 Forward -370 -351 -5.40875 0.0679
NP_442965.1_2 Forward -39 -20 -8.752 0.294
NP_442888.1_5 Reverse -219 -238 18.289 0.0684
NP_441037.1_4 Forward -91 -81 18.9151 0.00351
NP_441037.1_4 Reverse -78 -88 16.5761 0.0168
NP_442317.1_6 Forward -94 -75 7.96426 0.217
NP_441633.1_3 Reverse -78 -91 6.01747 0.0481
NP_441633.1_3 Forward -91 -78 -3.52063 0.177
NP_440136.1_2 Forward -88 -81 15.9687 0.0123
NP_440136.1_2 Reverse -81 -88 15.9687 0.0123
NP_442590.1_10 Forward -126 -107 9.0459 0.2
NP_442998.1_5 Forward -161 -151 11.3864 0.187
NP_442998.1_5 Forward -62 -52 9.7148 0.236
NP_442998.1_10 Forward -87 -80 15.5754 0.0102
NP_442998.1_10 Reverse -82 -89 15.5754 0.0102
NP_440299.1_1 Forward -93 -80 18.9965 0.00298
NP_440299.1_1 Forward -147 -134 5.23026 0.184
NP_440299.1_1 Reverse -318 -331 5.13193 0.187
NP_440299.1_1 Reverse -136 -149 2.87033 0.269
NP_441799.1_1 Reverse -76 -90 10.9137 0.0648
NP_441799.1_1 Reverse -349 -363 8.25877 0.12
NP_441799.1_1 Forward -300 -286 6.19383 0.179
NP_441799.1_1 Forward -93 -79 5.70218 0.197
NP_441799.1_1 Forward -281 -267 4.03056 0.269
NP_440640.1_9 Reverse -111 -130 10.8159 0.298
NP_442802.1_6 Reverse -79 -98 2.65439 0.204
NP_441007.1_10 Reverse -75 -88 22.6354 0.00574
NP_441007.1_10 Forward -94 -81 1.88757 0.203
NP_442334.1_1 Forward -101 -82 14.7491 0.0241
NP_442334.1_2 Forward -99 -82 -14.0225 0.297
NP_442201.1_10 Forward -100 -81 1.47442 0.113
NP_440256.1_1 Reverse -372 -391 -7.86702 0.247
NP_441559.1_8 Forward -291 -277 -4.13031 0.217
NP_441559.1_8 Forward -94 -80 -5.9986 0.271
NP_440915.1_6 Forward -93 -79 23.9923 0.000827
NP_440915.1_6 Reverse -76 -90 3.73617 0.1
NP_440997.1_6 Reverse -75 -94 9.93088 0.263
NP_440717.1_1 Forward -383 -364 8.35759 0.265
NP_441866.1_6 Forward -285 -266 12.4867 0.163
NP_442866.1_1 Forward -125 -106 2.94938 0.151
NP_442866.1_1 Reverse -75 -94 -4.32711 0.226
NP_440748.1_5 Reverse -371 -390 5.211 0.195
NP_441464.1_8 Forward -89 -75 10.7177 0.178
NP_441464.1_8 Reverse -80 -94 8.94771 0.192
NP_440695.1_5 Reverse -80 -99 -1.7705 0.288
NP_441939.1_3 Forward -88 -69 11.6025 0.112
NP_441199.1_6 Reverse -76 -95 11.7008 0.0648
NP_441199.1_6 Forward -93 -74 0.491109 0.242
NP_441494.1_6 Reverse -75 -88 18.3088 0.059
NP_442993.1_1 Forward -89 -73 -3.18639 0.126
NP_442386.1_9 Forward -363 -354 12.2907 0.0676
NP_442386.1_9 Reverse -352 -361 10.324 0.132
NP_442386.1_9 Forward -90 -81 6.39082 0.219
NP_442386.1_9 Reverse -79 -88 6.39082 0.219
NP_442386.1_9 Reverse -110 -119 6.09583 0.23
NP_442386.1_9 Reverse -286 -295 5.89917 0.233
NP_441340.1_5 Forward -88 -81 15.6737 0.0124
NP_441340.1_5 Reverse -81 -88 15.6737 0.0124
NP_441340.1_5 Reverse -354 -361 4.07068 0.239
NP_441340.1_5 Reverse -158 -165 4.07068 0.239
NP_441340.1_5 Forward -361 -354 4.07068 0.239
NP_441340.1_5 Reverse -376 -383 3.97235 0.274
NP_443028.1_4 Reverse -236 -255 12.9603 0.252
NP_440168.1_8 Reverse -145 -164 2.85105 0.25
NP_440168.1_9 Forward -333 -314 -0.0988766 0.273
NP_440251.1_1 Forward -38 -19 14.0608 0.0658
NP_442714.1_7 Forward -361 -342 9.24257 0.126
NP_441160.1_5 Reverse -342 -361 -6.58872 0.288
NP_440586.1_1 Reverse -73 -92 -3.93378 0.275
NP_440586.1_8 Forward -88 -81 13.2151 0.026
NP_440586.1_8 Reverse -81 -88 13.2151 0.026
NP_440586.1_8 Reverse -288 -295 10.9535 0.119
NP_440586.1_8 Forward -361 -354 7.61025 0.227
NP_440586.1_8 Reverse -354 -361 7.61025 0.227
NP_440586.1_8 Forward -355 -348 7.1186 0.272
NP_442251.1_6 Forward -88 -81 15.2804 0.0124
NP_442251.1_6 Reverse -81 -88 15.2804 0.0124
NP_441262.1_3 Reverse -80 -87 14.7888 0.0223
