Your browser is old and dusty. Try Google Chrome!

Details for slr1655

ORF slr1655
Accession NP_442961.1
Symbol psaL
Category Photosystem I
Definition photosystem I subunit XI
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -344 -363 4.916 0.174
NP_442291.1_5 Forward -397 -381 -4.36636 0.272
NP_441453.1_4 Forward -352 -344 6.80426 0.121
NP_441453.1_4 Reverse -343 -351 6.11594 0.121
NP_442838.1_7 Forward -357 -338 -0.688862 0.121
NP_441465.1_2 Reverse -272 -291 15.5749 0.278
NP_441630.1_3 Forward -374 -355 4.52268 0.163
NP_442173.1_1 Reverse -344 -352 12.0158 0.0316
NP_442173.1_1 Forward -351 -343 10.7375 0.0611
NP_442752.1_4 Forward -352 -345 13.8055 0.0199
NP_443027.1_4 Reverse -158 -168 10.9931 0.109
NP_440784.1_7 Forward -351 -344 6.23397 0.241
NP_440784.1_7 Reverse -344 -351 6.13563 0.241
NP_441250.1_3 Reverse -208 -227 4.22769 0.252
NP_440061.1_6 Reverse -114 -132 14.8663 0.202
NP_442062.1_8 Forward -352 -342 7.55152 0.0946
NP_442972.1_1 Forward -118 -100 7.19353 0.291
NP_440044.1_8 Reverse -161 -180 -3.63879 0.288
NP_441581.1_9 Reverse -275 -294 10.074 0.261
NP_440518.1_8 Forward -274 -255 13.6666 0.205
NP_441083.1_5 Forward -352 -342 7.05986 0.067
NP_441083.1_5 Reverse -343 -353 0.766681 0.218
NP_441434.1_7 Reverse -345 -359 4.22782 0.225
NP_441738.1_2 Reverse -345 -352 15.28 0.0102
NP_441738.1_2 Reverse -250 -257 6.03696 0.295
NP_441738.1_2 Forward -167 -160 6.03696 0.295
NP_440209.1_1 Forward -352 -344 8.57422 0.0425
NP_442889.1_8 Forward -355 -341 4.03056 0.27
NP_442889.1_8 Reverse -340 -354 2.94893 0.295
NP_441025.1_5 Forward -150 -136 13.9626 0.282
NP_441598.1_4 Forward -165 -146 17.6007 0.239
NP_442111.1_3 Forward -222 -209 14.7675 0.224
NP_442111.1_4 Reverse -342 -356 6.98109 0.108
NP_441163.1_1 Forward -164 -147 9.5762 0.225
NP_440481.1_6 Forward -337 -319 13.6872 0.21
NP_440481.1_6 Reverse -81 -99 12.9988 0.252
NP_441387.1_8 Reverse -110 -129 15.899 0.18
NP_440906.1_5 Forward -351 -344 6.23397 0.234
NP_440906.1_5 Reverse -344 -351 6.13563 0.241
NP_441486.1_1 Forward -355 -341 5.1128 0.0391
NP_440403.1_4 Forward -361 -342 -9.63698 0.279
NP_442848.1_1 Forward -358 -344 -2.75368 0.263
NP_443018.1_3 Reverse -344 -351 11.7405 0.0655
NP_443018.1_3 Forward -351 -344 5.44732 0.193
NP_440376.1_1 Forward -352 -343 5.99792 0.111
NP_440376.1_1 Reverse -343 -352 -0.196935 0.285
NP_441588.1_4 Reverse -345 -355 6.96153 0.178
NP_442687.1_7 Forward -353 -343 4.50326 0.245
NP_442191.1_4 Reverse -344 -358 11.0901 0.271
NP_441077.1_6 Forward -229 -213 4.73 0.255
NP_440781.1_1 Forward -337 -323 15.2409 0.247
NP_442658.1_1 Forward -354 -344 6.17443 0.235
NP_440141.1_8 Forward -74 -55 7.86593 0.232
NP_442782.1_2 Forward -56 -42 6.58777 0.222
