Your browser is old and dusty. Try Google Chrome!

Details for slr1657

ORF slr1657
Accession NP_442964.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440815.1_1 Reverse -41 -58 18.9184 0.2
NP_441480.1_8 Reverse -165 -184 13.9625 0.271
NP_441453.1_7 Forward -357 -350 13.4121 0.23
NP_440226.1_1 Reverse -208 -227 4.81767 0.178
NP_441098.1_3 Reverse -34 -53 -2.57799 0.28
NP_442752.1_4 Reverse -4 -11 12.4288 0.0388
NP_442752.1_4 Reverse -17 -24 5.54565 0.194
NP_441812.1_3 Reverse -207 -221 10.816 0.216
NP_440631.1_9 Reverse -28 -47 11.3903 0.286
NP_442062.1_8 Reverse -4 -14 3.51995 0.267
NP_441900.1_2 Forward -20 -2 -5.29143 0.288
NP_440304.1_4 Reverse -375 -385 1.94665 0.299
NP_440916.1_1 Forward -318 -304 11.3077 0.206
NP_442602.1_3 Forward -128 -109 0.982764 0.197
NP_442602.1_3 Reverse -368 -387 -2.75381 0.265
NP_441208.1_1 Reverse -147 -166 -6.88371 0.296
NP_442276.1_2 Forward -371 -352 4.12936 0.299
NP_442726.1_1 Reverse -237 -256 8.55425 0.277
NP_439957.1_6 Reverse -158 -177 11.7008 0.178
NP_442461.1_3 Reverse -203 -217 20.0649 0.0825
NP_440343.1_9 Reverse -143 -162 10.1275 0.248
NP_441014.1_10 Reverse -176 -195 -0.787962 0.253
NP_442848.1_5 Forward -187 -169 -3.12744 0.29
NP_440376.1_1 Reverse -251 -260 1.76968 0.242
NP_440376.1_1 Reverse -17 -26 1.57302 0.246
NP_442485.1_3 Reverse -6 -25 -0.590531 0.253
NP_441846.1_10 Reverse -7 -26 -22.125 0.257
NP_440642.1_10 Forward -164 -150 1.37564 0.293
NP_440667.1_2 Reverse -166 -185 -3.93378 0.242
NP_442658.1_1 Forward -262 -252 5.87944 0.246
NP_440141.1_8 Reverse -138 -157 5.80098 0.271
NP_442321.1_4 Forward -178 -159 -7.86702 0.284
NP_442321.1_4 Reverse -379 -398 -8.752 0.29
NP_441317.1_4 Forward -209 -195 9.75043 0.29
NP_441127.1_1 Reverse -233 -247 15.4376 0.115
NP_441338.2_9 Forward -399 -380 5.30933 0.252
NP_442690.1_1 Reverse -212 -231 -13.0786 0.254
NP_442690.1_1 Forward -51 -32 -15.9302 0.282
NP_442911.1_2 Forward -396 -377 -8.16202 0.228
NP_442853.1_5 Reverse -164 -183 19.7631 0.0429
NP_441129.1_3 Forward -378 -359 -17.7001 0.285
NP_442002.1_9 Forward -261 -254 12.2322 0.185
NP_440809.1_9 Reverse -227 -245 -8.04399 0.225
NP_441041.1_1 Reverse -154 -173 11.7992 0.198
NP_440174.1_2 Reverse -261 -280 11.7992 0.272
NP_441725.1_5 Reverse -252 -262 0.176696 0.206
NP_439966.1_9 Reverse -169 -178 3.7363 0.253
NP_440736.1_3 Reverse -279 -298 2.45773 0.282
NP_440674.1_3 Reverse -236 -255 3.44104 0.26
NP_441079.1_1 Forward -291 -272 14.6508 0.264
NP_441079.1_1 Reverse -232 -251 14.5524 0.264
NP_442012.1_1 Forward -392 -373 3.34271 0.18
NP_440587.1_4 Reverse -219 -238 15.6332 0.185
NP_442926.1_3 Reverse -366 -385 4.22769 0.269