NP_441262.1_3 Forward -89 -82 14.7888 0.0223
NP_443051.1_1 Reverse -79 -88 19.5676 0.00335
NP_443051.1_1 Forward -90 -81 18.0926 0.00402
NP_439937.1_8 Forward -91 -72 -0.39387 0.24
NP_439937.1_9 Forward -90 -73 -4.87838 0.157
NP_439937.1_9 Reverse -79 -96 -6.64833 0.157
NP_439937.1_9 Forward -333 -316 -11.5649 0.257
NP_439937.1_9 Reverse -276 -293 -11.7615 0.264
NP_439937.1_9 Forward -332 -315 -16.0881 0.287
NP_439937.1_9 Forward -363 -346 -17.3663 0.298
NP_441595.1_2 Forward -262 -249 10.3749 0.277
NP_441595.1_5 Forward -96 -78 15.1621 0.122
NP_440836.1_1 Forward -392 -373 9.3409 0.222
NP_440408.1_7 Forward -89 -70 8.94757 0.265
NP_440439.1_1 Reverse -77 -90 21.7504 0.00844
NP_440439.1_1 Forward -92 -79 1.10092 0.162
NP_440372.1_2 Forward -88 -81 16.3621 0.0124
NP_440372.1_2 Reverse -81 -88 16.3621 0.0124
NP_441138.1_5 Forward -306 -293 5.50481 0.272
NP_440316.1_10 Forward -98 -88 14.9263 0.175
NP_440316.1_10 Reverse -352 -362 8.4365 0.239
NP_441803.1_2 Reverse -75 -94 5.211 0.17
NP_441803.1_2 Forward -389 -370 3.73603 0.191
NP_441803.1_2 Forward -295 -276 -0.4922 0.279
NP_439977.1_5 Reverse -74 -93 9.3409 0.0937
NP_439977.1_5 Forward -95 -76 1.27776 0.195
NP_441572.1_1 Forward -380 -361 -4.32711 0.235
NP_442384.1_10 Reverse -80 -93 12.2123 0.0296
NP_442384.1_10 Forward -89 -76 9.06573 0.0574
NP_441604.1_9 Reverse -69 -88 14.3558 0.193
NP_440530.1_6 Forward -254 -240 15.5754 0.213
NP_442790.1_4 Forward -98 -79 -6.78538 0.146
NP_442262.1_10 Forward -88 -81 14.1988 0.0123
NP_442262.1_10 Reverse -81 -88 14.1988 0.0123
NP_442262.1_10 Reverse -288 -295 11.7405 0.0841
NP_442262.1_10 Forward -361 -354 10.4622 0.145
NP_442262.1_10 Reverse -354 -361 10.4622 0.145
NP_441689.1_5 Reverse -78 -88 8.43603 0.132
NP_440163.1_10 Forward -387 -377 8.63316 0.266
NP_440344.1_10 Forward -96 -79 -1.92778 0.0588
NP_440344.1_10 Forward -391 -374 -8.81095 0.134
NP_440531.1_6 Reverse -345 -364 2.26107 0.16
NP_440531.1_6 Forward -174 -155 -3.73712 0.27
NP_440531.1_6 Reverse -72 -91 -4.03212 0.273
NP_442123.1_3 Forward -89 -70 16.4207 0.0904
NP_440189.1_10 Forward -307 -288 2.85105 0.289
NP_441965.1_10 Forward -92 -76 9.59664 0.117
NP_441965.1_10 Forward -365 -349 8.71166 0.123
NP_441965.1_10 Reverse -284 -300 7.33503 0.15
NP_442529.1_4 Forward -98 -79 12.3892 0.175
NP_440297.1_9 Reverse -81 -91 9.51814 0.0917
NP_440297.1_9 Reverse -376 -386 0.471689 0.282
NP_440297.1_9 Reverse -158 -168 0.275027 0.282
NP_440297.1_9 Forward -361 -351 -0.118297 0.282
NP_440297.1_9 Forward -88 -78 -0.314959 0.282
NP_442280.1_10 Reverse -147 -165 4.67522 0.296
NP_441592.1_4 Reverse -287 -306 1.76941 0.21
NP_441896.1_3 Forward -98 -79 8.35759 0.0906
NP_441103.1_9 Forward -281 -271 16.2983 0.192
NP_440894.1_10 Forward -94 -75 9.93088 0.155
NP_443036.1_3 Reverse -318 -335 19.1151 0.14
NP_440999.1_9 Reverse -76 -90 6.6861 0.0962
NP_440999.1_9 Forward -93 -79 2.5562 0.148
NP_440999.1_9 Reverse -318 -332 -3.04867 0.283
NP_440888.1_2 Forward -89 -75 14.2569 0.0193
NP_440888.1_2 Reverse -80 -94 11.7987 0.0588
NP_440491.1_1 Forward -387 -368 7.59921 0.263
NP_442277.1_4 Reverse -71 -90 1.96529 0.262
NP_442033.1_10 Reverse -78 -97 -5.60541 0.179
NP_442033.1_10 Forward -91 -72 -7.27704 0.186
NP_442033.1_10 Reverse -275 -294 -9.53865 0.217
NP_442033.1_10 Forward -333 -314 -14.1602 0.297
NP_441543.1_2 Forward -88 -79 15.9293 0.00518
NP_441543.1_2 Reverse -81 -90 9.34117 0.0818
NP_441543.1_2 Reverse -158 -167 5.21127 0.209
NP_441543.1_2 Forward -361 -352 5.11294 0.209