NP_442782.1_2 Reverse -72 -86 6.48943 0.223
NP_441414.1_9 Forward -352 -333 -3.63879 0.14
NP_440184.1_1 Forward -133 -114 3.64179 0.23
NP_441317.1_4 Reverse -214 -228 12.2332 0.23
NP_441958.1_5 Reverse -342 -352 0.865012 0.12
NP_441958.1_5 Forward -353 -343 0.865012 0.12
NP_440450.1_10 Reverse -109 -128 11.0289 0.234
NP_442816.1_7 Reverse -214 -233 9.7875 0.233
NP_442376.1_2 Reverse -145 -164 -13.3736 0.292
NP_442911.1_2 Reverse -333 -352 -11.0136 0.296
NP_440153.1_5 Reverse -344 -358 0.491246 0.299
NP_440200.1_3 Reverse -147 -166 8.16093 0.298
NP_442002.1_9 Reverse -269 -276 11.1505 0.185
NP_442002.1_9 Forward -353 -346 10.7572 0.185
NP_441712.1_1 Reverse -107 -126 15.2223 0.251
NP_441712.1_1 Forward -230 -211 9.52091 0.289
NP_441646.1_1 Reverse -336 -355 -0.688862 0.271
NP_441000.1_6 Reverse -342 -356 4.22782 0.0964
NP_441110.1_8 Forward -265 -246 9.93088 0.286
NP_441550.1_8 Reverse -341 -351 13.4509 0.0248
NP_441550.1_8 Forward -354 -344 4.7978 0.283
NP_441916.1_10 Reverse -34 -53 0.294447 0.286
NP_440345.1_5 Forward -132 -118 13.8565 0.276
NP_441725.1_5 Reverse -344 -354 1.455 0.135
NP_441725.1_5 Forward -351 -341 0.766681 0.149
NP_439966.1_7 Forward -354 -344 8.73102 0.13
NP_439966.1_9 Forward -354 -345 0.983037 0.253
NP_440202.1_8 Forward -271 -252 9.32 0.297
NP_442941.1_3 Reverse -344 -354 1.65166 0.147
NP_440289.1_2 Forward -355 -342 5.23083 0.0636
NP_441514.1_1 Reverse -207 -217 14.727 0.274
NP_442281.1_1 Forward -357 -343 8.16044 0.0845
NP_441079.1_7 Reverse -108 -127 6.48849 0.136
NP_441079.1_7 Reverse -109 -128 6.39016 0.136
NP_441079.1_7 Forward -129 -110 -3.93454 0.239
NP_442847.1_3 Reverse -317 -336 10.52 0.217
NP_442172.1_1 Reverse -108 -127 19.4958 0.0964
NP_442982.1_5 Forward -362 -343 -3.24547 0.297
NP_441644.1_6 Forward -352 -342 3.61784 0.272
NP_442215.1_2 Reverse -341 -357 -4.26803 0.23
NP_442215.1_2 Forward -361 -345 -4.95634 0.242
NP_442215.1_2 Forward -368 -352 -5.84132 0.26
NP_440929.1_8 Reverse -343 -352 14.651 0.0105
NP_440929.1_8 Forward -352 -343 7.66954 0.0624
NP_440780.1_1 Forward -131 -112 11.2199 0.243
NP_442933.1_1 Forward -293 -274 15.899 0.167
NP_442933.1_1 Reverse -214 -233 7.78217 0.253
NP_442554.1_8 Forward -351 -341 8.53483 0.074
NP_442554.1_8 Reverse -344 -354 4.0116 0.2
NP_441762.1_7 Reverse -342 -354 -5.86088 0.246
NP_441762.1_7 Forward -353 -341 -7.63084 0.296
NP_442292.1_1 Reverse -344 -353 -0.196935 0.239
NP_442292.1_1 Forward -351 -342 -0.786921 0.287
NP_442292.1_5 Forward -173 -154 -2.65548 0.296
NP_442476.1_6 Forward -168 -154 3.34284 0.158
NP_441715.1_4 Reverse -344 -354 6.46988 0.143
NP_440881.1_4 Forward -169 -150 -0.39387 0.26
NP_440158.1_1 Reverse -105 -124 10.4559 0.243
NP_440158.1_1 Forward -132 -113 9.02356 0.298