NP_440919.1_7 Forward -317 -299 12.4886 0.151
NP_440379.1_8 Reverse -155 -174 23.9922 0.0185
NP_441468.1_1 Reverse -167 -174 7.41394 0.121
NP_442745.1_6 Forward -101 -82 14.5524 0.258
NP_442490.1_5 Reverse -159 -178 21.2389 0.0224
NP_441764.1_8 Forward -225 -215 13.3205 0.284
NP_442719.1_2 Reverse -281 -299 0.805058 0.162
NP_442719.1_2 Reverse -282 -300 -1.55487 0.175
NP_442719.1_2 Forward -250 -232 -1.84987 0.178
NP_442719.1_2 Reverse -235 -253 -9.7163 0.267
NP_441612.1_2 Forward -187 -177 14.9389 0.21
NP_442227.1_2 Forward -24 -5 0.294447 0.252
NP_441101.1_1 Reverse -234 -252 12.3105 0.247
NP_441101.1_4 Reverse -175 -194 9.63589 0.191
NP_442050.1_5 Forward -28 -18 7.45273 0.256
NP_440558.1_2 Reverse -168 -187 -4.03212 0.241
NP_440558.1_2 Forward -389 -370 -7.67036 0.298
NP_442576.1_9 Forward -191 -177 15.7678 0.291
NP_440923.1_1 Forward -81 -63 13.4897 0.208
NP_441433.1_8 Reverse -297 -316 6.09597 0.174
NP_441308.1_8 Reverse -20 -30 11.3864 0.22
NP_442347.1_2 Forward -12 -3 5.99792 0.201
NP_442998.1_5 Forward -400 -390 13.0581 0.158
NP_441559.1_8 Reverse -286 -300 -3.147 0.198
NP_441559.1_8 Reverse -231 -245 -3.73699 0.209
NP_441447.1_2 Reverse -31 -49 16.8337 0.0909
NP_441296.1_7 Forward -370 -351 14.0608 0.267
NP_442993.1_1 Forward -175 -159 -9.47957 0.186
NP_441340.1_9 Reverse -276 -286 8.93007 0.256
NP_440586.1_8 Forward -244 -237 5.64364 0.297
NP_442959.1_5 Reverse -20 -39 9.93088 0.224
NP_443038.1_4 Forward -290 -271 11.0125 0.208
NP_439937.1_9 Reverse -287 -304 -11.4665 0.256
NP_439937.1_9 Forward -246 -229 -15.6947 0.287
NP_441740.2_10 Reverse -251 -270 10.7175 0.286
NP_440408.1_7 Reverse -153 -172 10.2259 0.251
NP_440439.1_1 Reverse -14 -27 -1.65234 0.275
NP_440271.1_2 Reverse -151 -170 -0.000545616 0.292
NP_441138.1_5 Reverse -218 -231 5.21834 0.272
NP_440819.1_5 Forward -187 -179 7.59091 0.272
NP_439977.1_5 Forward -392 -373 0.58944 0.207
NP_441877.1_5 Forward -320 -301 -1.27885 0.283
NP_440838.1_5 Forward -338 -319 11.5042 0.271
NP_442078.1_3 Reverse -299 -318 5.2102 0.186
NP_440491.1_1 Forward -301 -282 9.74328 0.206
NP_440491.1_1 Forward -300 -281 7.20938 0.274
NP_442818.1_3 Reverse -238 -255 -5.07437 0.259
NP_442710.1_7 Reverse -204 -223 -5.7811 0.294
NP_442337.1_8 Reverse -142 -161 -2.0655 0.293
NP_441462.1_5 Forward -302 -283 9.3409 0.213
NP_441867.1_2 Reverse -301 -320 -12.4886 0.258
NP_441086.1_1 Reverse -87 -101 20.6881 0.0798
NP_441086.1_3 Reverse -231 -250 9.78869 0.193
NP_441004.1_1 Reverse -371 -390 4.42435 0.106
NP_441004.1_1 Reverse -154 -173 -9.34199 0.206
NP_441004.1_1 Reverse -304 -323 -10.4236 0.219