NP_442845.1_2 Reverse -74 -88 17.6992 0.0608
NP_442845.1_2 Reverse -347 -361 11.996 0.119
NP_442845.1_2 Reverse -262 -276 8.25939 0.195
NP_442845.1_2 Forward -368 -354 3.24451 0.298
NP_441319.1_8 Forward -95 -77 11.5239 0.147
NP_441918.1_7 Reverse -352 -371 -3.14714 0.297
NP_441469.1_8 Forward -385 -376 13.5694 0.073
NP_441469.1_8 Forward -90 -81 13.3727 0.073
NP_441469.1_8 Reverse -79 -88 6.5879 0.227
NP_443064.1_6 Reverse -80 -90 13.8273 0.0796
NP_443064.1_6 Forward -89 -79 10.8217 0.13
NP_442337.1_8 Forward -130 -111 7.57094 0.191
NP_442337.1_8 Reverse -251 -270 0.982764 0.241
NP_442578.1_7 Forward -88 -81 14.5921 0.026
NP_442578.1_7 Reverse -81 -88 14.5921 0.026
NP_442578.1_7 Forward -289 -282 9.97054 0.112
NP_442578.1_7 Reverse -288 -295 5.15232 0.291
NP_441462.1_2 Forward -89 -79 20.2362 0.000805
NP_441462.1_2 Reverse -80 -90 20.1379 0.000967
NP_441621.1_7 Forward -91 -77 12.3893 0.0393
NP_441621.1_7 Reverse -78 -92 -2.85201 0.188
NP_443062.1_1 Reverse -157 -175 5.71821 0.22
NP_443062.1_1 Reverse -80 -98 5.42569 0.229
NP_443062.1_1 Forward -384 -366 3.37804 0.3
NP_443062.1_6 Forward -239 -220 3.04771 0.245
NP_440519.1_6 Forward -367 -353 10.7177 0.29
NP_442204.1_1 Reverse -76 -87 0.353664 0.281
NP_442204.1_5 Reverse -70 -89 10.3242 0.0912
NP_440516.1_8 Forward -89 -80 16.9127 0.00442
NP_440516.1_8 Reverse -80 -89 16.9127 0.00442
NP_440516.1_8 Reverse -353 -362 -0.590259 0.283
NP_442080.1_7 Reverse -370 -389 -2.95047 0.287
NP_441033.1_5 Forward -64 -45 17.4032 0.257
NP_442428.1_5 Forward -88 -81 15.8704 0.0124
NP_442428.1_5 Reverse -81 -88 15.8704 0.0124
NP_442428.1_5 Forward -383 -376 4.759 0.223
NP_442428.1_5 Forward -165 -158 4.66067 0.244
NP_442428.1_5 Reverse -288 -295 4.46401 0.267
NP_442428.1_5 Forward -361 -354 4.36568 0.271
NP_442428.1_5 Reverse -354 -361 4.36568 0.271
NP_440783.1_1 Forward -388 -369 29.8921 0.000428
NP_440783.1_5 Forward -337 -318 3.6377 0.156
NP_441443.1_7 Reverse -62 -81 -1.67217 0.263
NP_441790.1_3 Reverse -81 -100 -4.81876 0.291
NP_441867.1_2 Forward -219 -200 -13.9635 0.277
NP_441867.1_2 Forward -387 -368 -20.0601 0.291
NP_440673.1_2 Forward -99 -80 7.85324 0.288
NP_440673.1_3 Forward -87 -80 12.4288 0.0426
NP_440673.1_3 Reverse -82 -89 12.4288 0.0426
NP_440673.1_3 Forward -294 -287 12.3305 0.0521
NP_440718.1_2 Forward -23 -4 13.1758 0.221
NP_440865.1_9 Reverse -74 -93 11.1109 0.0497
NP_441052.1_2 Forward -362 -352 14.3364 0.0224
NP_441052.1_2 Forward -89 -79 10.4031 0.0285
NP_441052.1_2 Reverse -80 -90 10.4031 0.0285
NP_441052.1_2 Reverse -287 -297 4.20827 0.163
NP_441052.1_2 Reverse -353 -363 4.0116 0.168
NP_442219.1_8 Forward -400 -381 10.0031 0.218
NP_442219.1_8 Forward -372 -353 9.61661 0.224
NP_442219.1_9 Forward -88 -79 8.25953 0.0681
NP_442219.1_9 Reverse -81 -90 8.25953 0.0681
NP_440436.1_4 Reverse -81 -90 15.9289 0.00508
NP_440436.1_4 Forward -88 -79 9.24241 0.0871
NP_440436.1_4 Reverse -158 -167 4.81753 0.239
NP_440436.1_4 Forward -361 -352 4.7192 0.244
NP_441884.1_8 Forward -90 -71 -9.63698 0.268
NP_441884.1_9 Forward -92 -73 -14.9469 0.138
NP_441884.1_9 Reverse -77 -96 -21.6334 0.256
NP_440314.1_9 Reverse -81 -100 19.469 0.00651
NP_442907.1_2 Forward -398 -380 10.8356 0.201
NP_441719.1_4 Forward -88 -81 16.3621 0.0124
NP_441719.1_4 Reverse -81 -88 16.3621 0.0124
NP_441719.1_4 Reverse -288 -295 3.77569 0.285
NP_441719.1_6 Forward -145 -126 5.40686 0.29
NP_441733.1_10 Reverse -77 -90 7.29578 0.156
NP_441733.1_10 Forward -92 -79 7.19745 0.156
NP_440746.1_3 Reverse -78 -97 3.34271 0.239
NP_441004.1_1 Forward -337 -318 -12.0953 0.244
NP_442366.1_3 Forward -121 -103 1.88744 0.139
NP_442366.1_5 Reverse -372 -382 11.091 0.213
NP_441034.1_4 Reverse -75 -94 19.7662 0.0574
NP_441115.1_4 Reverse -79 -97 7.3932 0.286
NP_442206.1_7 Reverse -352 -371 8.94757 0.295
NP_442206.1_10 Reverse -375 -390 3.51981 0.184
NP_442854.1_6 Forward -378 -359 1.47442 0.279
NP_443054.1_2 Reverse -78 -92 0.88457 0.252
NP_443054.1_2 Forward -386 -372 -0.492064 0.295
NP_442430.1_10 Reverse -70 -89 12.585 0.228
NP_441851.1_9 Forward -123 -104 7.86593 0.279
NP_441851.1_10 Forward -90 -80 17.4829 0.0027
NP_441851.1_10 Reverse -79 -89 8.53483 0.114
NP_441851.1_10 Forward -167 -157 4.60159 0.259
NP_442208.1_5 Reverse -308 -327 -7.27704 0.27
NP_442011.1_1 Forward -90 -71 -2.16383 0.272
NP_441668.1_4 Forward -159 -140 2.94938 0.189
NP_441668.1_5 Reverse -138 -157 9.83255 0.225
NP_442515.1_1 Forward -90 -76 13.4709 0.0278
NP_442515.1_1 Reverse -79 -93 7.86607 0.0856
NP_440593.1_3 Reverse -75 -94 -4.32711 0.246
NP_440593.1_3 Reverse -370 -389 -5.40875 0.259
NP_441349.1_10 Reverse -70 -89 0.982764 0.0852
NP_440389.1_2 Forward -166 -147 11.3075 0.287
NP_440432.1_9 Reverse -81 -96 8.73135 0.0427
NP_442843.1_1 Reverse -269 -288 -3.44213 0.222
NP_442843.1_1 Forward -376 -357 -11.6036 0.291
NP_440474.1_8 Forward -88 -74 16.6169 0.0481
NP_441124.1_5 Forward -161 -151 12.7217 0.215
NP_442450.1_5 Forward -91 -81 10.1081 0.115
NP_442168.1_5 Forward -165 -146 2.0644 0.232
NP_440588.1_2 Reverse -71 -90 9.14423 0.0446
NP_442006.1_2 Reverse -268 -285 -16.9724 0.267
NP_441570.1_1 Reverse -157 -175 -9.32229 0.134
NP_441570.1_1 Forward -89 -71 -15.3205 0.229
NP_441570.1_1 Forward -166 -148 -17.6804 0.287
NP_441078.1_4 Forward -89 -80 19.6659 0.0007
NP_441078.1_4 Reverse -80 -89 19.6659 0.0007
NP_441078.1_4 Reverse -353 -362 -1.6719 0.266
NP_441078.1_4 Forward -362 -353 -1.77023 0.266
NP_441078.1_4 Forward -384 -375 -1.86856 0.272
NP_441078.1_4 Forward -331 -322 -1.86856 0.272
NP_441078.1_4 Forward -166 -157 -1.86856 0.272
NP_442729.1_5 Reverse -267 -277 12.6647 0.235
NP_442729.1_5 Reverse -352 -362 8.33817 0.248
NP_442729.1_8 Forward -93 -80 18.5055 0.0312
NP_442388.1_4 Forward -84 -65 12.4867 0.23
NP_442443.1_1 Forward -339 -320 17.6007 0.0541
NP_442443.1_1 Reverse -72 -91 5.99764 0.155
NP_440526.1_3 Reverse -81 -92 11.4645 0.0646
NP_440526.1_3 Forward -88 -77 2.31981 0.267
NP_441432.1_8 Reverse -79 -88 16.8143 0.00595
NP_441432.1_8 Forward -90 -81 8.35786 0.0755
NP_441432.1_8 Reverse -352 -361 6.19458 0.118
NP_441432.1_8 Forward -167 -158 4.71961 0.197
NP_442320.1_8 Forward -95 -81 -1.67204 0.0821
NP_441732.1_2 Forward -93 -77 -5.25134 0.0476
NP_441732.1_2 Reverse -76 -92 -6.52964 0.0495
NP_440760.1_1 Reverse -80 -99 7.27595 0.0115
NP_440760.1_1 Forward -149 -130 -14.8485 0.137
NP_440760.1_1 Forward -89 -70 -21.24 0.233
NP_440131.1_2 Reverse -362 -381 6.4893 0.279
NP_442353.1_4 Forward -368 -349 -1.08295 0.298
NP_440913.1_1 Forward -121 -103 5.42735 0.241
NP_442400.1_10 Reverse -223 -236 7.9876 0.281
NP_440713.1_3 Reverse -105 -124 1.76941 0.28
NP_440713.1_4 Reverse -70 -89 3.34271 0.246
NP_442489.1_7 Forward -89 -80 20.1576 0.000695
NP_442489.1_7 Reverse -80 -89 20.1576 0.000695
NP_442489.1_7 Forward -384 -375 -1.37691 0.195
NP_442489.1_7 Forward -331 -322 -1.37691 0.195
NP_442489.1_7 Forward -166 -157 -1.37691 0.195
NP_442489.1_7 Reverse -353 -362 -1.6719 0.235
NP_442489.1_7 Forward -362 -353 -1.77023 0.247
NP_442079.1_7 Reverse -81 -100 15.7324 0.0744
NP_440559.1_1 Reverse -81 -90 17.306 0.00658
NP_440559.1_1 Forward -88 -79 8.65285 0.0586
NP_440559.1_1 Reverse -288 -297 4.71961 0.217
NP_441659.2_8 Forward -89 -79 20.9245 0.000805
NP_441659.2_8 Reverse -80 -90 19.3512 0.000966
NP_441659.2_8 Reverse -375 -385 3.61828 0.154
NP_441659.2_8 Reverse -140 -150 1.25834 0.245
NP_441022.1_1 Forward -350 -341 15.0954 0.183
NP_441022.1_1 Reverse -340 -349 12.4095 0.232
NP_442913.1_10 Forward -98 -79 7.17762 0.056
NP_442776.1_6 Forward -32 -13 15.8307 0.11
NP_442346.1_5 Forward -90 -80 17.9746 0.00128
NP_442346.1_5 Reverse -79 -89 16.303 0.00248
NP_442346.1_5 Forward -363 -353 10.8948 0.0813
NP_442346.1_5 Reverse -374 -384 10.4031 0.0967
NP_442346.1_5 Reverse -352 -362 6.27322 0.208
NP_442346.1_5 Forward -167 -157 5.09324 0.262
NP_440545.1_3 Forward -93 -76 18.3284 0.0103
NP_440545.1_3 Reverse -76 -93 11.6419 0.0247
NP_440545.1_3 Reverse -371 -388 5.25038 0.0631
NP_440545.1_3 Reverse -136 -153 0.92382 0.129
NP_440545.1_3 Reverse -318 -335 -5.66436 0.256
NP_440831.1_3 Reverse -71 -90 6.67837 0.271
NP_441629.1_3 Reverse -368 -387 2.35861 0.218
NP_440555.1_1 Forward -373 -354 0.196116 0.299
NP_441923.1_6 Reverse -376 -390 14.4542 0.179
NP_440486.1_6 Forward -369 -350 16.5191 0.207
NP_441653.1_2 Forward -100 -81 4.10942 0.261
NP_441653.1_3 Reverse -152 -166 13.9626 0.265
NP_442551.1_4 Forward -364 -349 -2.8717 0.276
NP_442603.1_7 Reverse -80 -94 18.5835 0.0131
NP_442603.1_7 Reverse -281 -295 8.25877 0.178
NP_440449.1_6 Reverse -72 -90 16.9122 0.0726
NP_440449.1_6 Forward -97 -79 7.67226 0.214
NP_441833.1_4 Forward -88 -81 15.9687 0.0124
NP_441833.1_4 Reverse -81 -88 15.9687 0.0124
NP_442162.1_9 Forward -88 -81 16.2637 0.0124
NP_442162.1_9 Reverse -81 -88 16.2637 0.0124
NP_440671.1_4 Forward -390 -376 8.16106 0.202
NP_440671.1_4 Reverse -105 -119 7.66941 0.21
NP_440671.1_4 Forward -172 -158 6.48943 0.245
NP_442140.1_3 Reverse -81 -91 14.828 0.0433
NP_442140.1_3 Reverse -354 -364 9.22315 0.111
NP_442140.1_3 Forward -88 -78 7.94484 0.124
NP_442140.1_3 Forward -361 -351 7.45319 0.14
NP_441696.1_6 Forward -88 -69 24.9755 0.00232
NP_440875.1_9 Forward -87 -77 14.5042 0.0411
NP_442547.1_7 Forward -335 -316 10.0276 0.293
NP_441813.1_5 Forward -91 -81 8.92815 0.0347
NP_441813.1_5 Reverse -78 -88 8.73149 0.0367
NP_440594.1_8 Reverse -81 -94 11.6217 0.152
NP_440594.1_8 Forward -88 -75 8.67183 0.213
NP_441227.1_3 Forward -289 -270 5.50599 0.266
NP_440590.1_4 Reverse -81 -94 13.0973 0.013
NP_440590.1_4 Forward -88 -75 3.26421 0.0749
NP_440590.1_4 Forward -383 -370 0.0192843 0.173
NP_440567.1_1 Forward -88 -74 17.5025 0.0153
NP_440567.1_1 Reverse -81 -95 7.27608 0.0744
NP_442497.1_10 Reverse -81 -90 19.8626 0.00532
NP_442497.1_10 Forward -88 -79 17.601 0.00813
NP_440821.1_4 Forward -91 -81 19.5479 0.00399
NP_440821.1_4 Reverse -78 -88 10.7964 0.0146
NP_440821.1_4 Forward -386 -376 -0.708283 0.287
NP_441239.1_9 Reverse -78 -90 18.4269 0.0114
NP_441239.1_9 Forward -91 -79 14.4936 0.0272
NP_441239.1_9 Reverse -109 -121 8.10212 0.142
NP_441239.1_9 Forward -386 -374 3.87389 0.272
NP_441239.1_9 Forward -364 -352 3.18557 0.292
NP_441951.1_4 Reverse -369 -388 3.34271 0.275
NP_441727.1_3 Reverse -73 -92 7.86593 0.214
NP_441727.1_3 Forward -385 -366 2.55606 0.299
NP_441892.1_1 Reverse -71 -88 4.95539 0.105
NP_441892.1_1 Forward -98 -81 -4.38605 0.26
NP_440604.1_6 Forward -89 -70 1.17943 0.162
NP_442044.1_1 Reverse -75 -94 -4.81876 0.18
NP_442193.1_8 Reverse -148 -167 9.43841 0.294
NP_442643.1_1 Forward -338 -319 -12.5869 0.268
NP_440949.1_7 Reverse -103 -122 10.52 0.233
NP_440354.1_5 Forward -92 -73 1.57275 0.272
NP_440354.1_7 Forward -126 -108 8.27895 0.249
NP_440546.1_4 Forward -89 -79 13.5365 0.0459
NP_440546.1_4 Reverse -80 -90 12.8578 0.0572
NP_440546.1_4 Reverse -353 -363 8.97947 0.16
NP_440546.1_6 Reverse -70 -89 9.3409 0.247
NP_440462.1_6 Reverse -78 -88 19.4496 0.00371
NP_440462.1_6 Forward -91 -81 10.4031 0.0396
NP_440462.1_6 Reverse -285 -295 1.455 0.294
NP_442340.1_3 Reverse -113 -132 -10.3253 0.286
NP_440868.1_4 Reverse -76 -88 19.0169 0.0123
NP_440868.1_4 Reverse -283 -295 2.30059 0.157
NP_442499.1_3 Forward -332 -314 4.6407 0.289
NP_440696.1_3 Forward -372 -354 6.41066 0.188
NP_440696.1_3 Reverse -277 -295 -4.20908 0.298
NP_442039.1_4 Forward -88 -81 15.1821 0.0124
NP_442039.1_4 Reverse -81 -88 15.1821 0.0124
NP_442039.1_7 Forward -164 -154 15.5163 0.211
NP_442039.1_7 Reverse -355 -365 12.6647 0.222
NP_442039.1_7 Forward -38 -28 10.5014 0.257
NP_442039.1_7 Reverse -371 -381 6.8632 0.292
NP_441811.1_8 Forward -95 -81 13.8643 0.175
NP_441811.1_8 Reverse -74 -88 12.1926 0.209
NP_441811.1_8 Reverse -305 -319 6.78443 0.263
NP_442837.1_3 Forward -88 -81 15.7721 0.0124
NP_442837.1_3 Reverse -81 -88 15.7721 0.0124
NP_440160.1_2 Reverse -321 -340 -8.45701 0.286
NP_442053.1_1 Forward -89 -80 18.3876 0.0007
NP_442053.1_1 Reverse -80 -89 18.3876 0.0007
NP_440505.1_3 Reverse -78 -88 15.418 0.0114
NP_440505.1_3 Forward -91 -81 7.84651 0.147
NP_441203.1_1 Reverse -81 -100 -14.9469 0.208
NP_442532.1_7 Forward -89 -75 14.2576 0.0644
NP_440914.1_1 Forward -89 -79 16.3248 0.00196
NP_440914.1_1 Reverse -80 -90 8.51751 0.186
NP_440914.1_1 Reverse -268 -278 6.56569 0.273
NP_441011.1_8 Forward -88 -79 16.6177 0.00602
NP_441011.1_8 Reverse -81 -90 14.356 0.0249
NP_442931.1_3 Forward -94 -75 17.0107 0.171
NP_442533.1_1 Reverse -123 -142 -10.3253 0.231
NP_442533.1_6 Forward -89 -80 17.2076 0.00137
NP_442533.1_6 Reverse -80 -89 17.2076 0.00137
NP_442533.1_6 Reverse -353 -362 7.17789 0.0948
NP_442533.1_6 Forward -362 -353 6.68623 0.105
NP_442533.1_6 Reverse -157 -166 5.01461 0.16
NP_442533.1_6 Forward -384 -375 3.7363 0.204
NP_442232.1_3 Reverse -72 -91 2.94938 0.0965
NP_443016.1_10 Forward -98 -79 11.5042 0.218
NP_441482.1_7 Forward -95 -81 -0.885388 0.0612
NP_441482.1_7 Reverse -105 -119 -3.34366 0.118
NP_441482.1_7 Reverse -74 -88 -10.5218 0.209
NP_441482.1_7 Reverse -134 -148 -11.0135 0.229
NP_441482.1_7 Forward -172 -158 -11.3085 0.254
NP_439944.1_9 Forward -88 -78 17.7779 0.00341
NP_439944.1_9 Reverse -81 -91 17.4829 0.00423
NP_440816.1_7 Forward -204 -185 9.93088 0.252
NP_442202.1_10 Forward -90 -76 4.81781 0.255
NP_440116.1_8 Reverse -81 -100 -6.29373 0.205
NP_440115.1_6 Reverse -77 -87 16.008 0.0325
NP_440115.1_6 Forward -92 -82 10.0098 0.115
NP_440007.1_9 Forward -170 -156 1.67122 0.285
NP_440007.1_9 Forward -123 -109 0.687908 0.292
NP_439965.1_5 Forward -151 -132 9.14342 0.299
NP_441602.1_3 Reverse -75 -94 8.65258 0.117
NP_441602.1_3 Forward -94 -75 -1.96717 0.231
NP_441170.1_4 Reverse -148 -166 7.19731 0.194
NP_441972.1_5 Forward -395 -376 0.884433 0.144
NP_441972.1_5 Forward -383 -364 0.687771 0.146
NP_441972.1_5 Reverse -81 -100 -1.57384 0.177
NP_441972.1_5 Reverse -370 -389 -2.45882 0.184
NP_441972.1_5 Forward -165 -146 -9.24366 0.282
NP_441106.1_1 Reverse -79 -88 18.486 0.0028
NP_441106.1_1 Forward -90 -81 9.73449 0.0311
NP_441420.1_1 Forward -291 -272 -1.57384 0.275
NP_440429.1_2 Reverse -46 -65 7.37428 0.289
NP_439903.1_6 Forward -138 -119 3.34192 0.21
NP_439903.1_6 Forward -92 -73 3.04693 0.213
NP_442306.1_10 Reverse -75 -94 -1.47551 0.0496
NP_441286.1_1 Reverse -79 -91 14.7886 0.00418
NP_441286.1_1 Forward -90 -78 5.25052 0.0259
NP_441286.1_1 Reverse -156 -168 0.825626 0.107
NP_442674.1_3 Forward -174 -155 2.45694 0.3
NP_440670.1_8 Forward -89 -80 18.3876 0.000699
NP_440670.1_8 Reverse -80 -89 18.3876 0.000699
NP_440886.1_7 Forward -90 -80 8.04271 0.0805
NP_440886.1_7 Reverse -79 -89 8.04271 0.0805
NP_442614.1_2 Forward -89 -75 6.58777 0.291
NP_442072.1_9 Forward -90 -72 -11.3872 0.0789
NP_442072.1_9 Reverse -79 -97 -21.5153 0.209
NP_441808.1_8 Reverse -74 -93 8.94757 0.259
NP_440907.2_8 Reverse -81 -91 19.449 0.00351
NP_440907.2_8 Forward -88 -78 19.1541 0.00362
NP_442264.1_2 Reverse -70 -87 7.41366 0.24
NP_442264.1_2 Reverse -343 -360 5.05372 0.287
NP_441021.1_1 Reverse -81 -100 -1.7705 0.124
NP_440841.1_4 Forward -36 -17 -8.94866 0.251
NP_441463.1_3 Reverse -70 -89 -3.73712 0.184
NP_441463.1_6 Reverse -78 -92 5.73949 0.287
NP_441626.1_2 Forward -88 -81 15.7721 0.0124
NP_441626.1_2 Reverse -81 -88 15.7721 0.0124
NP_442211.1_3 Forward -221 -202 6.98569 0.29
NP_442238.1_3 Forward -337 -318 4.32602 0.291
NP_442794.1_1 Reverse -107 -119 3.08724 0.286
NP_442615.1_1 Reverse -71 -89 6.11567 0.0364
NP_442615.1_1 Forward -98 -80 -1.45582 0.128
NP_442615.1_1 Forward -305 -287 -4.8974 0.197
NP_441962.1_4 Reverse -135 -154 -0.885524 0.117
NP_441962.1_4 Reverse -370 -389 -0.983855 0.117
NP_441962.1_4 Reverse -75 -94 -6.49039 0.177
NP_441962.1_4 Forward -94 -75 -8.65367 0.203
NP_441962.1_4 Forward -88 -69 -10.227 0.224
NP_440387.1_1 Forward -89 -73 15.2998 0.00554
NP_440387.1_1 Reverse -80 -96 8.41667 0.0282
NP_441431.1_2 Reverse -77 -91 13.6669 0.0834
NP_441431.1_2 Forward -92 -78 6.48882 0.269
NP_441488.1_7 Reverse -74 -93 16.1257 0.0543
NP_441488.1_7 Forward -95 -76 7.37428 0.125
NP_441488.1_8 Reverse -370 -384 10.717 0.146
NP_441836.1_2 Reverse -74 -93 12.1925 0.0706
NP_441993.1_1 Forward -149 -130 14.4212 0.0768
NP_441993.1_1 Reverse -74 -93 5.26024 0.205
NP_441993.1_1 Reverse -157 -176 0.777198 0.292
NP_441993.1_1 Forward -384 -365 0.679741 0.294
NP_441174.1_2 Reverse -77 -91 11.5043 0.296
NP_440114.1_10 Forward -89 -75 18.0925 0.0075
NP_440114.1_10 Forward -377 -363 10.4227 0.148
NP_441510.2_7 Reverse -105 -119 9.93039 0.281
NP_440766.1_4 Reverse -76 -90 4.03116 0.137
NP_439988.1_7 Forward -87 -73 12.487 0.292
NP_441237.1_9 Reverse -81 -91 17.2863 0.00348
NP_440457.1_1 Forward -93 -81 15.1819 0.0611
NP_440457.1_1 Forward -388 -376 0.628964 0.25
NP_440457.1_1 Reverse -76 -88 0.23564 0.25
NP_442940.1_2 Forward -89 -70 8.65258 0.167
NP_440798.1_6 Reverse -369 -382 2.18257 0.186
NP_440798.1_6 Forward -88 -75 1.69091 0.205
NP_441984.1_3 Reverse -130 -148 9.26226 0.211
NP_441984.1_3 Reverse -76 -94 8.96727 0.217
NP_442509.1_9 Reverse -80 -90 17.3841 0.00128
NP_442509.1_9 Forward -89 -79 8.04271 0.192
NP_442509.1_9 Forward -270 -260 6.17443 0.286
NP_442439.1_8 Forward -363 -344 8.06259 0.265
NP_440554.1_4 Forward -88 -78 15.418 0.0199
NP_440554.1_4 Reverse -81 -91 6.27322 0.123
NP_440554.1_4 Reverse -376 -386 3.42162 0.23
NP_441885.1_5 Forward -89 -79 11.3864 0.00668
NP_441885.1_5 Reverse -80 -90 11.3864 0.00668
NP_441428.1_8 Reverse -72 -91 6.58763 0.216
NP_442341.1_7 Reverse -79 -93 9.93102 0.0692
NP_442341.1_7 Forward -90 -76 6.3911 0.127
NP_442341.1_9 Reverse -155 -169 6.68548 0.217
NP_441756.1_5 Forward -388 -369 0.58944 0.23
NP_441756.1_5 Forward -93 -74 0.58944 0.23
NP_441756.1_5 Reverse -318 -337 -1.18052 0.253
NP_441173.1_9 Reverse -154 -162 9.85212 0.275
NP_440409.1_1 Reverse -72 -91 2.45773 0.18
NP_443000.1_7 Reverse -78 -88 10.7964 0.0345
NP_443000.1_7 Forward -91 -81 2.14332 0.226
NP_440507.2_3 Forward -393 -374 7.57013 0.274
NP_441842.1_1 Forward -87 -74 16.6366 0.0446
NP_441842.1_10 Reverse -73 -87 11.6026 0.126
NP_440275.1_3 Forward -91 -81 19.5479 0.00756
NP_440275.1_3 Reverse -78 -88 18.6629 0.0082
NP_440091.1_1 Reverse -76 -88 0.825626 0.227
NP_440679.1_10 Reverse -73 -92 -11.3086 0.182
NP_443010.1_10 Reverse -77 -94 8.66545 0.16
NP_441359.1_5 Reverse -197 -216 2.55606 0.266
NP_442451.1_2 Reverse -72 -91 0.196116 0.153
NP_441122.1_1 Forward -366 -351 4.01147 0.28
NP_440149.1_8 Forward -166 -147 -2.75381 0.175
NP_441105.1_3 Reverse -69 -88 11.0125 0.038
NP_441105.1_3 Reverse -364 -383 -3.73712 0.185
NP_441105.1_3 Reverse -342 -361 -9.63698 0.292
NP_441105.1_3 Forward -171 -152 -9.73531 0.295
NP_442373.1_2 Reverse -372 -391 -9.24366 0.258
NP_440216.1_1 Forward -89 -75 -1.5737 0.034
NP_440216.1_1 Reverse -80 -94 -2.45868 0.0513
NP_440216.1_9 Reverse -355 -364 7.47288 0.286
NP_440216.1_9 Forward -360 -351 7.37455 0.286
NP_440172.1_1 Forward -89 -79 17.5813 0.00421
NP_440172.1_1 Reverse -80 -90 16.303 0.00854
NP_440172.1_1 Reverse -353 -363 3.61828 0.222
NP_442015.1_10 Forward -388 -375 9.45906 0.0486
NP_442015.1_10 Forward -93 -80 4.44418 0.169
NP_441226.1_7 Forward -88 -81 14.4934 0.0123
NP_441226.1_7 Reverse -81 -88 14.4934 0.0123
NP_440198.1_10 Forward -232 -213 6.98095 0.296
NP_441111.1_7 Forward -88 -80 18.7023 0.00294
NP_441111.1_7 Reverse -81 -89 18.7023 0.00294
NP_441111.1_7 Forward -383 -375 -0.472234 0.131
NP_441111.1_7 Reverse -158 -166 -0.570565 0.233
NP_442379.1_10 Reverse -73 -90 8.00365 0.102
NP_439971.2_8 Reverse -274 -288 13.6676 0.284
NP_441766.1_2 Forward -89 -80 17.5026 0.00297
NP_441766.1_2 Reverse -80 -89 17.5026 0.00297
NP_441766.1_2 Forward -384 -375 3.24465 0.227
NP_442417.1_5 Reverse -375 -389 17.0108 0.0349
NP_440416.1_9 Reverse -368 -387 -12.3902 0.157
NP_440416.1_9 Reverse -352 -371 -18.1918 0.253
NP_440416.1_9 Forward -391 -372 -20.5517 0.286
NP_443052.1_8 Forward -99 -80 -5.99873 0.139
NP_443052.1_8 Reverse -127 -146 -13.7669 0.296
NP_443052.1_9 Reverse -324 -343 -2.0655 0.233
NP_440261.1_5 Reverse -81 -94 6.90245 0.0316
NP_440261.1_5 Forward -88 -75 6.70579 0.0318
NP_440261.1_5 Forward -330 -317 -4.60227 0.158
NP_440261.1_5 Forward -361 -348 -6.37223 0.201
NP_440988.1_10 Forward -364 -350 12.8375 0.178
NP_440988.1_10 Reverse -367 -381 11.3853 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGCTAAAGTCACCACTGCGGTGGCCAATGGGATGTTTCGCCATGGCCAACAAAACTTTTTCTGGTACGGGAGTTGGCCCCGGAATCATCAACATTTGCTTATTATCCATCGCGGTCAATCCTCCCCTTCGCTAAACGCAGTCAGGTAATTTTCTAGGGTTAATTTGTCGGTAATTGTTATCAATGCCGGAGTTATTGGGCATGATAGTTAGGCTTCCCATATTACCAAAACATGGCGCTGGCAAAATCTGTGCTGTGGCCCCAGCTTGATTTCCTTGACTGCCATTGGCGTGGTTTTAAGAGGACTCTGGGGCGATCGCCTCCACCAGAATTACCTAGGTGCAAAAGCAGGACAGACCGTACAATGGGAAACGATTAATCAAATGCACGCATAACTTGA

CDS

ATGGCCGCCATCACCCTCACCCTCCTTCTCCCGGGTAAAAGCGTTGCTGTCCAGAGCTGGACCTTTGAATCGGAACAAACCATCCGTGTGGGTCGGGCGGCGGATAACGATGTTGTACTTTATAGTGCTGTAGTATCCCGGCATCATCTAGAACTCCGACGGGAAGAGGAAGCTTGGGTCGCCATTAACTTGGGAGCTAATGGCACCTATATGGAAGCGGAAATGGTGGAAAAGCTTGTCCTCAAGGATGGCATGGTTCTACGCTTAGCCAGTTCCGGCCCCAAAATACAGATTAGGCTTCAGTCTGAACTCAGTACCCTGGAACAGGAACTAGCTCAACAAGATAGTTCCCCTACTGGGCCAGGGGAAGAACAAAAATCCAGCCGTCTCCACCCTGGGGATTCCAAAGAGACCATCATCAACTAG

Protein

MAAITLTLLLPGKSVAVQSWTFESEQTIRVGRAADNDVVLYSAVVSRHHLELRREEEAWVAINLGANGTYMEAEMVEKLVLKDGMVLRLASSGPKIQIRLQSELSTLEQELAQQDSSPTGPGEEQKSSRLHPGDSKETIIN