NP_441198.1_5 Reverse -162 -175 15.4566 0.206
NP_441198.1_7 Reverse -370 -389 14.9458 0.197
NP_441468.1_1 Forward -351 -344 6.13563 0.209
NP_441468.1_1 Reverse -344 -351 6.0373 0.223
NP_441020.2_6 Forward -354 -337 10.1669 0.151
NP_441673.1_1 Forward -352 -343 1.37636 0.114
NP_441673.1_1 Reverse -343 -352 1.1797 0.163
NP_441826.1_2 Forward -358 -344 11.5043 0.0358
NP_441764.1_8 Forward -223 -213 13.5119 0.284
NP_442361.1_3 Forward -358 -345 15.8506 0.0811
NP_442542.1_9 Forward -359 -345 8.25877 0.166
NP_442050.1_5 Forward -171 -161 9.22267 0.193
NP_441518.1_3 Forward -179 -160 -11.9969 0.261
NP_441878.1_6 Reverse -342 -352 0.57002 0.14
NP_441036.1_8 Forward -353 -343 6.8632 0.213
NP_441557.1_5 Reverse -343 -352 7.57121 0.049
NP_441557.1_5 Forward -352 -343 1.08137 0.0794
NP_441445.1_10 Forward -342 -323 15.5357 0.261
NP_442795.1_3 Forward -196 -177 5.01433 0.257
NP_441308.1_8 Forward -354 -344 8.4365 0.254
NP_442347.1_2 Reverse -344 -353 8.94785 0.0718
NP_442347.1_2 Forward -168 -159 5.01461 0.244
NP_441037.1_4 Reverse -341 -351 12.288 0.109
NP_441633.1_3 Reverse -235 -248 -5.58558 0.236
NP_441633.1_3 Reverse -341 -354 -6.76555 0.271
NP_442764.1_6 Forward -261 -243 2.47742 0.242
NP_440136.1_2 Forward -351 -344 6.23397 0.171
NP_440136.1_2 Reverse -344 -351 6.13563 0.193
NP_442998.1_5 Forward -203 -193 15.0247 0.149
NP_442998.1_5 Forward -249 -239 14.533 0.149
NP_442998.1_5 Reverse -268 -278 7.25653 0.298
NP_442998.1_10 Reverse -345 -352 15.5754 0.0102
NP_440899.1_8 Forward -289 -270 -10.227 0.277
NP_440299.1_1 Reverse -339 -352 4.64028 0.205
NP_441799.1_1 Reverse -339 -353 5.50552 0.206
NP_440256.1_1 Forward -362 -343 -9.53865 0.281
NP_442961.1_1 Forward -119 -102 21.1354 0.224
NP_442961.1_7 Forward -156 -137 22.7139 0.0194
NP_442961.1_8 Forward -78 -59 23.1072 0.0395
NP_440915.1_6 Forward -356 -342 4.81781 0.0953
NP_441464.1_8 Forward -352 -338 10.226 0.182
NP_440306.1_8 Reverse -186 -205 -0.886293 0.222
NP_442386.1_9 Forward -353 -344 5.9975 0.23
NP_441340.1_5 Forward -351 -344 13.5105 0.0314
NP_441340.1_5 Reverse -344 -351 5.84064 0.208
NP_441340.1_9 Forward -222 -212 7.58037 0.256
NP_442327.1_3 Forward -128 -109 9.97848 0.203
NP_441248.1_10 Forward -219 -209 14.6181 0.282
NP_442240.1_2 Reverse -344 -363 -4.6221 0.0843
NP_440161.1_3 Forward -354 -335 7.37428 0.299
NP_441027.1_1 Forward -282 -268 11.9953 0.27
NP_440586.1_8 Reverse -344 -351 9.47853 0.146
NP_440586.1_8 Forward -351 -344 5.74197 0.283
NP_441262.1_3 Forward -352 -345 14.7888 0.0223
NP_443051.1_1 Forward -353 -344 7.47288 0.0571
NP_443051.1_1 Reverse -342 -351 6.19458 0.0849
NP_441232.1_10 Reverse -332 -351 6.58763 0.161
NP_439937.1_9 Reverse -75 -92 -13.9248 0.287
