Your browser is old and dusty. Try Google Chrome!

Details for slr1667

ORF slr1667
Accession NP_442978.1
Symbol
Category hypothetical protein (target gene of sycrp1)
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_8 Forward -26 -9 8.88863 0.242
NP_440226.1_1 Reverse -340 -359 1.76941 0.29
NP_443002.1_5 Forward -71 -53 8.27817 0.297
NP_439997.1_4 Reverse -123 -142 6.39097 0.266
NP_440631.1_9 Reverse -323 -342 9.54094 0.3
NP_442972.1_1 Forward -167 -149 7.48186 0.291
NP_441083.1_5 Reverse -250 -260 2.63497 0.193
NP_441434.1_1 Forward -155 -141 9.6563 0.24
NP_442889.1_10 Forward -102 -83 11.6785 0.239
NP_441387.1_5 Reverse -61 -80 19.7422 0.164
NP_442848.1_1 Forward -265 -251 -0.393733 0.263
NP_442687.1_1 Forward -163 -150 15.0633 0.243
NP_441077.1_6 Forward -166 -150 8.00784 0.216
NP_441077.1_6 Forward -333 -317 1.8378 0.294
NP_441846.1_10 Forward -29 -10 -14.8485 0.24
NP_441846.1_10 Forward -26 -7 -23.01 0.275
NP_442205.1_9 Forward -17 -1 -1.51476 0.264
NP_441256.1_2 Reverse -17 -36 4.42435 0.299
NP_441317.1_4 Reverse -77 -91 10.0369 0.29
NP_439975.1_2 Reverse -335 -353 7.19731 0.226
NP_442002.1_1 Forward -28 -10 -0.177514 0.192
NP_441041.1_4 Forward -59 -40 -12.6852 0.272
NP_440983.1_5 Forward -37 -18 -0.0988766 0.22
NP_441644.1_6 Reverse -16 -26 3.32285 0.288
NP_442247.1_5 Forward -357 -343 14.582 0.234
NP_442933.1_2 Forward -91 -73 12.4159 0.227
NP_442933.1_10 Reverse -47 -56 9.63616 0.0616
NP_440382.1_2 Forward -190 -171 4.81688 0.27
NP_440382.1_2 Forward -331 -312 3.83357 0.274
NP_442142.1_4 Forward -59 -46 7.39353 0.141
NP_441637.1_9 Reverse -1 -19 -0.570838 0.292
NP_442227.1_2 Reverse -4 -23 0.0977854 0.253
NP_441911.1_10 Forward -98 -79 10.0051 0.226
NP_440918.1_2 Reverse -14 -33 11.0125 0.259
NP_441036.1_3 Forward -149 -130 -1.96717 0.217
NP_441036.1_8 Forward -57 -47 9.51814 0.174
NP_441445.1_1 Reverse -331 -350 8.94757 0.112
NP_440084.1_8 Reverse -150 -164 10.2293 0.271
NP_440709.1_1 Forward -365 -346 0.490334 0.259
NP_440717.1_1 Forward -30 -11 5.211 0.281
NP_440969.1_3 Forward -355 -337 6.80322 0.294
NP_440408.1_7 Forward -25 -6 7.17762 0.291
NP_442114.1_8 Reverse -194 -208 3.8339 0.281
NP_442750.1_3 Reverse -101 -120 -11.1119 0.236
NP_440350.1_5 Reverse -75 -94 -5.40875 0.289
NP_440822.1_1 Forward -38 -19 16.9499 0.13
NP_441918.1_7 Reverse -339 -358 -2.0655 0.297
NP_442315.1_1 Reverse -239 -257 4.14905 0.28
NP_442315.1_2 Reverse -98 -110 9.18376 0.291
NP_443064.1_6 Forward -349 -339 9.94905 0.187
NP_440454.1_1 Reverse -77 -96 11.1342 0.246
NP_442080.1_7 Reverse -367 -386 -3.63879 0.29
NP_440222.1_6 Forward -298 -285 19.1938 0.125
NP_441086.1_3 Forward -203 -184 6.9054 0.276
NP_441733.1_10 Forward -262 -249 9.65572 0.112
NP_441004.1_1 Reverse -58 -77 -12.8819 0.251
NP_442939.1_7 Reverse -53 -72 8.75091 0.295
NP_442515.1_1 Forward -350 -336 -3.73699 0.297
NP_441982.1_6 Reverse -291 -300 12.7718 0.274
NP_440431.1_4 Forward -96 -77 -7.59203 0.262
NP_440431.1_4 Forward -91 -72 -8.64244 0.275
NP_441333.1_1 Reverse -78 -88 11.6853 0.241
NP_440757.1_8 Reverse -187 -199 18.9964 0.0961
NP_440757.1_8 Forward -199 -187 18.4221 0.0961
NP_440545.1_3 Forward -29 -12 -3.00942 0.197
NP_443040.1_1 Forward -166 -152 10.3772 0.291
NP_441329.1_6 Forward -97 -78 3.10306 0.217
NP_441329.1_6 Forward -99 -80 2.53011 0.227
NP_442699.1_8 Reverse -239 -258 -12.7836 0.257
NP_440671.1_1 Reverse -344 -363 9.67211 0.191
NP_440671.1_1 Reverse -178 -197 8.42796 0.204
NP_441490.1_1 Forward -258 -239 14.3558 0.186
NP_441490.1_1 Reverse -245 -264 14.0608 0.186
NP_442886.1_1 Forward -299 -285 20.9441 0.136
NP_442669.1_1 Reverse -334 -353 18.584 0.002
NP_440354.1_7 Reverse -41 -59 6.31233 0.284
NP_440374.1_9 Forward -240 -221 11.7992 0.215
NP_441848.1_4 Forward -172 -156 7.45517 0.288
NP_439948.1_2 Forward -92 -74 14.9942 0.259
NP_441084.1_6 Reverse -363 -377 10.7985 0.228
NP_442039.1_5 Reverse -17 -36 16.4207 0.295
NP_442039.1_10 Forward -302 -284 13.588 0.227
NP_442679.1_1 Forward -98 -79 1.86774 0.17
NP_442679.1_1 Forward -101 -82 -4.22878 0.274
NP_442532.1_1 Forward -97 -83 10.1136 0.25
NP_439944.1_9 Forward -306 -296 4.99491 0.284
NP_442203.1_1 Forward -89 -75 17.3912 0.15
NP_441697.1_5 Forward -165 -146 -7.40105 0.243
NP_441527.1_4 Forward -96 -77 5.20389 0.106
NP_441527.1_4 Forward -97 -78 4.43995 0.111
NP_441527.1_4 Forward -98 -79 3.867 0.111
NP_441527.1_4 Forward -99 -80 -2.14899 0.154
NP_441527.1_4 Forward -94 -75 -7.30556 0.232
NP_441527.1_4 Forward -95 -76 -11.0297 0.278
NP_441527.1_4 Forward -92 -73 -11.3162 0.281
NP_441527.1_4 Forward -101 -82 -11.7937 0.284
NP_441527.1_4 Forward -91 -72 -12.4621 0.288
NP_442728.1_7 Forward -31 -17 10.6193 0.297
NP_441106.1_1 Forward -57 -48 2.35967 0.287
NP_441479.1_9 Reverse -50 -68 12.5072 0.293
NP_442614.1_2 Forward -25 -11 12.4876 0.157
NP_442842.1_10 Reverse -82 -101 1.0479 0.254
NP_441993.1_1 Reverse -104 -123 1.36194 0.28
NP_440766.1_4 Forward -263 -249 4.62115 0.124
NP_442246.1_6 Forward -163 -144 2.75272 0.291
NP_442680.1_5 Forward -171 -152 9.5482 0.145
NP_442680.1_5 Forward -393 -374 0.951443 0.255
NP_441489.1_3 Reverse -124 -138 8.98786 0.232
NP_441159.1_8 Reverse -77 -96 -2.16459 0.242
NP_442703.1_9 Reverse -182 -200 22.2419 0.0381
NP_441756.1_5 Reverse -13 -32 -2.65548 0.28
NP_441350.1_10 Forward -246 -227 21.7314 0.0685
NP_443052.1_9 Forward -35 -16 -2.45882 0.238
NP_442116.1_2 Forward -64 -45 10.6184 0.289
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACATCCCGAAGAGGAATAAGGACAGTAACCAGAGCTTGATTAACACAACTTCACAATCACCCTCTCAAGAAACTATTCAGAATTGACGTAAACAGCTTTCTTTTTCAGGAAAACCCTATCTTGATCTAGATACACAACAGTTGTGATCTGGGTCACAACCATTGAGTGATTAGGGACAATACATTTCTCGATTTGTGTGGTTTTTGTTACAAAAAATCGTATTTCTACGGAGCAGTAAAAAATTCAAATTTAGTGAAAGTCCAGTATTAGTGCCAATACGCACAAATTGTCATTTCCCTACAATAAAGAAGTAAAGAAAAAAACAACATTCATTTCCCAAGACCGACGAGCGATACATCGAGTTACCACCCACGAGGCCACGGGAAGGAGGCGACAAATT

