Your browser is old and dusty. Try Google Chrome!

Details for slr1678

ORF slr1678
Accession NP_441680.1
Symbol rpl21
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L21
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -349 -335 23.599 0.00309
NP_441061.1_2 Reverse -342 -356 7.27608 0.104
NP_441061.1_2 Reverse -336 -350 3.44117 0.164
NP_440557.1_1 Forward -349 -330 9.53756 0.125
NP_440795.1_7 Forward -349 -342 14.6904 0.0123
NP_440795.1_7 Reverse -342 -349 14.6904 0.0123
NP_441418.1_6 Reverse -341 -360 -4.13045 0.0256
NP_441418.1_6 Forward -350 -331 -19.4701 0.0888
NP_441418.1_6 Forward -344 -325 -19.7651 0.0955
NP_441418.1_6 Reverse -335 -354 -29.9915 0.249
NP_442291.1_5 Forward -351 -335 -0.924775 0.19
NP_441453.1_1 Forward -357 -339 6.01657 0.242
NP_441453.1_4 Reverse -341 -349 16.539 0.00633
NP_441453.1_4 Forward -350 -342 16.539 0.00633
NP_441453.1_4 Reverse -335 -343 4.24765 0.259
NP_442151.1_6 Forward -350 -336 16.1259 0.0178
NP_442151.1_6 Reverse -335 -349 9.2427 0.155
NP_441818.1_1 Forward -349 -338 10.1862 0.232
NP_441818.1_6 Forward -357 -343 11.6026 0.253
NP_440226.1_1 Reverse -341 -360 17.8957 0.0175
NP_440931.1_9 Forward -219 -200 13.3725 0.257
NP_440150.1_6 Reverse -338 -357 6.78429 0.223
NP_442173.1_1 Forward -349 -341 15.4574 0.00633
NP_442173.1_1 Reverse -342 -350 15.4574 0.00633
NP_442752.1_4 Forward -350 -343 13.8055 0.0199
NP_442752.1_4 Reverse -341 -348 13.8055 0.0199
NP_442752.1_4 Forward -121 -114 5.54565 0.194
NP_443027.1_4 Reverse -339 -349 14.0414 0.0452
NP_443027.1_4 Forward -352 -342 13.943 0.0452
NP_443027.1_4 Reverse -242 -252 10.8948 0.112
NP_441812.1_3 Forward -122 -108 7.76774 0.263
NP_442975.1_10 Forward -354 -340 12.192 0.0477
NP_440784.1_7 Forward -349 -342 15.9687 0.0123
NP_440784.1_7 Reverse -342 -349 15.9687 0.0123
NP_442909.1_7 Forward -349 -335 13.6669 0.12
NP_442909.1_7 Reverse -225 -239 7.86545 0.198
NP_440061.1_9 Reverse -339 -353 13.2736 0.0819
NP_440110.1_8 Forward -371 -352 -0.688862 0.228
NP_440110.1_8 Reverse -339 -358 -1.86883 0.252
NP_441476.1_3 Reverse -77 -96 17.699 0.083
NP_441476.1_5 Reverse -336 -355 8.94757 0.0933
NP_441476.1_5 Forward -355 -336 6.09597 0.134
NP_441476.1_5 Forward -389 -370 -7.4737 0.29
NP_439979.1_2 Forward -344 -325 14.1591 0.142
NP_442062.1_8 Reverse -341 -351 19.4496 0.000558
NP_442062.1_8 Forward -350 -340 17.3846 0.00193
NP_442062.1_8 Reverse -297 -307 4.40493 0.217
NP_441900.1_2 Reverse -352 -370 -6.56973 0.294
NP_441859.1_3 Forward -351 -332 4.22689 0.228
NP_441859.1_3 Reverse -340 -359 3.53858 0.239
NP_440304.1_4 Reverse -339 -349 10.8948 0.051
NP_440304.1_4 Forward -352 -342 9.91146 0.051
NP_442242.1_4 Forward -349 -342 14.3954 0.0124
NP_442242.1_4 Reverse -342 -349 14.3954 0.0124
NP_441781.1_7 Forward -350 -331 3.53937 0.188
NP_441352.1_2 Forward -339 -320 3.14605 0.222
NP_440893.1_6 Forward -348 -329 13.5683 0.242
NP_441208.1_9 Reverse -338 -352 7.86607 0.219
NP_441594.1_6 Reverse -332 -351 4.12936 0.222
NP_441594.1_6 Forward -329 -310 3.04771 0.238
NP_442742.1_9 Reverse -71 -90 -13.2752 0.271
NP_442110.1_7 Forward -350 -336 19.3708 0.0138
NP_442110.1_7 Reverse -341 -355 -0.197071 0.276
NP_441925.1_4 Reverse -73 -92 -15.2425 0.263
NP_441925.1_4 Forward -151 -132 -17.2092 0.29
NP_441925.1_4 Reverse -72 -91 -17.2092 0.29
NP_440856.1_7 Forward -344 -325 -3.04881 0.194
NP_441083.1_5 Forward -350 -340 20.3345 0.00053
NP_441083.1_5 Reverse -341 -351 11.3864 0.0159
NP_442827.1_8 Forward -358 -339 7.86512 0.0924
NP_442827.1_8 Reverse -333 -352 6.09517 0.112
NP_441149.1_7 Reverse -301 -320 4.12936 0.267
NP_441434.1_7 Reverse -343 -357 7.27608 0.225
NP_441738.1_2 Forward -348 -341 15.28 0.0102
NP_441738.1_2 Reverse -343 -350 15.28 0.0102
NP_441738.1_2 Forward -251 -244 9.57686 0.166
NP_441738.1_2 Reverse -84 -91 8.29857 0.176
NP_441558.1_5 Reverse -339 -358 12.0942 0.0717
NP_441558.1_5 Forward -346 -327 7.27595 0.185
NP_441645.1_6 Forward -141 -127 19.3701 0.163
NP_440209.1_1 Reverse -341 -349 18.1123 0.00295
NP_440209.1_1 Forward -350 -342 18.1123 0.00295
NP_440870.1_4 Forward -356 -338 3.16574 0.163
NP_442889.1_3 Reverse -303 -322 14.3558 0.282
NP_442889.1_8 Forward -353 -339 11.7003 0.0733
NP_441713.1_1 Reverse -335 -354 -6.68705 0.121
NP_441713.1_1 Forward -127 -108 -14.9469 0.26
NP_441770.1_5 Forward -358 -339 -0.197208 0.245
NP_440178.1_7 Forward -351 -332 -22.2233 0.258
NP_440053.1_2 Forward -99 -80 11.3075 0.291
NP_442570.1_3 Forward -352 -333 -2.75381 0.215
NP_441716.1_1 Forward -350 -336 12.8809 0.0689
NP_441716.1_1 Reverse -335 -349 10.3243 0.0963
NP_441716.1_1 Reverse -341 -355 4.52282 0.255
NP_442111.1_4 Reverse -340 -354 17.5025 0.00997
NP_442111.1_4 Forward -351 -337 2.94952 0.259
NP_440906.1_5 Forward -349 -342 15.8704 0.0124
NP_440906.1_5 Reverse -342 -349 15.8704 0.0124
NP_440747.1_10 Reverse -338 -350 17.2469 0.000522
NP_440747.1_10 Forward -353 -341 -2.02597 0.0196
NP_441130.1_10 Reverse -339 -353 17.8958 0.0144
NP_441486.1_1 Forward -353 -339 11.6026 0.0153
NP_441486.1_1 Reverse -338 -352 4.12949 0.0492
NP_441486.1_1 Forward -347 -333 0.786239 0.126
NP_442634.1_4 Forward -352 -338 6.19444 0.0508
NP_440403.1_10 Forward -353 -334 7.37428 0.208
NP_441695.1_4 Reverse -342 -360 12.3105 0.225
NP_442848.1_1 Reverse -335 -349 7.37441 0.0791
NP_442848.1_1 Forward -356 -342 4.52282 0.1
NP_441012.1_4 Reverse -337 -350 7.49244 0.272
NP_441012.1_4 Forward -348 -335 5.82081 0.29
NP_443018.1_3 Forward -349 -342 14.8871 0.0123
NP_443018.1_3 Reverse -342 -349 14.8871 0.0123
NP_443018.1_3 Forward -343 -336 12.5271 0.0523
NP_443018.1_3 Reverse -336 -343 12.5271 0.0523
NP_441634.1_8 Reverse -339 -353 22.4191 0.00795
NP_440376.1_1 Forward -350 -341 19.4693 0.000692
NP_440376.1_1 Reverse -341 -350 19.4693 0.000692