NP_442294.1_3 Reverse -189 -203 12.782 0.274
NP_440439.1_1 Forward -355 -342 -0.0790467 0.207
NP_440372.1_2 Forward -351 -344 13.8055 0.0214
NP_440372.1_2 Reverse -344 -351 6.52896 0.188
NP_441572.1_7 Forward -358 -339 5.11266 0.0892
NP_441155.1_2 Forward -159 -140 16.8141 0.218
NP_440262.1_10 Reverse -36 -50 21.7307 0.0564
NP_442790.1_4 Reverse -374 -393 -14.9469 0.283
NP_442262.1_10 Reverse -344 -351 13.2155 0.0213
NP_441689.1_5 Forward -354 -344 5.97777 0.197
NP_442244.1_3 Reverse -346 -365 12.7825 0.148
NP_440163.1_10 Forward -355 -345 15.2213 0.0762
NP_441335.1_2 Reverse -315 -334 12.3892 0.22
NP_440297.1_9 Forward -351 -341 0.176696 0.282
NP_440297.1_9 Reverse -344 -354 -0.511621 0.289
NP_441896.1_3 Forward -361 -342 -2.55715 0.284
NP_442378.1_9 Forward -124 -105 15.1416 0.246
NP_440999.1_9 Reverse -156 -170 -2.95034 0.281
NP_440888.1_2 Reverse -343 -357 8.75042 0.149
NP_440888.1_2 Reverse -147 -161 6.48882 0.232
NP_442454.1_2 Forward -131 -112 12.0793 0.251
NP_440052.1_5 Reverse -149 -168 -4.13045 0.249
NP_440575.1_8 Forward -218 -199 -1.96717 0.228
NP_441543.1_2 Reverse -344 -353 8.65285 0.0968
NP_441304.1_10 Forward -327 -318 14.0611 0.213
NP_441551.1_5 Reverse -244 -260 6.44936 0.269
NP_442710.1_7 Reverse -110 -129 21.5141 0.00834
NP_442710.1_7 Forward -127 -108 7.48206 0.0968
NP_442710.1_7 Forward -130 -111 -4.24334 0.272
NP_441469.1_8 Forward -353 -344 6.39124 0.227
NP_442337.1_8 Reverse -181 -200 2.45773 0.217
NP_442578.1_7 Forward -351 -344 6.0373 0.18
NP_441462.1_2 Forward -352 -342 9.51814 0.0171
NP_442204.1_1 Forward -356 -345 0.353664 0.281
NP_442204.1_5 Forward -362 -343 5.11266 0.16
NP_440516.1_8 Forward -352 -343 9.53783 0.0136
NP_440516.1_8 Reverse -343 -352 5.01461 0.118
NP_442428.1_5 Forward -351 -344 6.13563 0.209
NP_442428.1_5 Reverse -344 -351 6.0373 0.212
NP_440818.1_10 Reverse -366 -385 13.5691 0.26
NP_440673.1_3 Reverse -345 -352 12.4288 0.0426
NP_440673.1_3 Reverse -389 -396 8.59391 0.213
NP_440436.1_4 Reverse -344 -353 8.55409 0.0997
NP_441086.1_3 Reverse -293 -312 8.9237 0.221
NP_441719.1_4 Forward -351 -344 6.82395 0.0855
NP_441719.1_4 Reverse -344 -351 6.52896 0.188
NP_442366.1_3 Reverse -342 -360 1.78911 0.141
NP_440296.1_6 Reverse -112 -130 10.6971 0.295
NP_440296.1_10 Reverse -70 -89 -3.93378 0.209
NP_442206.1_2 Reverse -253 -272 10.7175 0.254
NP_443054.1_2 Reverse -286 -300 0.294584 0.269
NP_443054.1_2 Forward -159 -145 -0.197071 0.288
NP_441851.1_10 Forward -353 -343 6.17489 0.182
NP_441851.1_10 Reverse -342 -352 6.07655 0.187
NP_441851.1_10 Reverse -159 -169 4.89658 0.24
NP_442208.1_5 Forward -339 -320 -9.047 0.29
NP_442709.1_4 Forward -129 -110 20.2232 0.0319
NP_442709.1_4 Reverse -108 -127 7.59398 0.163