CDS

ATGTTCACTAAATTCAATCAAGTTCTTCTAGCTTCTGGTTTAGTTCTGACTTCCCTAGTCGGTTTTGGCTCTTCCGCTTTTGCTGAAGGTGCTAATGTATTTGCTAATAATCCTGAGATGGAGACTTTGACTTGGTCCCCCTCCAAAGAGACTGAAGGGAAGGCTATTGTTCTTACTAACAACGGGGAATTAACGTTGACTTCTATCGGAAATGTCAACGTCAAATCTAACAGTTATTTGGGTTTTACTGTGTCAGTGAGTTCGGCTAATGGAGTTACGGCAAGTGCGGCTGGGGGAGTGCTTAAACATCCGGATGCTGGCGATACCATTATCTACACTATCAACTATAACGGGTCAGATAAAACACTTGCTGCTGGTGTAGGAGATATGGAAACTCCATCGGCTGACATACCAGATTGTTCTGATGCTACTGGTTGTGACCGCGATGTTAAAATTGCAATCGCAGAAGAGCAAGTTGTTAGTAAGCCTGCTGGTACTTATTCAGATACCCTTACTTTCACATTGACAAATAAATAG

Protein

MFTKFNQVLLASGLVLTSLVGFGSSAFAEGANVFANNPEMETLTWSPSKETEGKAIVLTNNGELTLTSIGNVNVKSNSYLGFTVSVSSANGVTASAAGGVLKHPDAGDTIIYTINYNGSDKTLAAGVGDMETPSADIPDCSDATGCDRDVKIAIAEEQVVSKPAGTYSDTLTFTLTNK