NP_442687.1_7 Forward -351 -341 15.8113 0.0125
NP_442687.1_7 Reverse -340 -350 8.92815 0.0994
NP_442687.1_7 Reverse -201 -211 5.5849 0.194
NP_442191.1_4 Reverse -342 -356 10.9931 0.276
NP_441077.1_6 Reverse -175 -191 7.4294 0.233
NP_442485.1_3 Forward -355 -336 12.5858 0.105
NP_442485.1_3 Reverse -324 -343 0.982764 0.234
NP_441846.1_10 Reverse -125 -144 -12.0953 0.19
NP_441422.1_7 Forward -352 -335 7.11867 0.0992
NP_441422.1_7 Reverse -339 -356 -4.77938 0.247
NP_440691.1_2 Forward -338 -319 17.6007 0.264
NP_440691.1_10 Reverse -300 -319 9.0459 0.269
NP_442658.1_1 Forward -352 -342 18.7607 0.00222
NP_442658.1_1 Reverse -339 -349 6.76441 0.214
NP_442658.1_1 Reverse -333 -343 5.68278 0.258
NP_440141.1_8 Forward -359 -340 7.86593 0.232
NP_441855.2_4 Reverse -333 -352 14.8254 0.138
NP_442782.1_2 Forward -350 -336 2.35953 0.275
NP_442205.1_9 Forward -356 -340 6.45005 0.113
NP_441256.1_1 Forward -347 -328 -6.29373 0.239
NP_441256.1_8 Reverse -126 -145 2.16274 0.285
NP_442937.1_5 Reverse -330 -349 13.6675 0.0879
NP_442937.1_5 Reverse -336 -355 9.93088 0.177
NP_442937.1_5 Forward -355 -336 8.75091 0.212
NP_441958.1_5 Forward -351 -341 12.2714 0.00183
NP_441958.1_5 Reverse -340 -350 12.2714 0.00183
NP_441958.1_5 Forward -254 -244 0.471689 0.143
NP_441127.1_1 Reverse -335 -349 7.57108 0.3
NP_440203.1_5 Forward -347 -337 15.7125 0.0611
NP_439905.1_1 Reverse -342 -355 11.4257 0.204
NP_439990.1_5 Reverse -336 -349 11.3273 0.128
NP_441338.2_5 Forward -347 -328 1.86774 0.299
NP_442376.1_2 Forward -355 -336 -11.8003 0.286
NP_442911.1_2 Forward -360 -341 14.5524 0.0112
NP_442911.1_2 Reverse -331 -350 11.2092 0.0132
NP_440153.1_5 Reverse -342 -356 4.12949 0.199
NP_441591.1_10 Reverse -339 -358 6.88262 0.275
NP_443055.1_6 Reverse -327 -345 8.17984 0.148
NP_440993.1_2 Reverse -336 -352 2.8118 0.262
NP_440993.1_3 Reverse -331 -350 -1.37794 0.28
NP_440827.1_3 Forward -355 -336 17.404 0.101
NP_440827.1_3 Reverse -330 -349 10.9142 0.283
NP_442210.1_9 Forward -354 -336 9.45892 0.259
NP_441099.1_5 Reverse -331 -350 -1.57384 0.11
NP_441099.1_6 Forward -356 -337 17.8957 0.148
NP_442002.1_1 Forward -100 -82 -7.15901 0.249
NP_442002.1_1 Reverse -124 -142 -8.33898 0.264
NP_442002.1_9 Forward -351 -344 10.7572 0.185
NP_440809.1_9 Reverse -103 -121 1.98577 0.118
NP_441294.1_7 Forward -354 -340 19.9054 0.00262
NP_441646.1_1 Forward -357 -338 4.81767 0.189
NP_441646.1_1 Forward -313 -294 4.81767 0.189
NP_441646.1_1 Reverse -334 -353 -1.18052 0.28
NP_442438.1_10 Forward -355 -341 23.599 0.00642
NP_442438.1_10 Reverse -336 -350 17.9942 0.0179
NP_441000.1_6 Reverse -340 -354 4.62115 0.0946
NP_442771.1_1 Forward -352 -334 2.87075 0.0672
NP_442771.1_1 Reverse -339 -357 2.77242 0.0672
NP_440147.1_4 Reverse -339 -352 10.2457 0.0355
NP_440147.1_4 Forward -352 -339 3.36254 0.188
NP_440147.1_4 Forward -308 -295 0.510939 0.252
NP_441175.1_7 Forward -201 -182 9.53756 0.178
NP_441550.1_8 Reverse -339 -349 12.3692 0.0336
NP_441550.1_8 Forward -352 -342 10.501 0.066
NP_441916.1_7 Reverse -341 -351 18.4663 0.00144
NP_441916.1_7 Forward -350 -340 10.3048 0.0261
NP_440206.1_4 Reverse -331 -350 -2.16459 0.293
NP_440465.1_10 Forward -353 -334 -0.688862 0.29
NP_441041.1_4 Forward -350 -331 -5.9004 0.16
NP_441041.1_7 Forward -353 -341 10.2357 0.1
NP_441041.1_7 Forward -256 -244 7.80631 0.159
NP_442004.1_6 Forward -350 -336 18.2892 0.0534
NP_442004.1_6 Reverse -341 -355 10.1277 0.14
NP_441725.1_4 Reverse -336 -350 2.94893 0.279
NP_441725.1_5 Forward -349 -339 11.2881 0.0247
NP_441725.1_5 Reverse -342 -352 9.02648 0.0553
NP_439966.1_7 Forward -352 -342 17.4824 0.00636
NP_439966.1_7 Reverse -339 -349 15.8108 0.0124
NP_439966.1_9 Forward -352 -343 10.7178 0.0863
NP_442941.1_3 Forward -349 -339 19.9412 0.00262
NP_442941.1_3 Forward -120 -110 2.83163 0.14
NP_442941.1_3 Reverse -342 -352 2.53664 0.14
NP_440289.1_2 Forward -353 -340 10.2457 0.0272
NP_440289.1_2 Reverse -338 -351 -2.93064 0.262
NP_440983.1_5 Forward -350 -331 -5.50708 0.266
NP_440983.1_9 Reverse -332 -351 2.26107 0.292
NP_440260.1_8 Forward -353 -335 -2.93078 0.246
NP_440260.1_8 Reverse -332 -350 -4.70074 0.273
NP_441678.1_9 Forward -365 -346 -5.01543 0.297
NP_442281.1_1 Reverse -336 -350 15.6336 0.0113
NP_442281.1_1 Reverse -330 -344 6.78381 0.115
NP_441334.1_7 Reverse -339 -358 -11.4069 0.122
NP_441334.1_7 Forward -352 -333 -19.3717 0.275
NP_441079.1_7 Forward -280 -261 -3.34455 0.233
NP_440437.1_1 Reverse -335 -354 -1.47551 0.203
NP_442012.1_1 Forward -356 -337 0.0977854 0.248
NP_441556.1_4 Reverse -326 -345 12.3189 0.219
NP_442982.1_5 Reverse -331 -350 -1.27885 0.265
NP_442982.1_5 Reverse -154 -173 -1.57384 0.267
NP_441644.1_6 Forward -350 -340 17.3841 0.00127
NP_441644.1_6 Reverse -335 -345 10.206 0.0628
NP_441644.1_6 Reverse -341 -351 10.1076 0.0628
NP_441644.1_6 Forward -344 -334 4.01116 0.253
NP_443049.1_6 Forward -122 -112 10.9578 0.292
NP_442215.1_2 Forward -352 -336 11.0716 0.0433
NP_442029.1_1 Reverse -190 -209 -19.5684 0.291
NP_442029.1_10 Forward -140 -121 4.62101 0.29
NP_440929.1_8 Forward -350 -341 19.2726 0.000701
NP_440929.1_8 Reverse -341 -350 19.2726 0.000701
NP_440566.1_6 Reverse -295 -314 9.53756 0.289
NP_442933.1_10 Forward -350 -341 17.601 0.00325
NP_442933.1_10 Reverse -341 -350 17.601 0.00325
NP_442933.1_10 Reverse -244 -253 4.12963 0.28
NP_441751.2_8 Forward -349 -335 16.3225 0.00876
NP_441751.2_8 Reverse -342 -356 -3.04867 0.134
NP_442926.1_3 Forward -343 -324 10.6192 0.137
NP_442926.1_5 Forward -355 -336 14.7358 0.15
NP_442554.1_8 Reverse -342 -352 16.008 0.0065
NP_442554.1_8 Forward -349 -339 15.9097 0.00747
NP_442554.1_8 Forward -343 -333 11.0914 0.0391
NP_442554.1_8 Reverse -336 -346 4.20827 0.193
NP_440133.1_10 Reverse -32 -51 7.66927 0.181
NP_441762.1_7 Reverse -340 -352 12.4287 0.0142
NP_441762.1_7 Forward -351 -339 2.30059 0.0676
NP_442142.1_4 Reverse -338 -351 18.0132 0.0255
NP_442142.1_4 Forward -347 -334 10.0485 0.0806
NP_442142.1_4 Reverse -332 -345 9.16348 0.101
NP_442142.1_4 Forward -353 -340 6.0169 0.175
NP_442292.1_1 Forward -349 -340 18.486 0.00229
NP_442292.1_1 Reverse -342 -351 9.63616 0.0183
NP_442292.1_5 Forward -367 -348 -1.96717 0.273
NP_442476.1_6 Reverse -342 -356 12.9793 0.0454
NP_442476.1_6 Reverse -113 -127 2.85119 0.171
NP_442016.1_10 Reverse -290 -309 11.3075 0.259
NP_440895.1_6 Reverse -335 -348 9.85238 0.214
NP_441523.1_6 Reverse -160 -179 4.81767 0.25
NP_443009.1_5 Reverse -340 -351 18.3477 0.00265
NP_442406.1_1 Forward -153 -134 13.7649 0.185
NP_441715.1_4 Forward -349 -339 14.828 0.0268
NP_441715.1_4 Reverse -342 -352 9.32148 0.097
NP_441715.1_4 Forward -252 -242 4.50326 0.27
NP_440183.1_9 Forward -342 -323 -20.8467 0.292
NP_440379.1_5 Forward -353 -334 6.88262 0.133
NP_440379.1_5 Reverse -332 -351 -11.6036 0.299
NP_441468.1_1 Forward -349 -342 15.8704 0.0124
NP_441468.1_1 Reverse -342 -349 15.8704 0.0124
NP_441468.1_1 Reverse -336 -343 3.97235 0.277
NP_441468.1_1 Forward -343 -336 3.97235 0.277
NP_441020.2_6 Reverse -339 -356 9.08529 0.18
NP_441020.2_6 Forward -352 -335 7.11867 0.241
NP_441015.1_10 Reverse -336 -355 0.884433 0.164
NP_441015.1_10 Forward -355 -336 -3.04881 0.184
NP_441015.1_10 Forward -337 -318 -5.31042 0.221
NP_441015.1_10 Forward -349 -330 -8.85033 0.277
NP_441015.1_10 Forward -368 -349 -10.3253 0.284
NP_441673.1_1 Forward -350 -341 20.8459 0.000698
NP_441673.1_1 Reverse -341 -350 20.8459 0.000698
NP_441876.1_9 Forward -147 -137 10.5993 0.287
NP_441826.1_2 Reverse -335 -349 15.4376 0.0196
NP_441826.1_2 Forward -350 -336 2.75286 0.12
NP_441826.1_2 Forward -356 -342 1.17956 0.161
NP_442868.1_6 Reverse -339 -349 9.91146 0.038
NP_442868.1_6 Forward -352 -342 8.53483 0.0555
NP_442719.1_2 Forward -210 -192 -10.6996 0.28
NP_441056.1_1 Forward -350 -331 3.73603 0.131
NP_441612.1_2 Forward -350 -340 8.54929 0.21
NP_442227.1_2 Reverse -325 -344 -2.36049 0.272
NP_442361.1_3 Reverse -335 -348 8.47575 0.285
NP_442808.1_1 Forward -351 -341 18.4657 0.00201
NP_442808.1_1 Reverse -340 -350 8.63269 0.0481
NP_442808.1_1 Forward -145 -135 5.78111 0.141
NP_441101.1_1 Forward -352 -334 10.0489 0.286
NP_441101.1_10 Reverse -337 -356 3.73603 0.173
NP_440145.1_3 Reverse -234 -253 0.196116 0.137
NP_442820.1_10 Reverse -335 -353 14.0805 0.152
NP_442542.1_2 Forward -352 -339 21.0621 0.00555
NP_442542.1_9 Forward -357 -343 5.01387 0.279
NP_442050.1_5 Reverse -339 -349 16.4991 0.00812
NP_442050.1_5 Forward -352 -342 8.23937 0.234
NP_442342.1_9 Forward -352 -336 10.8749 0.126
NP_441114.1_3 Forward -209 -200 7.37455 0.239
NP_442977.1_2 Forward -58 -40 18.6229 0.24
NP_440558.1_2 Reverse -332 -351 10.7175 0.0935
NP_440558.1_2 Forward -353 -334 -2.75381 0.229
NP_442789.1_4 Forward -355 -336 -1.47551 0.219
NP_442789.1_4 Forward -352 -333 -7.67036 0.299
NP_441518.1_3 Forward -360 -341 -12.9802 0.264
NP_441518.1_3 Reverse -331 -350 -13.6686 0.264
NP_442792.1_8 Forward -355 -336 8.25926 0.205
NP_441878.1_6 Forward -351 -341 10.4031 0.0176
NP_441878.1_6 Reverse -340 -350 10.4031 0.0176
NP_441878.1_6 Reverse -334 -344 0.668351 0.139
NP_441878.1_6 Forward -345 -335 0.57002 0.14
NP_441036.1_8 Forward -351 -341 17.7779 0.000554
NP_441036.1_8 Forward -254 -244 8.73149 0.174
NP_441036.1_8 Reverse -340 -350 8.33817 0.174
NP_442650.1_2 Forward -350 -336 16.4209 0.0526
NP_441557.1_5 Forward -350 -341 19.9609 0.000699
NP_441557.1_5 Reverse -341 -350 19.9609 0.000699
NP_441557.1_5 Forward -253 -244 -0.786921 0.239
NP_441557.1_8 Forward -141 -131 14.0409 0.201
NP_441445.1_1 Forward -359 -340 13.9625 0.0527
NP_441445.1_1 Reverse -332 -351 0.491109 0.275
NP_441445.1_1 Reverse -126 -145 -0.0988766 0.286
NP_442777.1_1 Forward -143 -124 3.9319 0.3
NP_442419.1_2 Reverse -336 -355 7.37428 0.144
NP_442419.1_2 Forward -355 -336 0.786102 0.238
NP_442419.1_2 Forward -349 -330 0.786102 0.238
NP_440084.1_8 Reverse -178 -192 8.70139 0.299
NP_441739.1_2 Forward -110 -94 7.62932 0.205
NP_441308.1_8 Forward -352 -342 9.22315 0.226
NP_440101.1_3 Forward -355 -336 27.7288 0.000322
NP_440101.1_10 Forward -356 -337 4.81767 0.208
NP_441458.1_10 Reverse -332 -351 6.68596 0.197
NP_442183.1_1 Forward -350 -336 14.0609 0.037
NP_442183.1_1 Reverse -341 -355 8.75105 0.109
NP_442397.1_9 Forward -350 -331 15.8307 0.185
NP_441116.1_8 Reverse -58 -77 17.6007 0.188
NP_441549.1_9 Reverse -337 -355 0.412472 0.121
NP_441549.1_9 Forward -354 -336 -4.60241 0.198
NP_441238.1_10 Forward -337 -323 10.0294 0.292
NP_442347.1_2 Forward -349 -340 12.4878 0.056
NP_442347.1_2 Reverse -342 -351 11.1111 0.056
NP_442347.1_2 Reverse -113 -122 8.65285 0.0792
NP_442645.1_2 Forward -352 -333 0.687771 0.0487
NP_442645.1_2 Reverse -333 -352 -7.57203 0.11
NP_441037.1_4 Forward -352 -342 16.2838 0.0168
NP_441633.1_3 Reverse -339 -352 11.1307 0.0286
NP_441633.1_3 Forward -154 -141 -0.275709 0.142
NP_441633.1_3 Forward -352 -339 -3.81562 0.177
NP_440136.1_2 Forward -349 -342 15.9687 0.0123
NP_440136.1_2 Reverse -342 -349 15.9687 0.0123
NP_442590.1_10 Reverse -348 -367 8.16093 0.213
NP_442998.1_5 Forward -366 -356 7.94484 0.278
NP_442998.1_10 Forward -348 -341 15.5754 0.0102
NP_442998.1_10 Reverse -343 -350 15.5754 0.0102
NP_440299.1_1 Reverse -337 -350 22.3398 0.000547
NP_440299.1_1 Forward -354 -341 13.5883 0.0298
NP_441799.1_1 Forward -354 -340 14.0603 0.0274
NP_441799.1_1 Reverse -337 -351 7.86545 0.13
NP_441007.1_5 Forward -343 -324 13.5691 0.199
NP_441007.1_10 Forward -355 -342 4.24752 0.182
NP_441007.1_10 Reverse -336 -349 1.39592 0.203
NP_441449.1_8 Reverse -321 -340 17.5675 0.188
NP_440256.1_1 Reverse -338 -357 16.2241 0.0061
NP_440256.1_1 Reverse -294 -313 -6.98204 0.225
NP_442961.1_7 Reverse -342 -361 10.7175 0.263
NP_441512.1_4 Forward -354 -335 10.4225 0.237
NP_441559.1_8 Forward -355 -341 0.294584 0.169
NP_441559.1_8 Reverse -350 -364 -0.393733 0.175
NP_441559.1_8 Reverse -336 -350 -6.68692 0.279
NP_440915.1_6 Forward -354 -340 4.71948 0.0953
NP_440915.1_6 Reverse -337 -351 3.8345 0.1
NP_440915.1_6 Reverse -240 -254 -2.75368 0.28
NP_441866.1_4 Reverse -44 -57 12.175 0.293
NP_441704.1_8 Reverse -330 -349 12.9783 0.12
NP_442866.1_1 Forward -355 -336 7.66927 0.108
NP_441464.1_8 Reverse -341 -355 10.1277 0.183
NP_441939.1_3 Forward -349 -330 13.0775 0.0928
NP_441939.1_3 Reverse -342 -361 8.94757 0.159
NP_441199.1_6 Forward -354 -335 -1.47551 0.292
NP_442993.1_1 Forward -350 -334 -8.49626 0.168
NP_442386.1_9 Forward -351 -342 15.7322 0.0144
NP_442386.1_9 Reverse -340 -349 13.8639 0.0289
NP_442386.1_9 Forward -345 -336 12.2907 0.0676
NP_442386.1_9 Reverse -334 -343 12.1923 0.0704
NP_442386.1_10 Reverse -133 -146 14.6706 0.107
NP_441750.1_4 Reverse -337 -356 3.73603 0.231
NP_441340.1_5 Forward -349 -342 15.6737 0.0124
NP_441340.1_5 Reverse -342 -349 15.6737 0.0124
NP_441340.1_5 Reverse -336 -343 4.07068 0.239
NP_441340.1_5 Forward -343 -336 4.07068 0.239
NP_441947.1_10 Forward -352 -334 11.5239 0.15
NP_443028.1_4 Forward -58 -39 7.67428 0.293
NP_442791.1_5 Forward -358 -339 -8.26035 0.279
NP_440168.1_4 Reverse -331 -350 -5.60541 0.255
NP_440146.1_4 Reverse -192 -211 9.93088 0.129
NP_441254.1_1 Forward -112 -99 10.3434 0.295
NP_442240.1_1 Reverse -333 -352 3.34192 0.29
NP_440211.1_4 Forward -93 -83 13.5497 0.296
NP_440586.1_1 Forward -357 -338 -1.37718 0.237
NP_440586.1_8 Forward -349 -342 13.2151 0.026
NP_440586.1_8 Reverse -342 -349 13.2151 0.026
NP_440586.1_8 Forward -343 -336 7.61025 0.227
NP_440586.1_8 Reverse -336 -343 7.61025 0.227
NP_442251.1_6 Forward -349 -342 15.2804 0.0124
NP_442251.1_6 Reverse -342 -349 15.2804 0.0124
NP_442251.1_6 Forward -252 -245 9.77388 0.162
NP_440684.1_9 Reverse -335 -349 12.291 0.168
NP_441262.1_3 Reverse -341 -348 14.7888 0.0223
NP_441262.1_3 Forward -350 -343 14.7888 0.0223
NP_440027.1_3 Reverse -335 -353 5.52492 0.24
NP_440027.1_3 Reverse -341 -359 2.08335 0.293
NP_443051.1_1 Reverse -340 -349 10.4228 0.00754
NP_443051.1_1 Forward -351 -342 10.4228 0.00754
NP_443051.1_1 Forward -254 -245 0.0980582 0.226
NP_440451.1_10 Forward -349 -330 10.815 0.264
NP_439937.1_8 Forward -352 -333 6.4893 0.192
NP_439937.1_8 Forward -358 -339 -1.27885 0.249
NP_439937.1_8 Reverse -339 -358 -5.11376 0.286
NP_439937.1_9 Forward -145 -128 -1.14182 0.122
NP_439937.1_9 Reverse -353 -370 -4.97671 0.157
NP_439937.1_9 Reverse -340 -357 -6.45167 0.157
NP_440398.1_6 Reverse -82 -101 9.3409 0.214
NP_440398.1_6 Reverse -114 -133 5.30933 0.275
NP_440439.1_1 Forward -353 -340 11.9173 0.0288
NP_440439.1_1 Reverse -338 -351 7.29578 0.0664
NP_440439.1_1 Reverse -351 -364 -1.55401 0.273
NP_440372.1_2 Forward -349 -342 16.3621 0.0124
NP_440372.1_2 Reverse -342 -349 16.3621 0.0124
NP_440171.1_3 Forward -367 -348 2.75272 0.285
NP_441138.1_5 Forward -179 -166 11.9028 0.227
NP_440316.1_10 Reverse -334 -344 14.828 0.179
NP_440316.1_10 Reverse -134 -144 8.53483 0.239
NP_441803.1_2 Reverse -336 -355 17.3057 0.0309
NP_439977.1_5 Forward -356 -337 14.1591 0.0531
NP_440139.1_1 Forward -356 -337 15.4366 0.0474
NP_441572.1_7 Reverse -335 -354 1.96607 0.14
NP_442384.1_10 Forward -350 -337 17.4239 0.00585
NP_442384.1_10 Reverse -341 -354 10.2457 0.0465
NP_442114.1_4 Reverse -341 -352 12.1534 0.107
NP_442114.1_8 Reverse -165 -179 3.8339 0.281
NP_440364.1_6 Forward -351 -338 14.375 0.275
NP_440364.1_6 Reverse -334 -347 14.375 0.275
NP_441018.1_7 Forward -354 -335 8.06259 0.256
NP_442458.1_2 Forward -21 -2 10.3234 0.203
NP_442262.1_10 Forward -349 -342 14.1988 0.0123
NP_442262.1_10 Reverse -342 -349 14.1988 0.0123
NP_442262.1_10 Forward -343 -336 10.4622 0.145
NP_442262.1_10 Reverse -336 -343 10.4622 0.145
NP_441689.1_5 Reverse -339 -349 15.3192 0.0403
NP_441689.1_5 Reverse -110 -120 5.68278 0.215
NP_440163.1_10 Reverse -338 -348 12.4681 0.159
NP_440163.1_10 Reverse -332 -342 8.92815 0.256
NP_440344.1_10 Forward -357 -340 7.41366 0.0137
NP_440344.1_10 Reverse -334 -351 -0.256152 0.0402
NP_440282.1_10 Reverse -325 -344 -0.4922 0.21
NP_440282.1_10 Forward -354 -335 -6.68705 0.25
NP_441060.1_9 Reverse -341 -360 13.8641 0.175
NP_440189.1_2 Reverse -333 -352 4.12936 0.268
NP_440487.1_1 Forward -353 -334 -3.54046 0.214
NP_441965.1_3 Reverse -331 -350 4.81767 0.163
NP_441965.1_10 Forward -353 -337 11.9566 0.107
NP_441965.1_10 Forward -347 -331 7.04003 0.157
NP_440297.1_8 Forward -125 -107 12.2122 0.241
NP_440297.1_9 Forward -349 -339 9.32148 0.0917
NP_440297.1_9 Reverse -336 -346 0.865012 0.282
NP_440297.1_9 Forward -343 -333 -0.118297 0.282
NP_440297.1_9 Reverse -342 -352 -0.216628 0.282
NP_440350.1_1 Forward -108 -89 -5.50708 0.293
NP_441592.1_4 Forward -350 -331 -0.688862 0.246
NP_441896.1_3 Forward -359 -340 2.3594 0.197
NP_440894.1_10 Forward -355 -336 2.94938 0.279
NP_442067.1_4 Reverse -330 -349 6.88262 0.207
NP_442067.1_4 Forward -361 -342 3.83436 0.273
NP_440999.1_9 Forward -354 -340 12.1926 0.0414
NP_440999.1_9 Reverse -340 -354 -3.44199 0.293
NP_440888.1_2 Reverse -341 -355 18.0918 0.00261
NP_440888.1_2 Forward -350 -336 16.7152 0.00577
NP_440888.1_2 Reverse -297 -311 6.78381 0.22
NP_440803.1_3 Forward -366 -347 7.27595 0.219
NP_440491.1_1 Forward -353 -334 12.0823 0.157
NP_442277.1_4 Forward -359 -340 7.4718 0.146
NP_442033.1_10 Reverse -342 -361 -10.1286 0.228
NP_442033.1_10 Reverse -352 -371 -10.817 0.243
NP_440575.1_8 Reverse -176 -195 1.57275 0.173
NP_441759.1_2 Forward -352 -333 0.982764 0.219
NP_441917.1_2 Forward -347 -329 6.01734 0.288
NP_441543.1_2 Reverse -342 -351 18.486 0.00236
NP_441543.1_2 Forward -349 -340 16.9127 0.00359
NP_441543.1_2 Forward -343 -334 6.68623 0.142
NP_441543.1_3 Forward -145 -131 12.3887 0.163
NP_441543.1_3 Reverse -78 -92 10.3237 0.212
NP_442845.1_2 Reverse -335 -349 18.1908 0.0608
NP_442845.1_2 Forward -350 -336 16.4209 0.0636
NP_440380.1_5 Forward -325 -306 0.982764 0.299
NP_441551.1_5 Forward -354 -338 15.7908 0.0771
NP_441319.1_8 Reverse -335 -353 5.52568 0.277
NP_441469.1_8 Forward -351 -342 16.126 0.00797
NP_441469.1_8 Reverse -334 -343 13.6677 0.073
NP_441469.1_8 Reverse -340 -349 6.48957 0.227
NP_443064.1_3 Reverse -119 -138 9.14423 0.179
NP_443064.1_5 Reverse -336 -355 18.1225 0.198
NP_443064.1_6 Forward -350 -340 12.5669 0.0796
NP_442578.1_5 Forward -145 -126 1.27776 0.257
NP_442578.1_7 Forward -349 -342 14.5921 0.026
NP_442578.1_7 Reverse -342 -349 14.5921 0.026
NP_440220.1_4 Reverse -322 -341 1.27698 0.238
NP_441462.1_2 Forward -350 -340 11.5831 0.00406
NP_441462.1_2 Reverse -341 -351 11.5831 0.00406
NP_441462.1_2 Forward -253 -243 -0.216628 0.192
NP_441621.1_7 Forward -352 -338 6.48943 0.068
NP_441621.1_7 Reverse -339 -353 -3.34366 0.188
NP_443062.1_1 Forward -344 -326 5.91323 0.215
NP_443062.1_1 Forward -350 -332 4.06059 0.276
NP_443062.1_6 Reverse -289 -308 5.30933 0.206
NP_443062.1_6 Reverse -333 -352 4.71934 0.214
NP_442204.1_1 Reverse -337 -348 9.69511 0.0736
NP_442204.1_1 Forward -336 -325 -0.432984 0.299
NP_442204.1_5 Forward -360 -341 0.491109 0.261
NP_440516.1_8 Forward -350 -341 16.9127 0.00442
NP_440516.1_8 Reverse -341 -350 16.9127 0.00442
NP_440516.1_8 Reverse -335 -344 -0.590259 0.283
NP_442428.1_4 Forward -351 -332 5.11266 0.222
NP_442428.1_5 Forward -349 -342 15.8704 0.0124
NP_442428.1_5 Reverse -342 -349 15.8704 0.0124
NP_442428.1_5 Forward -343 -336 4.36568 0.271
NP_442428.1_5 Reverse -336 -343 4.36568 0.271
NP_442120.1_10 Forward -356 -337 -7.17871 0.217
NP_441867.1_2 Forward -99 -80 -12.9802 0.276
NP_441867.1_2 Reverse -92 -111 -13.5702 0.277
NP_440673.1_2 Forward -354 -335 13.6088 0.109
NP_440673.1_3 Forward -348 -341 12.4288 0.0426
NP_440673.1_3 Reverse -343 -350 12.4288 0.0426
NP_440865.1_9 Reverse -335 -354 -2.55715 0.184
NP_441052.1_2 Forward -350 -340 19.9412 0.00106
NP_441052.1_2 Reverse -341 -351 10.5014 0.0285
NP_441052.1_2 Forward -344 -334 4.89658 0.14
NP_441052.1_2 Reverse -335 -345 4.0116 0.168
NP_442219.1_9 Forward -349 -340 17.7976 0.00718
NP_442219.1_9 Reverse -342 -351 8.35786 0.0681
NP_440436.1_4 Reverse -342 -351 18.1905 0.00233
NP_440436.1_4 Forward -349 -340 17.2072 0.00233
NP_440436.1_4 Forward -343 -334 5.70251 0.186
NP_441884.1_9 Forward -353 -334 -12.8819 0.138
NP_441884.1_9 Reverse -338 -357 -21.24 0.235
NP_441884.1_9 Reverse -323 -342 -23.5016 0.284
NP_442907.1_9 Reverse -336 -355 2.3594 0.171
NP_441719.1_4 Forward -349 -342 16.3621 0.0124
NP_441719.1_4 Reverse -342 -349 16.3621 0.0124
NP_441733.1_10 Reverse -338 -351 7.49244 0.153
NP_441004.1_1 Reverse -196 -215 -11.3086 0.237
NP_441004.1_1 Forward -350 -331 -11.5053 0.24
NP_441004.1_1 Forward -97 -78 -15.7335 0.277
NP_441004.1_4 Reverse -199 -209 14.6313 0.175
NP_441004.1_5 Reverse -198 -212 8.06273 0.278
NP_441004.1_5 Reverse -129 -143 7.27608 0.292
NP_442366.1_3 Forward -351 -333 15.4571 0.0205
NP_440296.1_10 Forward -356 -337 -14.3569 0.269
NP_442694.1_3 Forward -354 -336 -4.11075 0.265
NP_442694.1_4 Reverse -192 -201 13.3727 0.225
NP_442206.1_7 Reverse -333 -352 10.7175 0.295
NP_442854.1_6 Reverse -335 -354 0.491109 0.296
NP_443054.1_2 Reverse -339 -353 12.1926 0.0722
NP_441851.1_10 Forward -351 -341 16.008 0.00552
NP_441851.1_10 Reverse -340 -350 15.8113 0.00552
NP_441851.1_10 Forward -122 -112 4.10993 0.287
NP_442622.1_5 Forward -352 -333 -2.75381 0.171
NP_441542.1_4 Forward -285 -271 3.63784 0.267
NP_442856.1_7 Reverse -332 -351 3.44104 0.149
NP_442856.1_7 Forward -353 -334 -2.95047 0.239
NP_442856.1_7 Forward -359 -340 -3.3438 0.243
NP_442515.1_1 Reverse -340 -354 4.62115 0.107
NP_441683.1_7 Forward -91 -72 -7.08038 0.272
NP_440593.1_3 Forward -355 -336 -2.36049 0.224
NP_440593.1_3 Reverse -336 -355 -5.01543 0.256
NP_440593.1_3 Forward -349 -330 -6.29373 0.272
NP_440593.1_9 Reverse -338 -352 10.0294 0.24
NP_441982.1_6 Forward -205 -196 10.862 0.291
NP_441046.1_2 Forward -337 -318 -0.0988766 0.276
NP_440940.1_7 Forward -360 -342 7.88485 0.193
NP_441349.1_10 Reverse -331 -350 -0.295539 0.0936
NP_442843.1_1 Forward -343 -324 8.94757 0.116
NP_442843.1_1 Forward -97 -78 -0.4922 0.186
NP_442843.1_1 Forward -370 -351 -11.5053 0.291
NP_439960.1_4 Forward -351 -332 12.1917 0.291
NP_439960.1_10 Reverse -334 -352 14.7688 0.0769
NP_440474.1_8 Reverse -342 -356 17.3052 0.0432
NP_440431.1_3 Forward -212 -193 -10.4236 0.275
NP_442450.1_5 Reverse -339 -349 9.32148 0.115
NP_440588.1_2 Reverse -332 -351 16.0274 0.012
NP_439950.1_1 Forward -92 -83 16.0277 0.145
NP_442006.1_2 Forward -344 -327 -7.53264 0.176
NP_442006.1_2 Reverse -135 -152 -17.4641 0.276
NP_442006.1_2 Reverse -326 -343 -17.5624 0.279
NP_441003.1_9 Reverse -326 -345 11.9958 0.213
NP_443047.1_6 Reverse -328 -347 15.5357 0.266
NP_440483.1_1 Forward -103 -84 5.11266 0.154
NP_440483.1_1 Reverse -88 -107 -3.04881 0.21
NP_440483.1_1 Forward -135 -116 -7.08038 0.258
NP_441570.1_1 Forward -350 -332 10.3439 0.00901
NP_441570.1_1 Reverse -341 -359 -7.25734 0.0879
NP_441570.1_1 Reverse -335 -353 -8.92897 0.124
NP_440078.1_4 Reverse -330 -349 11.8975 0.234
NP_440078.1_10 Forward -350 -331 3.53937 0.262
NP_441078.1_4 Forward -350 -341 19.6659 0.0007
NP_441078.1_4 Reverse -341 -350 19.6659 0.0007
NP_441078.1_4 Reverse -335 -344 -1.6719 0.266
NP_441078.1_4 Forward -344 -335 -1.77023 0.266
NP_442729.1_8 Reverse -337 -350 8.37742 0.125
NP_442443.1_1 Forward -340 -321 -6.58872 0.295
NP_440526.1_3 Forward -349 -338 7.92465 0.126
NP_440526.1_3 Reverse -342 -353 2.41814 0.267
NP_441432.1_5 Reverse -111 -125 7.27608 0.272
NP_441432.1_8 Reverse -340 -349 16.8143 0.00595
NP_441432.1_8 Forward -351 -342 8.25953 0.0755
NP_442320.1_8 Reverse -335 -349 5.70279 0.0334
NP_442320.1_8 Forward -356 -342 -0.492064 0.0817
NP_442344.1_7 Forward -116 -97 -10.4236 0.3
NP_441732.1_2 Reverse -337 -353 12.0549 0.00594
NP_441732.1_2 Forward -354 -338 -16.2644 0.165
NP_440497.1_2 Forward -349 -330 4.52268 0.29
NP_442540.1_8 Forward -46 -27 14.8474 0.279
NP_440760.1_1 Forward -350 -331 12.0942 0.0104
NP_440760.1_1 Reverse -341 -360 -14.5535 0.133
NP_442797.1_7 Reverse -353 -371 19.6853 0.0606
NP_442797.1_7 Forward -357 -339 5.82068 0.216
NP_442797.1_7 Reverse -334 -352 4.83737 0.217
NP_440199.1_10 Reverse -338 -348 7.64985 0.231
NP_440199.1_10 Reverse -205 -215 6.76487 0.269
NP_441805.1_6 Forward -340 -321 14.6508 0.19
NP_442510.1_5 Reverse -332 -351 13.3725 0.229
NP_442400.1_10 Forward -278 -265 14.3856 0.173
NP_440713.1_4 Reverse -331 -350 22.9106 0.0065
NP_440713.1_4 Forward -360 -341 4.916 0.219
NP_442489.1_2 Reverse -324 -343 4.32602 0.22
NP_442489.1_7 Forward -350 -341 20.1576 0.000695
NP_442489.1_7 Reverse -341 -350 20.1576 0.000695
NP_442489.1_7 Reverse -335 -344 -1.6719 0.235
NP_442489.1_7 Forward -344 -335 -1.77023 0.247
NP_442079.1_6 Reverse -333 -352 12.8808 0.283
NP_442079.1_7 Forward -343 -324 1.0811 0.263
NP_440559.1_1 Forward -349 -340 17.4043 0.00658
NP_440559.1_1 Reverse -342 -351 8.75118 0.0586
NP_441659.2_8 Forward -350 -340 18.1713 0.00133
NP_441659.2_8 Reverse -341 -351 11.9764 0.0147
NP_441659.2_8 Reverse -244 -254 5.48657 0.106
NP_440426.1_7 Reverse -234 -253 -0.295539 0.297
NP_442913.1_10 Forward -226 -207 -5.01543 0.254
NP_441040.1_2 Reverse -346 -365 -5.11376 0.174
NP_441040.1_5 Reverse -330 -349 9.24257 0.226
NP_440708.1_6 Reverse -346 -365 -9.047 0.26
NP_440442.1_3 Forward -357 -343 16.3225 0.242
NP_440779.1_5 Reverse -341 -358 -14.2191 0.243
NP_442346.1_5 Reverse -340 -350 16.6963 0.00248
NP_442346.1_5 Forward -345 -335 10.8948 0.0813
NP_442346.1_5 Forward -351 -341 9.02648 0.118
NP_442346.1_5 Reverse -201 -211 8.1415 0.146
NP_442346.1_10 Reverse -339 -358 3.44104 0.194
NP_440352.1_5 Reverse -163 -182 10.417 0.275
NP_440545.1_3 Reverse -337 -354 13.6085 0.0167
NP_440545.1_3 Forward -354 -337 9.77361 0.0374
NP_440831.1_3 Reverse -332 -351 20.2692 0.0338
NP_440831.1_3 Forward -353 -334 8.52284 0.223
NP_441629.1_3 Reverse -79 -98 -4.1312 0.29
NP_440486.1_6 Forward -351 -332 12.0942 0.207
NP_440010.1_3 Reverse -219 -238 -2.36049 0.25
NP_440010.1_3 Forward -362 -343 -4.81876 0.25
NP_440010.1_4 Reverse -331 -350 14.3549 0.157
NP_440010.1_4 Forward -354 -335 10.815 0.157
NP_440010.1_4 Reverse -337 -356 -2.26292 0.279
NP_442551.1_4 Reverse -141 -156 6.76473 0.179
NP_442603.1_7 Forward -350 -336 11.7003 0.113
NP_442603.1_7 Reverse -112 -126 6.58715 0.236
NP_441888.1_9 Forward -344 -325 15.2389 0.26
NP_441833.1_4 Forward -349 -342 15.9687 0.0124
NP_441833.1_4 Reverse -342 -349 15.9687 0.0124
NP_441833.1_4 Forward -252 -245 11.0522 0.0559
NP_442162.1_8 Forward -356 -337 -2.55715 0.291
NP_442162.1_9 Forward -349 -342 16.2637 0.0124
NP_442162.1_9 Reverse -342 -349 16.2637 0.0124
NP_440671.1_4 Reverse -335 -349 22.1241 0.00197
NP_442404.1_9 Reverse -115 -129 10.1271 0.263
NP_440772.1_6 Forward -343 -324 8.06259 0.292
NP_442045.1_5 Reverse -332 -351 6.39097 0.202
NP_442073.1_6 Reverse -332 -351 -3.63879 0.291
NP_442140.1_3 Reverse -342 -352 17.4829 0.0159
NP_442140.1_3 Forward -343 -333 11.3864 0.0767
NP_442140.1_3 Forward -349 -339 4.40493 0.243
NP_440875.1_9 Reverse -343 -353 15.2829 0.0295
NP_441813.1_5 Reverse -339 -349 15.9097 0.01
NP_441813.1_5 Forward -352 -342 10.0098 0.0208
NP_441227.1_6 Forward -365 -346 12.2908 0.293
NP_440590.1_4 Reverse -342 -355 12.2123 0.0156
NP_440590.1_4 Forward -349 -336 4.14919 0.0632
NP_440567.1_1 Reverse -342 -356 23.009 0.00964
NP_440567.1_1 Forward -349 -335 13.0776 0.0213
NP_442497.1_10 Forward -349 -340 10.4228 0.0087
NP_442497.1_10 Reverse -342 -351 10.4228 0.0087
NP_440821.1_4 Forward -352 -342 18.7612 0.00422
NP_440821.1_4 Reverse -339 -349 18.2696 0.00448
NP_441239.1_9 Forward -352 -340 16.0669 0.0175
NP_441239.1_9 Forward -146 -134 8.6921 0.125
NP_441239.1_9 Reverse -339 -351 6.92215 0.173
NP_441239.1_9 Forward -346 -334 6.72548 0.178
NP_440542.1_8 Forward -205 -192 16.3422 0.288
NP_441727.1_3 Forward -357 -338 5.40766 0.254
NP_441727.1_8 Forward -355 -336 3.93269 0.197
NP_441892.1_1 Reverse -332 -349 4.07041 0.116
NP_441892.1_1 Forward -353 -336 1.8088 0.147
NP_441892.1_1 Forward -359 -342 -0.846137 0.192
NP_441892.1_1 Reverse -326 -343 -2.22277 0.219
NP_442193.1_8 Forward -353 -334 13.9616 0.211
NP_442270.1_9 Reverse -330 -349 -7.08038 0.213
NP_441541.1_7 Reverse -162 -180 14.2034 0.189
NP_442216.1_4 Forward -150 -142 8.1805 0.255
NP_442216.1_4 Reverse -83 -91 8.1805 0.255
NP_443035.1_10 Forward -342 -325 5.44704 0.273
NP_442138.1_10 Forward -350 -331 -3.73712 0.242
NP_442052.1_7 Forward -368 -354 14.8476 0.199
NP_440546.1_4 Reverse -341 -351 11.8882 0.0679
NP_440546.1_4 Forward -350 -340 10.046 0.109
NP_440546.1_4 Reverse -335 -345 8.97947 0.16
NP_440546.1_4 Reverse -244 -254 8.6886 0.176
NP_440546.1_4 Forward -344 -334 6.94336 0.269
NP_441230.1_5 Forward -355 -336 16.6174 0.0583
NP_441230.1_5 Reverse -349 -368 0.196116 0.273
NP_440675.1_3 Forward -344 -325 6.88262 0.261
NP_440462.1_6 Forward -352 -342 17.9746 0.00578
NP_440462.1_6 Reverse -339 -349 7.74818 0.0699
NP_442465.1_9 Forward -200 -186 8.55439 0.298
NP_441184.1_5 Reverse -324 -343 13.4708 0.13
NP_440868.1_4 Forward -354 -342 19.6068 0.00963
NP_440868.1_4 Reverse -337 -349 6.1355 0.0878
NP_442479.1_9 Forward -290 -271 -4.22878 0.25
NP_441582.1_5 Reverse -277 -296 3.44025 0.266
NP_441474.1_1 Reverse -325 -344 1.27698 0.247
NP_439948.1_2 Forward -58 -40 17.095 0.259
NP_440696.1_3 Forward -354 -336 14.7688 0.0717
NP_442882.1_8 Forward -93 -74 22.0256 0.0151
NP_442039.1_4 Forward -349 -342 15.1821 0.0124
NP_442039.1_4 Reverse -342 -349 15.1821 0.0124
NP_442039.1_7 Reverse -95 -105 12.1731 0.257
NP_441811.1_8 Forward -356 -342 8.06273 0.238
NP_441811.1_8 Reverse -335 -349 7.47274 0.243
NP_442679.1_1 Reverse -161 -180 -3.44213 0.255
NP_440825.1_6 Reverse -192 -211 10.3242 0.285
NP_442696.1_6 Forward -147 -128 -3.44213 0.149
NP_442696.1_6 Reverse -76 -95 -11.7019 0.235
NP_442837.1_3 Forward -349 -342 15.7721 0.0124
NP_442837.1_3 Reverse -342 -349 15.7721 0.0124
NP_442837.1_3 Reverse -113 -120 6.52896 0.2
NP_440160.1_2 Forward -365 -346 -7.96535 0.286
NP_442053.1_1 Forward -350 -341 18.3876 0.0007
NP_442053.1_1 Reverse -341 -350 18.3876 0.0007
NP_440505.1_3 Reverse -339 -349 16.303 0.00696
NP_440505.1_3 Forward -352 -342 14.1397 0.0235
NP_440351.1_1 Forward -140 -121 -3.93378 0.271
NP_440351.1_8 Forward -108 -90 10.4422 0.177
NP_441536.1_4 Forward -330 -312 12.6055 0.107
NP_441203.1_1 Forward -349 -330 -20.2567 0.297
NP_442532.1_7 Reverse -341 -355 8.06273 0.171
NP_442009.1_9 Reverse -90 -109 7.7676 0.278
NP_441408.2_7 Forward -352 -333 9.73422 0.0989
NP_440914.1_1 Forward -350 -340 17.5935 0.000537
NP_440914.1_1 Forward -306 -296 9.39583 0.186
NP_440914.1_1 Reverse -341 -351 8.6151 0.186
NP_441011.1_8 Reverse -342 -351 16.9127 0.00602
NP_441011.1_8 Forward -349 -340 8.25953 0.144
NP_442533.1_1 Reverse -124 -143 -14.7502 0.247
NP_442533.1_1 Reverse -126 -145 -16.2252 0.263
NP_442533.1_6 Forward -350 -341 17.2076 0.00137
NP_442533.1_6 Reverse -341 -350 17.2076 0.00137
NP_442533.1_6 Reverse -335 -344 7.17789 0.0948
NP_442533.1_6 Forward -344 -335 6.68623 0.105
NP_442232.1_3 Reverse -333 -352 -6.88371 0.193
NP_442232.1_3 Forward -358 -339 -12.7836 0.282
NP_442322.1_4 Reverse -78 -95 -8.61494 0.286
NP_443016.1_1 Reverse -329 -348 -8.06369 0.289
NP_441482.1_7 Reverse -335 -349 10.1277 0.0135
NP_439944.1_9 Forward -349 -339 19.0562 0.00329
NP_439944.1_9 Reverse -342 -352 10.4031 0.0887
NP_441697.1_5 Forward -193 -174 -0.812105 0.204
NP_441527.1_4 Forward -59 -40 -13.1306 0.298
NP_440115.1_6 Forward -353 -343 9.61647 0.115
NP_440115.1_6 Reverse -338 -348 9.41981 0.115
NP_440115.1_6 Forward -124 -114 5.68323 0.227
NP_440115.1_6 Forward -366 -356 4.79825 0.282
NP_440007.1_9 Reverse -337 -351 1.86788 0.282
NP_439965.1_1 Reverse -332 -351 6.58763 0.076
NP_439965.1_1 Forward -359 -340 -5.80207 0.211
NP_441680.1_1 Forward -236 -217 27.3355 0.00155
NP_441680.1_2 Forward -32 -17 24.661 0.0188
NP_441680.1_10 Forward -207 -188 21.0193 0.175
NP_440608.1_2 Forward -367 -348 6.09597 0.231
NP_441602.1_3 Reverse -336 -355 0.294447 0.217
NP_441602.1_3 Forward -355 -336 -0.590531 0.224
NP_441972.1_5 Forward -349 -330 -3.3438 0.199
NP_441106.1_1 Forward -351 -342 18.191 0.0028
NP_441106.1_1 Reverse -340 -349 9.63616 0.0311
NP_441106.1_1 Forward -254 -245 5.40793 0.151
NP_441106.1_1 Reverse -334 -343 5.21127 0.167
NP_440429.1_2 Reverse -336 -355 8.35759 0.272
NP_439903.1_6 Forward -353 -334 7.07848 0.164
NP_442588.1_8 Forward -135 -116 15.1424 0.238
NP_440797.1_2 Reverse -330 -349 11.9854 0.284
NP_441286.1_1 Reverse -340 -352 14.7886 0.00418
NP_441286.1_1 Forward -351 -339 11.8387 0.0114
NP_442674.1_3 Reverse -333 -352 6.78348 0.228
NP_440670.1_8 Forward -350 -341 18.3876 0.000699
NP_440670.1_8 Reverse -341 -350 18.3876 0.000699
NP_441479.1_1 Forward -340 -321 20.1573 0.0605
NP_441930.1_3 Forward -60 -41 5.65597 0.263
NP_440886.1_7 Forward -351 -341 17.7774 0.0011
NP_440886.1_7 Reverse -340 -350 7.94438 0.0805
NP_440886.1_7 Reverse -334 -344 6.46942 0.123
NP_440886.1_7 Forward -143 -133 4.30615 0.243
NP_442614.1_2 Forward -350 -336 8.16106 0.255
NP_442382.1_5 Forward -368 -349 16.7157 0.15
NP_442072.1_9 Reverse -340 -358 -21.9087 0.215
NP_440907.2_8 Reverse -342 -352 17.4824 0.00685
NP_440907.2_8 Forward -141 -131 4.01116 0.283
NP_442264.1_2 Forward -354 -337 5.44704 0.276
NP_442264.1_5 Forward -350 -336 11.7993 0.253
NP_441463.1_3 Forward -360 -341 -10.6203 0.299
NP_441463.1_6 Reverse -339 -353 15.5961 0.151
NP_441626.1_2 Forward -349 -342 15.7721 0.0124
NP_441626.1_2 Reverse -342 -349 15.7721 0.0124
NP_442365.1_7 Reverse -337 -356 22.8122 0.0169
NP_440107.1_5 Forward -351 -332 -0.4922 0.178
NP_440107.1_5 Reverse -340 -359 -0.885524 0.178
NP_440107.1_5 Reverse -334 -353 -1.7705 0.178
NP_442794.1_1 Reverse -337 -349 19.7052 0.00523
NP_442615.1_1 Forward -359 -341 1.10079 0.0906
NP_441962.1_4 Forward -349 -330 -0.787193 0.117
NP_441962.1_4 Forward -355 -336 -5.01543 0.163
NP_441962.1_4 Reverse -336 -355 -5.50708 0.169
NP_440387.1_1 Reverse -341 -357 15.4965 0.00544
NP_440387.1_1 Forward -350 -334 13.3332 0.00865
NP_441431.1_2 Forward -353 -339 10.6187 0.158
NP_441836.1_2 Forward -356 -337 18.1907 0.0346
NP_441836.1_2 Reverse -338 -357 -3.24547 0.236
NP_441993.1_1 Forward -350 -331 10.4255 0.126
NP_441993.1_1 Reverse -335 -354 6.91701 0.177
NP_439938.1_3 Reverse -352 -371 17.0656 0.227
NP_441174.1_1 Reverse -126 -141 11.4846 0.247
NP_441174.1_2 Reverse -338 -352 18.5841 0.023
NP_440114.1_10 Reverse -341 -355 14.0609 0.0446
NP_442090.1_10 Forward -88 -75 12.999 0.179
NP_441817.1_1 Forward -339 -321 13.0972 0.271
NP_442698.1_10 Reverse -161 -180 -0.39387 0.297
NP_442323.1_7 Reverse -349 -368 4.12856 0.224
NP_442324.1_3 Reverse -335 -354 14.2574 0.194
NP_440293.1_3 Reverse -333 -352 -1.96717 0.239
NP_440766.1_4 Reverse -337 -351 17.5025 0.0255
NP_439988.1_7 Reverse -343 -357 18.2885 0.292
NP_439988.1_7 Forward -38 -24 15.0436 0.292
NP_439988.1_7 Forward -351 -337 11.5037 0.292
NP_441979.1_5 Reverse -335 -354 -12.6852 0.228
NP_442743.1_5 Forward -349 -330 11.0125 0.142
NP_442743.1_5 Reverse -342 -361 6.58763 0.18
NP_439998.1_9 Forward -211 -192 16.5191 0.175
NP_442867.1_8 Reverse -118 -137 7.47261 0.244
NP_440457.1_1 Forward -354 -342 9.77374 0.092
NP_440457.1_1 Reverse -337 -349 8.29878 0.101
NP_440457.1_1 Reverse -131 -143 0.0389777 0.25
NP_440798.1_6 Reverse -342 -355 12.3107 0.0468
NP_440801.1_8 Forward -351 -332 2.75272 0.229
NP_440801.1_8 Forward -250 -231 -1.27885 0.276
NP_440054.1_7 Reverse -329 -348 13.9625 0.222
NP_441332.1_10 Forward -368 -353 9.61633 0.252
NP_440473.1_3 Reverse -336 -355 13.9625 0.289
NP_442509.1_9 Reverse -341 -351 16.2041 0.00739
NP_442509.1_9 Forward -350 -340 8.14104 0.192
NP_441253.1_1 Reverse -325 -344 4.62101 0.276
NP_440554.1_4 Reverse -342 -352 13.943 0.0218
NP_440554.1_4 Forward -252 -242 7.25653 0.106
NP_440554.1_4 Forward -349 -339 7.05986 0.106
NP_441885.1_5 Forward -350 -340 20.9245 0.000538
NP_441885.1_5 Reverse -341 -351 11.4848 0.00668
NP_441275.1_3 Reverse -269 -283 22.0257 0.0286
NP_440478.1_10 Forward -352 -338 7.47274 0.262
NP_440478.1_10 Reverse -333 -347 6.6861 0.288
NP_442703.1_1 Reverse -159 -178 5.39487 0.283
NP_442310.1_1 Reverse -333 -352 10.7175 0.284
NP_442341.1_7 Forward -351 -337 16.1259 0.0186
NP_442341.1_7 Reverse -340 -354 11.8976 0.0502
NP_442341.1_9 Forward -352 -338 10.3237 0.135
NP_442341.1_9 Reverse -333 -347 5.30886 0.274
NP_441756.1_5 Reverse -352 -371 -2.95047 0.287
NP_442395.2_4 Forward -351 -332 15.4366 0.0507
NP_442534.1_7 Forward -351 -332 5.70265 0.292
NP_440750.1_5 Forward -289 -275 4.42448 0.294
NP_440423.1_10 Forward -260 -241 9.93088 0.259
NP_443000.1_7 Reverse -339 -349 17.0896 0.00865
NP_443000.1_7 Reverse -295 -305 4.69992 0.176
NP_443000.1_7 Forward -352 -342 2.04498 0.226
NP_440076.1_5 Reverse -334 -353 11.8967 0.291
NP_440507.2_3 Reverse -332 -351 13.5683 0.145
NP_440507.2_3 Forward -353 -334 7.66846 0.273
NP_441842.1_1 Reverse -343 -356 16.2433 0.0484
NP_441842.1_10 Forward -357 -343 18.3875 0.0173
NP_440275.1_3 Forward -352 -342 17.9746 0.0082
NP_440275.1_3 Reverse -339 -349 8.1415 0.0602
NP_440091.1_1 Forward -354 -342 19.6068 0.0114
NP_440091.1_1 Reverse -337 -349 -0.452677 0.273
NP_441902.1_3 Reverse -162 -172 13.8563 0.226
NP_440679.1_5 Forward -347 -328 17.0107 0.0872
NP_440679.1_10 Forward -342 -323 -6.58872 0.162
NP_441359.1_5 Reverse -351 -370 9.14423 0.159
NP_442451.1_2 Reverse -333 -352 5.60432 0.119
NP_442451.1_2 Forward -358 -339 -9.14533 0.259
NP_439962.1_4 Reverse -117 -136 4.42435 0.179
NP_439962.1_4 Reverse -333 -352 0.786102 0.197
NP_439962.1_4 Reverse -346 -365 -0.0988766 0.197
NP_439962.1_4 Forward -352 -333 -4.42544 0.269
NP_439962.1_4 Forward -358 -339 -6.98204 0.286
NP_440149.1_8 Forward -350 -331 10.9142 0.0445
NP_440149.1_8 Reverse -341 -360 -2.26216 0.166
NP_440149.1_8 Reverse -335 -354 -5.9004 0.235
NP_441875.1_7 Reverse -98 -108 15.418 0.227
NP_441105.1_3 Reverse -330 -349 13.7658 0.027
NP_441105.1_3 Forward -361 -342 -3.63879 0.184
NP_440216.1_1 Reverse -341 -355 7.86607 0.00793
NP_440216.1_1 Forward -350 -336 -10.4235 0.145
NP_440216.1_1 Forward -253 -239 -11.8001 0.219
NP_440172.1_1 Forward -350 -340 15.0247 0.00945
NP_440172.1_1 Reverse -341 -351 8.73149 0.0586
NP_440172.1_1 Reverse -335 -345 3.61828 0.222
NP_440167.1_3 Forward -354 -335 9.63589 0.247
NP_442015.1_10 Reverse -337 -350 18.8988 0.00492
NP_442015.1_10 Forward -354 -341 3.16588 0.185
NP_442015.1_10 Forward -348 -335 -0.177378 0.255
NP_441045.1_1 Reverse -166 -185 14.0608 0.26
NP_441226.1_7 Forward -349 -342 14.4934 0.0123
NP_441226.1_7 Reverse -342 -349 14.4934 0.0123
NP_440413.1_10 Forward -397 -378 14.6508 0.266
NP_441111.1_7 Forward -349 -341 18.7023 0.00294
NP_441111.1_7 Reverse -342 -350 18.7023 0.00294
NP_442379.1_10 Reverse -334 -351 -1.43612 0.223
NP_442379.1_10 Forward -357 -340 -1.92778 0.224
NP_441766.1_2 Forward -350 -341 17.5026 0.00297
NP_441766.1_2 Reverse -341 -350 17.5026 0.00297
NP_440416.1_9 Reverse -334 -353 2.65439 0.0394
NP_440416.1_9 Forward -357 -338 -14.8485 0.18
NP_440416.1_9 Reverse -333 -352 -18.2901 0.256
NP_443052.1_8 Forward -360 -341 -6.09707 0.141
NP_442116.1_6 Reverse -1 -18 13.994 0.172
NP_442116.1_6 Forward -18 -1 8.64641 0.244
NP_440591.1_9 Reverse -334 -352 12.3105 0.0935
NP_442154.1_1 Forward -343 -325 -6.76569 0.141
NP_442154.1_6 Reverse -334 -353 2.16274 0.234
NP_441430.1_6 Forward -355 -336 15.6341 0.136
NP_440261.1_5 Reverse -342 -355 -2.73398 0.0924
NP_440261.1_5 Reverse -113 -126 -3.52063 0.135
NP_440261.1_5 Forward -349 -336 -10.5021 0.201
NP_440988.1_10 Reverse -339 -353 10.2235 0.187
NP_440988.1_10 Forward -346 -332 9.93309 0.19
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTAACCCAGATACGTCAACAATTACAACAGGTGCGGGGCCAATCCGGGGCGGCGATCGCCATGGCCGAGTTGGTGGCAGAACAAATTGCGGTCCAGCAAACACCAGTTAGGATGAGTTTGACAAAATAGCTAGCAACTTAGAAAATAGAAGATCGCTTGTCAACTATCCCGCTCGGATCAGGTTACGACAACCATTACCCAAAAATGCCAGAGCTTAATATTTTTCTGTTGTTTCCCTAGGATCTGTTTGTAATGCCCCCCTAGCCCCCCAATTCTGGGGGGGATCAATTTCAAAGTCCCCCAACGTTGGGGGATTTAGGGGGCAGAGTTAACAAGTTCCTCAAATAAACCAGAAAACTTAACGGCGGCATACCTGTACGGCAATTTACGCAAATAAATT

CDS

ATGAGTTACGCCATTATTGAAATTGGGGGAACCCAAATTCGGGTTGAGCCCGGCCGTTTTTACGAGATTAACCACCTCGACGCCGCACCGGAAGACAGCTATGTGGTCGATAAGGTGTTGCTAGTCAAAGACGGAGACAATGTCACCATTGGCCAGCCCTACGTCGCTGGAGCCACTGTAGAAGGGGAAATTCTCTCCCACCGTCGGGGTCGCAAAGTCATCGTCTACAAAATGCAACCCAAAAAGAAAACCCGCAAAAAACGGGGTCACCGCCAAGAGCTCACCCGCCTATTGGTGAAATCCATCTCCGTCAACGGCACGGCGATCGCCGAGGCCCTCGAAGTGGATGCTAAAACCCCAGTGGTGGCTGGTTAA

Protein

MSYAIIEIGGTQIRVEPGRFYEINHLDAAPEDSYVVDKVLLVKDGDNVTIGQPYVAGATVEGEILSHRRGRKVIVYKMQPKKKTRKKRGHRQELTRLLVKSISVNGTAIAEALEVDAKTPVVAG