NP_442689.1_8 Forward -288 -271 -6.35267 0.281
NP_440432.1_9 Reverse -161 -176 -2.97003 0.177
NP_442843.1_1 Forward -351 -332 -7.08038 0.245
NP_442168.1_5 Forward -351 -332 -1.7705 0.264
NP_442006.1_2 Forward -165 -148 -17.4641 0.276
NP_442006.1_2 Forward -255 -238 -19.0374 0.297
NP_441078.1_4 Forward -352 -343 0.196389 0.205
NP_441078.1_4 Reverse -343 -352 -0.000272808 0.205
NP_442348.1_2 Forward -324 -315 6.98123 0.293
NP_441432.1_8 Forward -353 -344 5.50626 0.151
NP_441432.1_9 Reverse -214 -227 8.40445 0.289
NP_441333.1_1 Reverse -215 -225 12.9245 0.217
NP_442320.1_8 Forward -358 -344 3.8345 0.0578
NP_440760.1_1 Forward -352 -333 -22.42 0.257
NP_440199.1_10 Forward -355 -345 14.533 0.0861
NP_442510.1_9 Reverse -144 -158 15.8309 0.279
NP_442489.1_7 Forward -352 -343 0.688044 0.152
NP_442489.1_7 Reverse -343 -352 0.688044 0.152
NP_440559.1_1 Forward -351 -342 13.6677 0.0368
NP_441659.2_8 Forward -352 -342 6.46988 0.0744
NP_441022.1_1 Forward -54 -45 11.5462 0.274
NP_441022.1_1 Forward -219 -210 11.0666 0.284
NP_441040.1_2 Reverse -341 -360 2.45773 0.119
NP_440352.1_5 Forward -231 -212 11.0983 0.267
NP_441888.1_7 Reverse -155 -169 7.37441 0.225
NP_441833.1_4 Reverse -344 -351 6.52896 0.0924
NP_441833.1_4 Forward -351 -344 6.23397 0.163
NP_441329.1_6 Forward -230 -211 0.90675 0.245
NP_441895.1_2 Forward -74 -55 -16.9135 0.168
NP_442162.1_9 Forward -351 -344 12.9205 0.0282
NP_442162.1_9 Reverse -344 -351 12.9205 0.0282
NP_440671.1_1 Forward -122 -103 12.0647 0.178
NP_440671.1_1 Reverse -115 -134 8.23655 0.204
NP_440671.1_4 Forward -358 -344 17.1092 0.0237
NP_442943.1_1 Reverse -112 -127 2.91421 0.286
NP_442140.1_3 Reverse -344 -354 6.27322 0.176
NP_442140.1_3 Forward -351 -341 5.28991 0.216
NP_440951.1_3 Reverse -377 -395 16.9321 0.227
NP_440875.1_9 Reverse -345 -355 8.37203 0.233
NP_441813.1_5 Forward -354 -344 7.45319 0.0746
NP_441813.1_5 Reverse -341 -351 4.89658 0.143
NP_442028.1_1 Reverse -213 -226 8.56056 0.281
NP_440590.1_4 Reverse -344 -357 3.46087 0.0735
NP_442497.1_10 Forward -351 -342 8.25953 0.047
NP_442497.1_10 Reverse -344 -353 0.589713 0.153
NP_440821.1_4 Forward -354 -344 9.32148 0.03
NP_440821.1_4 Reverse -341 -351 0.57002 0.169
NP_441239.1_9 Reverse -341 -353 12.0354 0.0512
NP_441239.1_9 Forward -354 -342 2.98891 0.3
NP_440219.1_1 Forward -125 -106 14.7512 0.191
NP_441541.1_1 Reverse -116 -134 -2.95826 0.264
NP_442216.1_4 Reverse -317 -325 8.1805 0.255
NP_440546.1_4 Forward -352 -342 6.94336 0.269
NP_440462.1_6 Forward -354 -344 5.87989 0.135
NP_440868.1_4 Forward -356 -344 -0.846001 0.282
NP_442402.1_10 Reverse -194 -204 10.1076 0.3
NP_441848.1_4 Reverse -101 -117 15.2855 0.154
NP_441848.1_4 Forward -228 -212 11.4658 0.224
