Your browser is old and dusty. Try Google Chrome!

Details for slr1684

ORF slr1684
Accession NP_441694.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY391b: 1970517 - 1970880, join 1972064 - 1973077]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -252 -259 8.8889 0.188
NP_441453.1_4 Forward -260 -252 11.6225 0.0403
NP_441225.1_5 Forward -55 -36 9.14423 0.252
NP_441499.1_3 Reverse -223 -233 17.9741 0.28
NP_439957.1_10 Forward -24 -14 15.2213 0.289
NP_442889.1_8 Forward -125 -111 4.03056 0.27
NP_442889.1_10 Forward -32 -13 15.1318 0.149
NP_442111.1_1 Reverse -243 -262 15.1416 0.29
NP_441014.1_10 Reverse -152 -171 0.883656 0.236
NP_443018.1_3 Forward -259 -252 4.56234 0.241
NP_443018.1_3 Reverse -252 -259 4.46401 0.244
NP_440376.1_1 Forward -188 -179 5.60459 0.125
NP_440376.1_1 Forward -266 -257 -1.18024 0.294
NP_440642.1_10 Reverse -364 -378 3.93223 0.264
NP_442911.1_2 Reverse -247 -266 -9.14533 0.25
NP_442002.1_9 Forward -157 -150 11.1505 0.185
NP_442598.1_2 Reverse -379 -388 14.8477 0.252
NP_440802.1_8 Forward -320 -301 14.5524 0.278
NP_442500.1_8 Forward -386 -372 18.4693 0.103
NP_442933.1_1 Reverse -378 -397 6.82725 0.261
NP_442933.1_2 Forward -336 -318 8.21429 0.257
NP_442554.1_8 Forward -259 -249 2.33998 0.274
NP_442292.1_1 Forward -259 -250 5.21127 0.152
NP_441468.1_1 Reverse -252 -259 3.97235 0.277
NP_441673.1_1 Forward -266 -257 -8.06341 0.254
NP_441096.1_5 Reverse -11 -29 17.2262 0.297
NP_443004.2_2 Reverse -30 -49 16.368 0.221
NP_441612.1_2 Forward -266 -256 13.874 0.21
NP_441911.1_10 Forward -380 -361 13.8614 0.21
NP_441911.1_10 Forward -360 -341 10.1015 0.226
NP_442718.1_2 Forward -162 -143 -2.0655 0.266
NP_442113.1_10 Reverse -135 -154 -3.44213 0.214
NP_440346.1_7 Forward -368 -349 10.7175 0.181
NP_440093.1_6 Forward -83 -64 16.7149 0.278
NP_440614.1_4 Forward -82 -63 22.1127 0.0451
NP_441433.1_8 Forward -245 -226 -1.37718 0.258
NP_442579.1_6 Forward -77 -58 10.6192 0.154
NP_441739.1_2 Reverse -43 -59 1.92616 0.291
NP_441728.2_5 Reverse -60 -79 14.2574 0.244
NP_440899.1_8 Reverse -102 -121 -5.31042 0.231
NP_440899.1_8 Reverse -34 -53 -6.58872 0.231
NP_442334.1_2 Forward -207 -190 -7.82764 0.297
NP_442860.1_7 Forward -52 -34 6.5807 0.294
NP_440915.1_6 Forward -211 -197 -2.75368 0.28
NP_442993.1_1 Reverse -251 -267 -12.0362 0.265
NP_441340.1_5 Forward -259 -252 11.0522 0.0749
NP_442474.1_1 Forward -76 -57 14.4541 0.0254
NP_443051.1_5 Forward -228 -209 3.93269 0.298
NP_442488.1_7 Reverse -243 -262 8.94757 0.284
NP_439977.1_7 Reverse -240 -259 10.52 0.281
NP_442572.1_3 Forward -192 -174 17.4356 0.225
NP_441018.1_7 Reverse -149 -168 7.47261 0.269
NP_442262.1_10 Forward -259 -252 7.90559 0.266
NP_440282.1_10 Forward -270 -251 -7.4737 0.251
NP_442917.1_1 Forward -391 -372 7.76679 0.254
NP_440297.1_9 Forward -259 -249 1.16001 0.282
NP_440350.1_5 Reverse -16 -35 1.0811 0.158
NP_440350.1_5 Reverse -308 -327 -1.67217 0.208
NP_440350.1_5 Reverse -24 -43 -4.13045 0.273
NP_440350.1_5 Reverse -368 -387 -7.27704 0.299
NP_440888.1_2 Reverse -198 -212 9.53707 0.123
NP_442277.1_7 Forward -388 -372 7.74165 0.196
NP_442277.1_7 Forward -46 -30 -0.757133 0.228
NP_441543.1_2 Reverse -75 -84 5.70292 0.181
NP_442845.1_2 Forward -266 -252 6.78443 0.202
NP_442710.1_7 Forward -300 -281 -7.7994 0.299
NP_442337.1_8 Reverse -158 -177 -1.47551 0.284
NP_441223.1_5 Forward -387 -373 16.8168 0.162
NP_441785.1_1 Forward -260 -246 14.1927 0.166
NP_442428.1_5 Reverse -252 -259 4.36568 0.271
NP_443048.1_9 Reverse -11 -25 17.5078 0.11
NP_442219.1_8 Forward -276 -257 8.65027 0.241
NP_441893.1_5 Reverse -175 -189 15.3386 0.288
NP_442813.1_4 Reverse -49 -68 -5.80207 0.299
NP_441851.1_10 Reverse -250 -260 4.10993 0.287
NP_441396.1_2 Reverse -142 -159 1.70976 0.249
NP_441046.1_2 Forward -156 -137 2.45773 0.24
NP_442689.1_8 Reverse -35 -52 0.235503 0.191
NP_442689.1_8 Reverse -382 -399 -8.71262 0.296
NP_441078.1_4 Reverse -257 -266 -1.08191 0.222
NP_441078.1_4 Forward -266 -257 -2.06522 0.295
NP_441432.1_8 Reverse -256 -265 3.14632 0.259
NP_441432.1_8 Reverse -250 -259 2.94966 0.28
NP_441333.1_1 Reverse -28 -38 12.9245 0.217
NP_441333.1_1 Reverse -34 -44 10.8273 0.293
NP_442320.1_8 Reverse -251 -265 -5.50694 0.228
NP_442815.1_3 Reverse -249 -268 23.2056 0.0153
NP_442489.1_2 Forward -271 -252 9.3409 0.168
NP_441659.2_8 Forward -260 -250 0.766681 0.258
NP_440336.1_1 Forward -58 -39 13.3725 0.286
NP_439912.1_3 Reverse -22 -40 20.6678 0.0401
NP_440335.1_9 Forward -47 -29 10.6389 0.28
NP_440250.1_4 Reverse -344 -363 5.99684 0.253
NP_441948.1_4 Forward -215 -197 -4.40575 0.228
NP_441358.1_3 Forward -229 -211 11.0314 0.249
NP_443040.1_1 Forward -116 -102 10.1839 0.291
NP_441329.1_6 Forward -130 -111 7.01823 0.179
NP_441329.1_6 Forward -33 -14 3.10306 0.217
NP_441329.1_6 Forward -47 -28 1.28872 0.24
NP_441329.1_6 Forward -379 -360 0.90675 0.245
NP_441329.1_6 Forward -49 -30 0.333799 0.258
NP_441329.1_6 Forward -36 -17 -0.812105 0.284
NP_441329.1_6 Forward -328 -309 -1.95801 0.293
NP_442055.1_8 Reverse -249 -268 12.88 0.254
NP_442199.1_5 Forward -268 -249 -6.29373 0.272
NP_441951.1_4 Forward -200 -181 3.44104 0.275
NP_442568.1_8 Forward -173 -159 8.65272 0.28
NP_440876.1_8 Forward -341 -322 17.994 0.262
NP_442465.1_2 Reverse -313 -332 2.45694 0.243
NP_442402.1_4 Reverse -62 -81 -0.492971 0.189
NP_441848.1_7 Reverse -143 -162 1.57197 0.228
NP_442679.1_1 Forward -158 -139 8.84924 0.147
NP_442679.1_1 Forward -384 -365 8.35759 0.147
NP_442679.1_1 Forward -279 -260 -1.18052 0.226
NP_442679.1_1 Forward -38 -19 -2.65548 0.242
NP_442679.1_1 Forward -234 -215 -3.14714 0.25
NP_442829.1_2 Forward -322 -306 9.39733 0.287
NP_440505.1_3 Forward -209 -199 9.22315 0.122
NP_442844.1_5 Reverse -14 -33 9.7334 0.231
NP_441408.2_7 Forward -170 -151 -4.52377 0.281
NP_441011.1_8 Reverse -252 -261 11.6028 0.0754
NP_439944.1_9 Reverse -252 -262 10.7964 0.0887
NP_439944.1_9 Reverse -258 -268 10.0098 0.0949
NP_441527.1_4 Forward -32 -13 9.59652 0.0632
NP_441527.1_4 Forward -38 -19 2.33913 0.131
NP_441527.1_4 Forward -44 -25 2.05265 0.131
NP_441527.1_4 Forward -29 -10 -1.86252 0.15
NP_441527.1_4 Forward -73 -54 -2.72194 0.161
NP_441527.1_4 Forward -35 -16 -4.34531 0.184
NP_441527.1_4 Forward -324 -305 -4.63178 0.188
NP_441527.1_4 Forward -50 -31 -6.35064 0.217
NP_441527.1_4 Forward -46 -27 -7.11457 0.23
NP_441527.1_4 Forward -385 -366 -7.78302 0.237
NP_441527.1_4 Forward -327 -308 -8.26048 0.242
NP_441527.1_4 Forward -47 -28 -9.40638 0.258
NP_441527.1_4 Forward -328 -309 -9.69285 0.261
NP_441527.1_4 Forward -375 -356 -9.88384 0.262
NP_441527.1_4 Forward -45 -26 -9.88384 0.262
NP_441527.1_4 Forward -33 -14 -10.1703 0.266
NP_441527.1_4 Forward -39 -20 -11.2207 0.278
NP_441527.1_4 Forward -325 -306 -12.3666 0.285
NP_441527.1_4 Forward -374 -355 -12.4621 0.288
NP_441527.1_4 Forward -352 -333 -12.7486 0.293
NP_441527.1_7 Reverse -275 -294 10.6184 0.282
NP_442728.1_1 Forward -191 -172 8.55425 0.239
NP_440444.1_9 Reverse -193 -212 13.8633 0.223
NP_442674.1_10 Reverse -243 -262 20.4523 0.0681
NP_440814.1_8 Forward -25 -6 -0.787193 0.287
NP_441500.1_2 Forward -151 -132 12.5858 0.228
NP_441981.1_3 Forward -24 -10 14.4066 0.268
NP_442680.1_5 Forward -233 -214 19.3172 0.0362
NP_442680.1_5 Forward -80 -61 5.4452 0.225
NP_442680.1_5 Forward -54 -35 3.88216 0.227
NP_442680.1_5 Forward -27 -8 2.51449 0.237
NP_441332.1_4 Forward -23 -4 4.03102 0.293
NP_441159.1_8 Reverse -215 -234 11.7983 0.0889
NP_441885.1_5 Reverse -257 -267 0.57002 0.137
NP_440628.1_1 Forward -38 -28 14.6456 0.248
NP_440628.1_1 Forward -319 -309 13.1012 0.29
NP_442703.1_9 Forward -34 -16 9.36059 0.244
NP_442341.1_9 Forward -191 -177 6.58715 0.221
NP_440191.1_6 Reverse -288 -302 14.9084 0.294
NP_443010.1_10 Forward -210 -193 3.83376 0.25
NP_441207.1_7 Forward -53 -39 11.7725 0.241
NP_441105.1_3 Forward -271 -252 -6.58872 0.236
NP_441105.1_3 Reverse -246 -265 -8.06369 0.265
NP_440701.1_7 Forward -371 -352 19.0757 0.126
NP_442552.1_4 Forward -310 -291 14.4666 0.253
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGTATTTAAACCAAAAGAAAGATTAAAAGAGGGAGATAAGTATAAAACAAAGCCGGAATTAGCAGTAGAGATAATAAAAGAACTAGAAGAAAGTGGTTTTAAAATAAAAAGAGTAGTGTCAGATAGCTTATATGGAGAAAGCCATAGCAATTTTATCAGTGCTGTAGAGGAATTAAAAATAGAATATGCAGTGGGAATCCGGAGTAATCATGGGGTCTGGCTTCCAAAGGAAGCTAAAGTAAGGGCAAATAAGTGGAGGAGGTTTGAACACATAAGATGGGATAGAAAACAGGAAGATAGGTATATCAGAGAAATAGTTTATGGCAAAAAAGCGCAATAAGATATTGGGAAATTAAAACAGAAACAGAAAAAGAGGAGGAAAAAGCAGGATGGTTTGTA

CDS

ATGACTCGAATACCAGATATTAAATATAAAGAAGTTGGCAGAATATATGGAGTAAGGTCATGGATAGAATATGGATTTAAGCAATGCAAAAGTGAATTAGGATGGGCAGATTTTAGGGTAACTCATTATGAGCAAATTCAAAAATGGTGGGAATTAGTGATGTGTGCATATTGTATGATTTGTTTTTATGATGAGAATTTTAATCCGACTCTAAATTCAACGTCAAAGTATCATCAAAAGCATGAAAAATGGGATAAAGAAAAATGGCTAAACAACCTACGATTAGTGATCTCTGTATTTAATGCAATAAATCTTATCAAAAAGTGGTTAAAAGTATTTCCATTTGCTCATGTTTTGGATGAATTAACTAAATTTTACAACAAGGTTGATAAGCTAGATCGATTAAAGTATTTGCTAAATTCATGGAATACATTCTATTCTTCTTCTGCCTAG

Protein

MTRIPDIKYKEVGRIYGVRSWIEYGFKQCKSELGWADFRVTHYEQIQKWWELVMCAYCMICFYDENFNPTLNSTSKYHQKHEKWDKEKWLNNLRLVISVFNAINLIKKWLKVFPFAHVLDELTKFYNKVDKLDRLKYLLNSWNTFYSSSA