NP_441004.1_1 Reverse -236 -255 -14.9469 0.271
NP_441004.1_1 Forward -305 -286 -18.1918 0.298
NP_441004.1_2 Reverse -366 -385 1.96607 0.216
NP_440728.1_9 Reverse -36 -54 15.4599 0.294
NP_442208.1_5 Reverse -362 -381 20.1573 0.0244
NP_442208.1_5 Forward -382 -363 -6.09707 0.266
NP_440593.1_3 Forward -390 -371 1.57275 0.19
NP_441982.1_6 Reverse -306 -315 10.48 0.296
NP_441046.1_2 Reverse -231 -250 -0.590531 0.282
NP_440483.1_1 Reverse -297 -316 -6.49039 0.25
NP_441570.1_1 Reverse -236 -254 -10.4039 0.17
NP_440078.1_8 Forward -251 -232 1.17943 0.279
NP_440539.1_9 Forward -310 -291 -4.03212 0.286
NP_442348.1_2 Reverse -388 -397 14.2577 0.165
NP_440526.1_3 Forward -12 -1 0.451529 0.281
NP_439935.1_1 Forward -297 -278 6.4893 0.28
NP_442749.1_5 Reverse -312 -329 7.74166 0.259
NP_441968.1_1 Forward -227 -219 14.3753 0.286
NP_442008.1_2 Reverse -373 -392 3.34271 0.257
NP_441800.1_7 Forward -250 -232 0.0191479 0.219
NP_442346.1_1 Reverse -160 -179 10.2259 0.27
NP_440545.1_3 Forward -249 -232 -4.09106 0.218
NP_440459.1_2 Reverse -157 -174 8.59364 0.254
NP_441943.1_5 Reverse -269 -288 15.8918 0.239
NP_442828.1_7 Forward -302 -283 -4.32711 0.276
NP_440875.1_9 Forward -178 -168 8.08002 0.243
NP_442547.1_5 Forward -201 -182 17.8386 0.243
NP_441239.1_9 Reverse -164 -176 3.57889 0.283
NP_440624.1_5 Forward -47 -29 7.57099 0.294
NP_441769.1_3 Forward -220 -201 -2.75457 0.245
NP_442138.1_1 Reverse -169 -188 0.686995 0.278
NP_442479.1_9 Reverse -109 -128 -6.88371 0.266
NP_442402.1_2 Forward -320 -306 10.1271 0.298
NP_442402.1_4 Reverse -285 -304 -2.95123 0.209
NP_442402.1_4 Forward -325 -306 -10.2277 0.298
NP_442402.1_4 Forward -34 -15 -10.2277 0.298
NP_442402.1_10 Forward -316 -306 16.2041 0.118
NP_442402.1_10 Reverse -292 -302 13.6475 0.2
NP_442402.1_10 Reverse -293 -303 13.5492 0.2
NP_442402.1_10 Forward -317 -307 10.1076 0.3
NP_439942.1_2 Forward -52 -33 11.9196 0.296
NP_440753.1_4 Forward -385 -366 17.6982 0.2
NP_440753.1_5 Reverse -279 -298 10.1275 0.232
NP_442837.1_3 Forward -12 -5 5.74231 0.275
NP_440505.1_3 Reverse -15 -25 10.0098 0.12
NP_442360.1_5 Forward -305 -295 12.6647 0.298
NP_441102.1_10 Forward -204 -185 6.58763 0.265
NP_441252.1_6 Reverse -306 -313 11.6422 0.288
NP_440914.1_1 Forward -260 -250 10.6645 0.129
NP_441699.1_7 Forward -248 -229 5.60352 0.255
NP_442533.1_1 Reverse -1 -20 -15.2418 0.253
NP_442541.1_10 Forward -181 -167 1.86729 0.273
NP_441697.1_5 Forward -223 -204 -7.30556 0.242
NP_441028.1_6 Forward -315 -305 7.74772 0.218
NP_441028.1_6 Reverse -294 -304 6.0761 0.232
NP_441028.1_6 Reverse -180 -190 4.89613 0.275
NP_442893.1_4 Reverse -212 -231 10.815 0.106
NP_442211.1_9 Forward -388 -369 1.37609 0.283
NP_441962.1_4 Reverse -372 -391 -7.4737 0.189
NP_441858.1_2 Forward -261 -242 14.323 0.228
NP_441858.1_2 Reverse -241 -260 13.349 0.233
NP_442743.1_1 Reverse -288 -307 17.3048 0.195
NP_442743.1_1 Forward -254 -235 6.58682 0.268
NP_439910.1_2 Forward -137 -120 -13.8258 0.163
NP_442867.1_8 Reverse -140 -159 6.58763 0.259
NP_441332.1_4 Forward -299 -280 7.96426 0.234
NP_442509.1_9 Reverse -344 -354 11.1893 0.142
NP_443037.1_8 Reverse -243 -262 8.35759 0.242
NP_442862.1_3 Forward -317 -300 8.69197 0.236
NP_441173.1_9 Forward -315 -307 13.1954 0.184
NP_441173.1_9 Forward -314 -306 12.507 0.206
NP_441173.1_9 Reverse -295 -303 11.3271 0.226
NP_441173.1_9 Reverse -294 -302 11.3271 0.226
NP_443000.1_7 Reverse -206 -216 0.963343 0.278
NP_442275.1_1 Reverse -232 -251 9.0459 0.245
NP_443010.1_10 Forward -289 -272 2.38426 0.277
NP_441359.1_5 Reverse -14 -33 6.39097 0.188
NP_440249.1_2 Forward -42 -32 17.2858 0.194
NP_439971.2_9 Forward -392 -373 19.6656 0.12
NP_442552.1_1 Forward -383 -364 0.0977854 0.257
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGAAAAATCCCGCTGACATTGACCCAGCCTGCTGCAACGTAGTCACTGGGTTCATCCAAAAGACTGTTGTAAAATCCAACCTAATTTTCCCCAAGCTTGGGGGAAACTCGGGAAAGGTTTCCTAGTCAGTCGATTTAAGGGCAAACCCGAACTTTGCCAACACCTCCCAAATCAAGATAAAACTTGATCACTATTTTTAGTTTGTGAATCTATGGGAAAAACAATGCCAGCTCCGTTTCCCTGCCCCAACTAAGCAGAGGATAATTAAACACCAATCTAGGGAAAATAGTCCTGGGTAAGCAGTCATTCCTAACCAAGTGAGTTACATTGAATAACCTAGGTAAGTAAATAAACTCACTCAAAAATTTCCGGATCCTATCCCCGTCTTCGCTCCCCACT

CDS

ATGACTACGACAGAATTAACGGCGGCCACCCTAACTCAACTTCAGCAAGAAATTAATCGGTTACAACGGGAAAATGATGATCTCCACATTGCCTTGACCACGATCGCCGAACATGGGGACATGATCGAGTCATTGCTGAATGAAACCAATGTCAAGCTCAGAAGCGAAATCCTGGAACGACAGCGGGCAGAGGCGAAGTTACAAAATATTCTCAGTTTAATTTCCCGGGAAAAGGAAGACCTAGAAATTATTGTGGAAACCATCATGCAACATGGGGACGTGGTGGATGCCCAATGGCGACAAAAACTAGGGGAAACCGCAGAGTTACTTAACCTCGATAGCCTCACCCAGGTTTCCAACCGCCGCCATTTTGACCTCCATCTGGCCCAACAATGGGAACGGGCCATGGATAGCCAAGAGGCGATCGCCCTGATTTTATGTGATATCGACCATTTCAAACAATTCAACGACTTCTACGGCCACCTCAGTGGGGATGACTGTTTGCGGCGCATTGCCAAAACCCTCAGTGCCACCCTCCGCAACCCGTTTGATCTTTTTGCTCGCTACGGTGGTGAAGAATTTGGTGTAATTTTGCCCCAGGTGACCAGTGAAGCTGCCCAGCAGATTGCTAAACGGATGCAGGCCTCTCTGACAATGCTAGAAATTCCCCATCACCATTCCCCCACTAGCGAATTCGTCACCATGTCCTTTGGCATCGGTCGCCTGTATCCCCAGCCGGGACAACTCCCCCTAGACCTAATTGCCCAAGCGGACGAAAATCTTTACAAGGCGAAACGCCAGGGCCGGAACTGCATTTTCGGCCATTGA

Protein

MTTTELTAATLTQLQQEINRLQRENDDLHIALTTIAEHGDMIESLLNETNVKLRSEILERQRAEAKLQNILSLISREKEDLEIIVETIMQHGDVVDAQWRQKLGETAELLNLDSLTQVSNRRHFDLHLAQQWERAMDSQEAIALILCDIDHFKQFNDFYGHLSGDDCLRRIAKTLSATLRNPFDLFARYGGEEFGVILPQVTSEAAQQIAKRMQASLTMLEIPHHHSPTSEFVTMSFGIGRLYPQPGQLPLDLIAQADENLYKAKRQGRNCIFGH