NP_441848.1_6 Reverse -322 -341 12.0933 0.296
NP_441848.1_7 Reverse -208 -227 -1.57461 0.253
NP_440696.1_3 Reverse -339 -357 11.0322 0.136
NP_440696.1_6 Reverse -331 -350 4.03102 0.288
NP_442039.1_4 Forward -351 -344 11.6422 0.0747
NP_442039.1_4 Forward -168 -161 7.80726 0.24
NP_442679.1_1 Forward -235 -216 0.58944 0.196
NP_440825.1_7 Forward -351 -341 10.8602 0.286
NP_442837.1_3 Forward -351 -344 6.0373 0.25
NP_442837.1_3 Reverse -344 -351 6.0373 0.25
NP_442053.1_1 Reverse -343 -352 7.07956 0.105
NP_440505.1_3 Forward -354 -344 12.2714 0.0543
NP_442360.1_5 Reverse -264 -274 12.5664 0.298
NP_441203.1_1 Reverse -344 -363 -10.1286 0.137
NP_442532.1_1 Forward -229 -215 11.8628 0.215
NP_441011.1_8 Reverse -344 -353 7.07956 0.179
NP_442533.1_6 Reverse -343 -352 4.42462 0.179
NP_442541.1_10 Reverse -321 -335 1.47397 0.286
NP_440854.1_1 Forward -233 -214 13.2252 0.11
NP_441482.1_7 Reverse -337 -351 -5.01529 0.168
NP_441482.1_7 Forward -358 -344 -8.94853 0.193
NP_441697.1_5 Forward -129 -110 -0.716613 0.204
NP_441697.1_5 Reverse -109 -128 -3.58137 0.217
NP_441697.1_5 Reverse -108 -127 -10.1703 0.278
NP_440816.1_2 Forward -231 -212 7.88715 0.259
NP_441028.1_6 Forward -294 -284 4.60114 0.278
NP_441028.1_6 Forward -79 -69 4.10949 0.278
NP_441028.1_6 Reverse -129 -139 3.42118 0.296
NP_440116.1_8 Forward -351 -332 -9.73531 0.287
NP_441527.1_4 Forward -239 -220 -6.15965 0.215
NP_441527.1_4 Forward -233 -214 -9.1199 0.255
NP_440115.1_6 Forward -399 -389 10.0098 0.115
NP_440007.1_9 Forward -356 -342 2.94952 0.277
NP_441347.1_9 Reverse -117 -130 11.9768 0.174
NP_441106.1_1 Forward -353 -344 8.45619 0.0548
NP_439903.1_6 Forward -101 -82 1.37531 0.248
NP_441286.1_1 Reverse -342 -354 -6.05754 0.245
NP_440670.1_8 Forward -352 -343 16.0277 0.00443
NP_440670.1_8 Reverse -343 -352 12.5861 0.0253
NP_441930.1_2 Forward -256 -246 11.9764 0.271
NP_442072.1_9 Reverse -342 -360 -15.4188 0.18
NP_442401.1_2 Reverse -311 -330 10.3234 0.178
NP_442125.1_2 Forward -234 -215 7.37428 0.203
NP_440907.2_1 Reverse -149 -168 13.4708 0.28
NP_440907.2_8 Reverse -344 -354 6.0761 0.179
NP_440907.2_8 Forward -351 -341 4.7978 0.243
NP_441021.1_1 Forward -351 -332 -12.9802 0.3
NP_440962.1_5 Forward -283 -273 18.3679 0.248
NP_441626.1_2 Forward -351 -344 12.2322 0.0511
NP_441626.1_2 Reverse -344 -351 5.93897 0.231
NP_441962.1_4 Forward -162 -143 -15.1435 0.299
NP_440387.1_1 Forward -352 -336 -3.08806 0.155
NP_441431.1_2 Forward -395 -381 7.3738 0.244
NP_440634.1_1 Forward -354 -335 11.4058 0.287
NP_440114.1_10 Forward -352 -338 10.226 0.151
NP_440737.1_1 Forward -330 -311 5.40766 0.251
NP_442090.1_2 Reverse -301 -320 12.6523 0.214
NP_441510.2_7 Forward -358 -344 16.5185 0.226
NP_440766.1_4 Forward -356 -342 11.111 0.0771
NP_440766.1_5 Reverse -39 -51 8.61071 0.277
NP_441237.1_9 Forward -351 -341 13.943 0.0577
NP_442743.1_4 Reverse -344 -363 -1.37718 0.195
NP_442635.1_9 Forward -294 -275 14.2097 0.262
NP_440457.1_1 Forward -356 -344 9.28209 0.0929
NP_440798.1_6 Forward -351 -338 2.96921 0.158
NP_442680.1_5 Forward -233 -214 0.072229 0.269
NP_441332.1_3 Reverse -88 -107 9.14423 0.202
NP_442509.1_9 Forward -352 -342 10.8943 0.152
NP_442509.1_9 Reverse -343 -353 9.41933 0.192
NP_440554.1_4 Reverse -344 -354 11.6814 0.0377
NP_440554.1_4 Forward -168 -158 4.69992 0.181
NP_440554.1_4 Reverse -249 -259 2.43831 0.265
NP_441885.1_5 Forward -352 -342 -0.0199663 0.186
NP_440628.1_1 Forward -227 -217 16.5762 0.248
NP_440478.1_10 Reverse -385 -399 10.0294 0.208
NP_441428.1_8 Forward -208 -189 4.22769 0.243
NP_442703.1_1 Forward -233 -214 9.31004 0.228
NP_442341.1_7 Reverse -342 -356 7.66941 0.0994
NP_441173.1_9 Reverse -196 -204 13.1954 0.184
NP_442395.2_4 Forward -353 -334 3.14526 0.207
NP_440191.1_6 Forward -113 -99 14.4309 0.294
NP_440191.1_6 Reverse -96 -110 13.5715 0.294
NP_440076.1_5 Forward -264 -245 12.1917 0.274
NP_441842.1_10 Forward -359 -345 6.88276 0.271
NP_440275.1_3 Forward -354 -344 5.87989 0.13
NP_440091.1_1 Forward -173 -161 1.21895 0.204
NP_440091.1_1 Forward -356 -344 1.02229 0.218
NP_440216.1_1 Reverse -343 -357 -3.83532 0.09
NP_442015.1_10 Reverse -156 -169 2.37923 0.193
NP_442015.1_10 Reverse -339 -352 2.08423 0.202
NP_441226.1_7 Forward -351 -344 12.7234 0.0312
NP_441226.1_7 Reverse -344 -351 11.5435 0.0757
NP_441111.1_7 Reverse -344 -352 8.86921 0.0589
NP_441766.1_2 Reverse -343 -352 12.6844 0.0158
NP_441766.1_2 Reverse -160 -169 3.04799 0.236
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCTAGCAACCGAAGGCTTCAGTCCGCACCTTTTGAAGATTGACCAACGGCGATCGGACAACTTCAGGCAGGCAGGGGGCATTATTTGAATATTGCAAACATCGTCTTTTGCTCTATGGTTTTAATTTGCCCAGACCATGAAAAGCGAACTGGGGCAGATTGAAGAGGATTATAAAAAGAGAAAAAATTTGGCTCGTGGGGAAAATTCCATCCAAAGAAAGCCTCCAAAGTAGAGATCCCAGGCGGAAAAGCCGCTGTTGAGTGGAGGTCAATAAAACTTAATGAATTTTTTTAAAGCTAAAAGCCATTTTCCTCGCAAAACGTCCCCCCGTGCGTAAAATGGGGACTAAAGTTTTGTCACGTCCCTGACGAAATTCTTTAATAGGAGAACTCAATACCA

CDS

ATGGCTGAATCTAACCAAGTTGTACAAGCCTATAACGGCGATCCTTTTGTGGGGCATCTTTCCACCCCCATTTCCGACTCCGCTTTCACCCGCACTTTTATCGGCAATTTGCCCGCCTATCGCAAAGGCCTTTCCCCCATCCTCAGAGGTTTGGAAGTGGGCATGGCCCACGGTTACTTCTTGATTGGCCCCTGGACCCTGCTGGGCCCGCTGCGGGATTCTGAGTACCAGTACATTGGTGGTCTGATCGGAGCTTTGGCTTTGATCCTGGTGGCTACCGCTGCTCTTAGTAGCTATGGACTGGTTACCTTCCAAGGGGAACAGGGTTCCGGCGACACTCTGCAAACAGCCGATGGTTGGAGCCAATTTGCTGCTGGCTTTTTTGTGGGTGGCATGGGAGGTGCCTTTGTGGCTTACTTCCTGTTGGAAAACCTCAGCGTTGTGGATGGGATTTTCCGGGGTCTATTTAACTAA

Protein

MAESNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN