Your browser is old and dusty. Try Google Chrome!

Details for slr1653

ORF slr1653
Accession NP_442958.1
Symbol
Category Glutamate family / Nitrogen assimilation
Definition N-acyl-L-amino acid amidohydrolase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -119 -133 21.0424 0.00934
NP_441061.1_2 Reverse -206 -220 7.9644 0.0955
NP_441061.1_2 Forward -126 -112 4.81781 0.143
NP_440795.1_7 Forward -126 -119 14.6904 0.0123
NP_440795.1_7 Reverse -119 -126 14.6904 0.0123
NP_440795.1_7 Reverse -262 -269 9.77388 0.169
NP_441418.1_6 Reverse -118 -137 -11.7019 0.0555
NP_441418.1_6 Forward -337 -318 -28.2215 0.203
NP_441418.1_6 Forward -139 -120 -29.0082 0.215
NP_441418.1_6 Reverse -205 -224 -29.0082 0.215
NP_441418.1_6 Forward -349 -330 -29.9915 0.249
NP_441418.1_6 Reverse -328 -347 -30.6798 0.291
NP_441418.1_6 Forward -304 -285 -30.7781 0.296
NP_440815.1_2 Reverse -379 -393 10.717 0.265
NP_442291.1_5 Reverse -117 -133 10.4816 0.0441
NP_442291.1_5 Forward -128 -112 5.07341 0.082
NP_442291.1_5 Forward -338 -322 2.41848 0.126
NP_441453.1_4 Reverse -118 -126 16.539 0.00633
NP_441453.1_4 Forward -127 -119 16.539 0.00633
NP_441453.1_4 Reverse -328 -336 14.8674 0.00947
NP_441453.1_4 Forward -337 -329 6.80426 0.121
NP_441453.1_4 Reverse -300 -308 4.14932 0.264
NP_441453.1_7 Forward -12 -5 14.1988 0.175
NP_441453.1_7 Forward -66 -59 12.9205 0.23
NP_441623.1_1 Reverse -4 -22 -4.11075 0.274
NP_442151.1_6 Reverse -118 -132 11.3077 0.104
NP_442151.1_6 Forward -127 -113 9.43936 0.148
NP_442151.1_6 Reverse -300 -314 6.98109 0.214
NP_441818.1_1 Forward -126 -115 18.446 0.0046
NP_441818.1_1 Reverse -119 -130 15.6928 0.0257
NP_441818.1_9 Forward -147 -128 -5.40875 0.253
NP_440226.1_1 Reverse -328 -347 11.7008 0.0509
NP_440226.1_1 Forward -309 -290 4.52268 0.188
NP_440226.1_1 Forward -337 -318 2.85105 0.249
NP_441630.1_3 Reverse -211 -230 1.27776 0.251
NP_440150.1_6 Reverse -115 -134 0.884433 0.295
NP_442173.1_1 Forward -126 -118 15.4574 0.00633
NP_442173.1_1 Reverse -119 -127 15.4574 0.00633
NP_442173.1_1 Forward -336 -328 13.8841 0.0225
NP_442173.1_1 Reverse -329 -337 12.0158 0.0316
NP_442173.1_7 Reverse -227 -246 17.3057 0.19
NP_442752.1_4 Forward -337 -330 13.8055 0.0199
NP_442752.1_4 Forward -127 -120 13.8055 0.0199
NP_442752.1_4 Reverse -118 -125 13.8055 0.0199
NP_442752.1_4 Forward -309 -302 10.8555 0.0846
NP_443027.1_4 Forward -129 -119 13.1564 0.0521
NP_443027.1_4 Reverse -116 -126 11.0914 0.107
NP_441812.1_3 Forward -167 -153 8.25939 0.254
NP_442975.1_10 Forward -131 -117 11.7987 0.0482
NP_442975.1_10 Reverse -7 -21 4.8172 0.239
NP_442975.1_10 Reverse -114 -128 4.62054 0.241
NP_440784.1_7 Forward -126 -119 15.9687 0.0123
NP_440784.1_7 Reverse -119 -126 15.9687 0.0123
NP_440784.1_7 Forward -336 -329 6.23397 0.241
NP_440784.1_7 Reverse -329 -336 6.13563 0.241
NP_442909.1_7 Reverse -119 -133 18.5835 0.0491
NP_442909.1_7 Forward -126 -112 6.88214 0.237
NP_441250.1_3 Forward -207 -188 2.85105 0.267
NP_440061.1_9 Reverse -116 -130 22.615 0.0017
NP_440061.1_9 Reverse -298 -312 14.5519 0.0631
NP_440061.1_9 Reverse -326 -340 5.21053 0.293
NP_440061.1_9 Reverse -50 -64 4.91554 0.3
NP_440110.1_4 Forward -138 -119 6.88262 0.148
NP_441054.1_2 Forward -112 -93 9.83255 0.284
NP_441476.1_5 Reverse -113 -132 -1.57384 0.205
NP_440878.1_9 Forward -319 -300 0.392778 0.196
NP_442062.1_8 Forward -127 -117 17.3846 0.00193
NP_442062.1_8 Reverse -118 -128 17.3846 0.00193
NP_442062.1_8 Forward -337 -327 7.64985 0.0911
NP_442062.1_8 Reverse -328 -338 7.15819 0.107
NP_442062.1_8 Forward -88 -78 6.27322 0.132
NP_442062.1_8 Reverse -300 -310 4.50326 0.212
NP_441859.1_3 Reverse -327 -346 8.65176 0.137
NP_440304.1_4 Forward -230 -220 11.4848 0.051
NP_440304.1_4 Forward -129 -119 9.91146 0.051
NP_440304.1_4 Forward -311 -301 6.56821 0.15
NP_440304.1_4 Reverse -116 -126 1.84832 0.299
NP_442242.1_4 Forward -126 -119 14.3954 0.0124
NP_442242.1_4 Reverse -119 -126 14.3954 0.0124
NP_440044.1_8 Reverse -119 -138 5.89931 0.0967
NP_440044.1_8 Forward -336 -317 5.30933 0.103
NP_440044.1_8 Forward -126 -107 3.04771 0.14
NP_442762.1_10 Forward -321 -302 -2.26216 0.205
NP_441581.1_6 Reverse -270 -289 9.58335 0.291
NP_441619.1_9 Forward -316 -297 7.27595 0.203
NP_441208.1_9 Forward -130 -116 6.78443 0.229
NP_441594.1_6 Forward -136 -117 12.0942 0.116
NP_441594.1_6 Reverse -109 -128 4.916 0.211
NP_441594.1_6 Reverse -331 -350 1.86774 0.261
NP_441594.1_6 Reverse -2 -21 0.786102 0.281
NP_440370.1_10 Reverse -319 -338 6.58763 0.287
NP_442276.1_2 Forward -321 -302 4.81767 0.295
NP_442110.1_7 Forward -127 -113 9.63603 0.0715
NP_442110.1_7 Reverse -118 -132 8.25939 0.0953
NP_442110.1_7 Reverse -112 -126 0.196253 0.266
NP_441082.1_10 Forward -146 -133 9.95071 0.237
NP_442726.1_1 Forward -219 -200 10.9142 0.213
NP_441925.1_4 Reverse -262 -281 -16.4225 0.282
NP_440856.1_4 Reverse -293 -312 10.4225 0.0532
NP_440856.1_7 Forward -229 -210 -3.14714 0.196
NP_440856.1_7 Forward -304 -285 -3.44213 0.199
NP_441083.1_5 Forward -127 -117 20.3345 0.00053
NP_441083.1_5 Reverse -118 -128 20.3345 0.00053
NP_441083.1_5 Forward -337 -327 7.94484 0.048
NP_441083.1_5 Reverse -328 -338 0.865012 0.218
NP_441083.1_5 Reverse -300 -310 0.176696 0.241
NP_442827.1_8 Reverse -110 -129 1.27698 0.184
NP_441434.1_7 Forward -125 -111 8.45605 0.225
NP_441434.1_7 Reverse -330 -344 3.24451 0.254
NP_441141.1_4 Forward -320 -301 11.6025 0.292
NP_441738.1_2 Reverse -330 -337 15.28 0.0102
NP_441738.1_2 Forward -125 -118 15.28 0.0102
NP_441738.1_2 Reverse -120 -127 15.28 0.0102
NP_441738.1_2 Reverse -364 -371 8.29857 0.176
NP_441738.1_4 Reverse -108 -127 15.8307 0.0804
NP_441558.1_5 Forward -129 -110 9.0459 0.132
NP_441558.1_5 Reverse -326 -345 7.7676 0.17
NP_441558.1_5 Reverse -298 -317 7.47261 0.18
NP_441558.1_5 Reverse -116 -135 5.80098 0.24
NP_441645.1_1 Reverse -353 -372 13.0766 0.171
NP_440209.1_1 Reverse -118 -126 18.1123 0.00295
NP_440209.1_1 Forward -127 -119 18.1123 0.00295
NP_440209.1_1 Forward -337 -329 8.57422 0.0425
NP_440209.1_1 Reverse -300 -308 5.0343 0.194
NP_442889.1_8 Forward -340 -326 7.66879 0.143
NP_442889.1_8 Reverse -115 -129 5.30886 0.231
NP_440447.1_1 Reverse -38 -56 7.4923 0.194
NP_440447.1_1 Reverse -308 -326 3.75572 0.246
NP_440447.1_6 Forward -345 -327 4.44404 0.17
NP_442675.1_4 Forward -348 -330 -4.20908 0.257
NP_440178.1_7 Forward -128 -109 -14.2585 0.152
NP_440178.1_7 Forward -215 -196 -21.7317 0.237
NP_440178.1_7 Reverse -117 -136 -21.7317 0.237
NP_441792.1_5 Reverse -194 -210 15.4965 0.153
NP_441716.1_1 Reverse -118 -132 19.9608 0.00829
NP_441716.1_1 Reverse -205 -219 4.42448 0.256
NP_441716.1_1 Forward -127 -113 3.73617 0.259
NP_441598.1_4 Reverse -84 -103 16.7157 0.247
NP_442111.1_4 Reverse -117 -131 11.701 0.0486
NP_442111.1_4 Reverse -327 -341 8.94771 0.0661
NP_442111.1_4 Forward -310 -296 7.76774 0.0867
NP_442111.1_4 Forward -128 -114 5.40779 0.166
NP_441624.1_6 Reverse -365 -384 15.6332 0.218
NP_441624.1_7 Forward -220 -206 8.75105 0.235
NP_440906.1_5 Forward -126 -119 15.8704 0.0124
NP_440906.1_5 Reverse -119 -126 15.8704 0.0124
NP_440906.1_5 Forward -336 -329 6.23397 0.234
NP_440906.1_5 Reverse -329 -336 6.13563 0.241
NP_440747.1_10 Reverse -115 -127 16.8536 0.00143
NP_440747.1_10 Forward -130 -118 7.51213 0.00286
NP_440747.1_10 Reverse -297 -309 -2.51763 0.0509
NP_440747.1_10 Forward -217 -205 -11.8591 0.161
NP_440747.1_10 Reverse -325 -337 -12.0557 0.199
NP_440747.1_10 Reverse -202 -214 -12.1541 0.227
NP_441130.1_10 Forward -129 -115 16.2242 0.0257
NP_441130.1_10 Reverse -116 -130 14.9459 0.0387
NP_441130.1_10 Forward -216 -202 7.76774 0.149
NP_441486.1_1 Forward -130 -116 5.89945 0.0344
NP_441486.1_1 Reverse -115 -129 5.80112 0.0344
NP_441486.1_1 Reverse -325 -339 1.76955 0.0999
NP_441486.1_1 Forward -340 -326 -5.80194 0.26
NP_442634.1_4 Forward -311 -297 3.14618 0.118
NP_442634.1_4 Reverse -116 -130 -3.34366 0.161
NP_440403.1_4 Reverse -109 -128 10.1275 0.073
NP_440403.1_4 Forward -136 -117 -4.03212 0.203
NP_440403.1_4 Reverse -284 -303 -8.55534 0.257
NP_440403.1_10 Forward -136 -117 4.916 0.251
NP_441014.1_8 Reverse -125 -144 -8.94866 0.288
NP_441014.1_8 Reverse -368 -387 -9.34199 0.295
NP_441014.1_9 Forward -304 -285 11.9958 0.174
NP_441014.1_10 Forward -128 -109 9.34008 0.124
NP_441014.1_10 Forward -152 -133 -1.8696 0.267
NP_442848.1_1 Forward -133 -119 16.6175 0.0143
NP_442848.1_1 Reverse -112 -126 15.8309 0.0143
NP_442848.1_4 Forward -15 -1 6.09611 0.284
NP_442848.1_9 Reverse -112 -131 4.22769 0.206
NP_441012.1_4 Reverse -288 -301 9.45906 0.272
NP_441012.1_4 Forward -64 -51 6.50913 0.278
NP_443018.1_3 Forward -126 -119 14.8871 0.0123
NP_443018.1_3 Reverse -119 -126 14.8871 0.0123
NP_443018.1_3 Reverse -329 -336 11.7405 0.0655
NP_443018.1_3 Forward -308 -301 11.5438 0.0752
NP_443018.1_3 Forward -336 -329 5.44732 0.193
NP_441634.1_8 Reverse -116 -130 15.5359 0.0248
NP_441634.1_8 Forward -44 -30 2.45787 0.167
NP_441634.1_8 Forward -129 -115 -4.4253 0.295
NP_440376.1_1 Forward -127 -118 19.4693 0.000692
NP_440376.1_1 Reverse -118 -127 19.4693 0.000692
NP_440376.1_1 Forward -309 -300 6.5879 0.0915
NP_440376.1_1 Forward -337 -328 5.89959 0.116
NP_440376.1_1 Forward -214 -205 4.71961 0.15
NP_440376.1_1 Reverse -328 -337 -0.0986038 0.285
NP_440376.1_1 Reverse -300 -309 -0.196935 0.285
NP_441588.1_4 Forward -125 -115 8.73149 0.14
NP_442687.1_7 Forward -338 -328 12.5664 0.0712
NP_442687.1_7 Forward -271 -261 10.0098 0.0994
NP_442687.1_7 Forward -128 -118 8.92815 0.0994
NP_442687.1_7 Reverse -117 -127 8.92815 0.0994
NP_442687.1_7 Forward -244 -234 4.99491 0.225
NP_442191.1_4 Forward -101 -87 12.6414 0.198
NP_442191.1_4 Forward -308 -294 10.6053 0.294
NP_442485.1_3 Reverse -116 -135 -4.13045 0.278
NP_441846.1_10 Forward -286 -267 -21.4367 0.256
NP_441846.1_10 Forward -288 -269 -22.9117 0.271
NP_442958.1_2 Forward -317 -298 24.8772 0.0206
NP_442958.1_3 Forward -138 -119 23.4022 0.0172
NP_441013.1_2 Reverse -302 -320 0.805796 0.254
NP_441422.1_7 Reverse -116 -133 4.95539 0.106
NP_440667.1_2 Forward -214 -195 -6.39206 0.273
NP_441950.1_7 Forward -145 -126 -7.57203 0.279
NP_442296.1_5 Reverse -88 -107 3.73603 0.251
NP_440360.1_10 Reverse -126 -140 2.16287 0.27
NP_442658.1_1 Reverse -110 -120 11.4843 0.082
NP_442658.1_1 Forward -129 -119 9.616 0.147
NP_442658.1_1 Forward -339 -329 9.02601 0.169
NP_442658.1_1 Reverse -116 -126 7.94438 0.199
NP_442658.1_1 Forward -311 -301 7.0594 0.214
NP_442782.1_2 Forward -284 -270 4.71948 0.25
NP_442782.1_2 Forward -309 -295 0.294584 0.291
NP_442205.1_9 Forward -133 -117 -1.21977 0.264
NP_440184.1_5 Reverse -108 -127 7.07928 0.224
NP_439959.1_5 Forward -303 -284 14.9458 0.189
NP_442937.1_5 Reverse -113 -132 16.3224 0.0449
NP_442937.1_5 Forward -132 -113 15.1424 0.0621
NP_441958.1_5 Forward -128 -118 12.2714 0.00183
NP_441958.1_5 Reverse -117 -127 12.2714 0.00183
NP_441958.1_5 Forward -338 -328 8.73149 0.0255
NP_441958.1_5 Reverse -299 -309 1.55333 0.095
NP_441958.1_5 Forward -310 -300 1.35667 0.0987
NP_442836.1_5 Forward -133 -114 19.469 0.023
NP_442836.1_5 Forward -39 -20 1.47442 0.283
NP_440203.1_2 Forward -326 -307 12.9791 0.293
NP_440203.1_5 Reverse -121 -131 12.6642 0.141
NP_439905.1_1 Reverse -329 -342 14.9656 0.106
NP_440984.1_7 Forward -300 -286 7.57108 0.166
NP_441377.1_5 Reverse -355 -374 16.1257 0.163
NP_439990.1_5 Reverse -113 -126 12.6056 0.11
NP_442911.1_2 Forward -137 -118 -3.14714 0.109
NP_440153.1_5 Reverse -119 -133 17.7975 0.0482
NP_440153.1_5 Forward -126 -112 1.67122 0.245
NP_440153.1_8 Reverse -118 -131 4.44418 0.2
NP_442064.1_4 Forward -224 -205 5.50519 0.267
NP_443055.1_6 Reverse -320 -338 -1.55487 0.28
NP_440993.1_2 Reverse -323 -339 9.39998 0.12
NP_440993.1_4 Reverse -205 -222 10.8552 0.213
NP_440827.1_3 Forward -132 -113 11.5042 0.268
NP_440602.1_2 Forward -265 -246 3.14605 0.263
NP_440602.1_8 Forward -337 -323 17.1092 0.103
NP_441429.1_10 Reverse -29 -48 3.34271 0.204
NP_441099.1_5 Forward -137 -118 8.84924 0.0344
NP_441099.1_5 Reverse -108 -127 3.14605 0.0522
NP_442002.1_9 Forward -338 -331 10.7572 0.185
NP_442032.1_5 Forward -366 -356 17.4824 0.172
NP_440809.1_9 Reverse -319 -337 -8.14232 0.227
NP_441294.1_7 Reverse -114 -128 16.4498 0.0144
NP_441294.1_7 Forward -131 -117 15.3939 0.0254
NP_441294.1_7 Reverse -201 -215 10.5945 0.181
NP_441646.1_1 Forward -134 -115 18.1907 0.0597
NP_441646.1_1 Reverse -111 -130 7.66927 0.156
NP_442438.1_10 Forward -132 -118 9.43936 0.0637
NP_442438.1_10 Reverse -113 -127 7.47274 0.0933
NP_442431.1_10 Forward -278 -260 -0.865831 0.296
NP_441752.1_6 Reverse -101 -120 -1.27885 0.287
NP_441000.1_6 Forward -128 -114 -3.34366 0.221
NP_440147.1_4 Reverse -116 -129 18.1122 0.00478
NP_440147.1_4 Forward -129 -116 9.75405 0.0371
NP_440147.1_4 Reverse -298 -311 7.88576 0.0598
NP_440147.1_4 Forward -339 -326 -0.472371 0.287
NP_441550.1_8 Forward -129 -119 16.7941 0.00906
NP_441550.1_8 Reverse -116 -126 15.1225 0.0132
NP_441550.1_8 Forward -339 -329 9.22267 0.103
NP_441550.1_8 Reverse -326 -336 6.56775 0.201
NP_441916.1_7 Forward -127 -117 10.3048 0.0261
NP_441916.1_7 Reverse -118 -128 10.3048 0.0261
NP_441916.1_7 Reverse -328 -338 9.51814 0.0338
NP_441916.1_7 Forward -309 -299 6.46988 0.0941
NP_441916.1_7 Reverse -300 -310 3.81494 0.202
NP_441916.1_10 Forward -135 -116 4.32602 0.223
NP_441916.1_10 Reverse -191 -210 3.6377 0.227
NP_441041.1_4 Forward -139 -120 -11.8003 0.252
NP_441041.1_4 Forward -315 -296 -13.4719 0.288
NP_441041.1_7 Reverse -115 -127 10.8188 0.0864
NP_442004.1_3 Forward -120 -101 21.5339 0.0764
NP_442004.1_6 Reverse -118 -132 8.94771 0.14
NP_442004.1_6 Forward -127 -113 2.5562 0.263
NP_441725.1_4 Reverse -38 -52 6.19383 0.278
NP_441725.1_4 Reverse -113 -127 3.53891 0.278
NP_441725.1_5 Reverse -119 -129 9.02648 0.0553
NP_441725.1_5 Reverse -301 -311 6.37155 0.115
NP_441725.1_5 Forward -126 -116 2.04498 0.115
NP_441725.1_5 Reverse -220 -230 0.275027 0.192
NP_441725.1_5 Reverse -329 -339 -0.806614 0.271
NP_439966.1_7 Reverse -116 -126 15.3192 0.0152
NP_439966.1_7 Forward -129 -119 14.8275 0.0177
NP_439966.1_7 Reverse -298 -308 8.43603 0.14
NP_439966.1_7 Forward -339 -329 7.74772 0.15
NP_439966.1_7 Reverse -326 -336 6.56775 0.177
NP_439966.1_9 Forward -339 -330 10.7178 0.0863
NP_439966.1_9 Forward -129 -120 0.884706 0.253
NP_442941.1_3 Forward -126 -116 19.2529 0.00262
NP_442941.1_3 Reverse -119 -129 10.9931 0.0116
NP_442941.1_3 Forward -336 -326 7.64985 0.0628
NP_442941.1_3 Forward -308 -298 -0.216628 0.252
NP_440289.1_2 Reverse -115 -128 12.6056 0.0139
NP_440289.1_2 Forward -130 -117 2.18257 0.102
NP_440260.1_8 Reverse -109 -127 -6.86402 0.295
NP_442281.1_1 Reverse -323 -337 16.8135 0.00698
NP_442281.1_1 Reverse -113 -127 15.1419 0.0138
NP_442281.1_1 Forward -132 -118 6.98048 0.111
NP_442281.1_1 Forward -314 -300 2.5556 0.263
NP_442281.1_1 Reverse -369 -383 1.5723 0.296
NP_441334.1_7 Forward -311 -292 -14.1602 0.249
NP_441334.1_7 Forward -129 -110 -19.3717 0.275
NP_440395.1_2 Forward -371 -352 18.7807 0.0834
NP_442256.1_2 Reverse -116 -134 -7.749 0.215
NP_440437.1_1 Reverse -112 -131 -1.18052 0.196
NP_440437.1_1 Reverse -294 -313 -4.32711 0.256
NP_442012.1_1 Forward -94 -75 1.86774 0.21
NP_442012.1_1 Reverse -294 -313 -0.787193 0.267
NP_442982.1_5 Reverse -290 -309 6.19431 0.154
NP_441644.1_6 Forward -127 -117 17.3841 0.00127
NP_441644.1_6 Reverse -118 -128 17.3841 0.00127
NP_441644.1_6 Forward -309 -299 7.74772 0.117
NP_441644.1_6 Reverse -328 -338 7.45273 0.124
NP_441644.1_6 Reverse -300 -310 4.99446 0.216
NP_441644.1_6 Forward -322 -312 3.42118 0.282
NP_440867.1_9 Reverse -290 -309 13.2741 0.249
NP_442215.1_2 Forward -129 -113 4.58176 0.0832
NP_442215.1_2 Reverse -203 -219 -0.826444 0.173
NP_442215.1_2 Reverse -379 -395 -5.84132 0.26
NP_442029.1_1 Forward -129 -110 -9.83364 0.213
NP_442029.1_1 Forward -297 -278 -12.6852 0.254
NP_442029.1_6 Forward -314 -295 6.68596 0.234
NP_440253.1_2 Reverse -118 -136 7.68896 0.0682
NP_440253.1_2 Forward -127 -109 4.6407 0.1
NP_440253.1_2 Forward -337 -319 1.19912 0.166
NP_440929.1_8 Forward -127 -118 19.2726 0.000701
NP_440929.1_8 Reverse -118 -127 19.2726 0.000701
NP_440929.1_8 Reverse -328 -337 7.17789 0.0713
NP_442933.1_10 Forward -127 -118 17.601 0.00325
NP_442933.1_10 Reverse -118 -127 17.601 0.00325
NP_442933.1_10 Reverse -328 -337 8.06287 0.0885
NP_442933.1_10 Forward -337 -328 7.96454 0.0937
NP_442933.1_10 Reverse -300 -309 5.3096 0.203
NP_442933.1_10 Forward -309 -300 4.62128 0.227
NP_441751.2_8 Reverse -119 -133 6.78443 0.0348
NP_441751.2_8 Forward -126 -112 2.85119 0.0759
NP_442554.1_8 Reverse -119 -129 18.0729 0.00543
NP_442554.1_8 Forward -126 -116 16.2046 0.0065
NP_442554.1_8 Forward -308 -298 6.76487 0.107
NP_442554.1_8 Reverse -329 -339 6.17489 0.125
NP_442554.1_8 Reverse -301 -311 6.07655 0.126
NP_442554.1_8 Forward -321 -311 5.5849 0.145
NP_442554.1_8 Forward -336 -326 3.91327 0.203
NP_441762.1_7 Reverse -327 -339 4.36554 0.0504
NP_441762.1_7 Reverse -117 -129 2.69391 0.0676
NP_441762.1_7 Forward -128 -116 -6.74586 0.284
NP_442313.1_5 Forward -126 -107 5.99764 0.253
NP_442142.1_4 Reverse -115 -128 12.2117 0.0464
NP_442142.1_4 Reverse -283 -296 8.77016 0.108
NP_442142.1_4 Reverse -310 -323 5.82024 0.182
NP_442142.1_4 Forward -124 -111 5.0336 0.204
NP_442142.1_4 Forward -130 -117 4.34528 0.223
NP_442142.1_4 Reverse -208 -221 3.36198 0.258
NP_442292.1_1 Forward -126 -117 18.486 0.00229
NP_442292.1_1 Reverse -119 -128 18.486 0.00229
NP_442292.1_1 Forward -336 -327 -0.196935 0.239
NP_442292.1_1 Reverse -329 -338 -0.196935 0.239
NP_440919.1_1 Forward -342 -323 -4.81876 0.242
NP_442476.1_6 Reverse -119 -133 3.24451 0.161
NP_442476.1_6 Reverse -329 -343 2.75286 0.174
NP_442476.1_6 Forward -126 -112 0.392915 0.262
NP_443009.1_2 Reverse -330 -349 8.75091 0.216
NP_443009.1_5 Reverse -117 -128 8.90795 0.0965
NP_443009.1_5 Forward -128 -117 8.90795 0.0965
NP_443009.1_5 Reverse -299 -310 5.46638 0.202
NP_443009.1_5 Reverse -327 -338 4.67974 0.234
NP_442301.1_2 Reverse -117 -136 7.27514 0.257
NP_441715.1_4 Forward -126 -116 17.3846 0.0106
NP_441715.1_4 Reverse -119 -129 7.84651 0.107
NP_441198.1_5 Reverse -120 -133 16.0466 0.206
NP_440379.1_5 Forward -142 -123 -10.227 0.276
NP_441468.1_1 Forward -126 -119 15.8704 0.0124
NP_441468.1_1 Reverse -119 -126 15.8704 0.0124
NP_441468.1_1 Forward -336 -329 6.13563 0.209
NP_441468.1_1 Reverse -329 -336 6.0373 0.223
NP_441468.1_1 Forward -308 -301 4.07068 0.263
NP_441468.1_9 Forward -259 -245 19.4691 0.121
NP_441618.1_6 Reverse -241 -260 13.1758 0.3
NP_441020.2_6 Forward -311 -294 11.5436 0.117
NP_441020.2_6 Forward -129 -112 6.23369 0.27
NP_441015.1_10 Forward -132 -113 -2.36049 0.178
NP_441015.1_10 Forward -321 -302 -3.63879 0.19
NP_441015.1_10 Reverse -113 -132 -6.49039 0.249
NP_441015.1_10 Forward -144 -125 -9.93197 0.282
NP_441673.1_1 Forward -127 -118 20.8459 0.000698
NP_441673.1_1 Reverse -118 -127 20.8459 0.000698
NP_441673.1_1 Forward -309 -300 1.37636 0.114
NP_441673.1_1 Forward -337 -328 1.27803 0.155
NP_441673.1_1 Reverse -328 -337 1.27803 0.155
NP_441673.1_1 Reverse -300 -309 1.1797 0.163
NP_441731.1_3 Forward -135 -116 -6.68705 0.296
NP_441826.1_2 Forward -133 -119 20.6491 0.00697
NP_441826.1_2 Reverse -112 -126 5.1128 0.0978
NP_441826.1_2 Forward -127 -113 -0.197071 0.204
NP_441826.1_2 Forward -315 -301 -3.44199 0.285
NP_441330.1_1 Reverse -295 -314 -14.1602 0.214
NP_442490.1_9 Forward -276 -257 -5.40875 0.273
NP_442490.1_9 Forward -139 -120 -8.752 0.293
NP_442490.1_10 Reverse -285 -303 12.7038 0.172
NP_442868.1_6 Reverse -116 -126 19.2529 0.00563
NP_442868.1_6 Forward -129 -119 17.4829 0.012
NP_442719.1_1 Reverse -237 -256 13.4708 0.275
NP_441056.1_1 Forward -127 -108 -0.39387 0.164
NP_440806.1_1 Forward -262 -244 9.45892 0.236
NP_441612.1_2 Reverse -205 -215 8.83972 0.21
NP_441612.1_2 Reverse -118 -128 8.54929 0.21
NP_441612.1_2 Forward -127 -117 8.54929 0.21
NP_442227.1_2 Reverse -123 -142 -2.75381 0.28
NP_442808.1_1 Reverse -117 -127 8.63269 0.0481
NP_442808.1_1 Forward -128 -118 8.63269 0.0481
NP_442808.1_1 Reverse -299 -309 4.89613 0.185
NP_441101.1_10 Reverse -114 -133 3.93269 0.173
NP_441315.1_2 Forward -137 -119 14.3114 0.291
NP_440145.1_3 Reverse -108 -127 6.4893 0.0511
NP_440145.1_3 Forward -137 -118 0.294447 0.137
NP_442542.1_2 Forward -339 -326 18.0139 0.0368
NP_442542.1_2 Forward -135 -122 16.9322 0.0522
NP_442542.1_2 Forward -129 -116 11.229 0.114
NP_442542.1_2 Forward -41 -28 6.80412 0.205
NP_442050.1_5 Forward -129 -119 15.6142 0.01
NP_442050.1_5 Reverse -116 -126 14.3359 0.0206
NP_442050.1_5 Reverse -326 -336 13.4509 0.0343
NP_440038.1_4 Reverse -305 -324 -0.197208 0.279
NP_440601.1_7 Forward -299 -285 14.6509 0.278
NP_441114.1_3 Reverse -53 -62 8.55452 0.231
NP_440558.1_2 Forward -130 -111 3.24438 0.159
NP_440558.1_2 Reverse -216 -235 1.86774 0.175
NP_440558.1_2 Forward -136 -117 -1.57384 0.215
NP_440558.1_2 Reverse -109 -128 -2.85214 0.231
NP_440558.1_2 Reverse -257 -276 -7.4737 0.294
NP_441518.1_3 Reverse -108 -127 -13.7669 0.264
NP_441518.1_3 Forward -244 -225 -14.4552 0.276
NP_441878.1_6 Forward -310 -300 11.4848 0.0176
NP_441878.1_6 Forward -128 -118 10.4031 0.0176
NP_441878.1_6 Reverse -117 -127 10.4031 0.0176
NP_441878.1_6 Reverse -299 -309 -0.314959 0.174
NP_441878.1_6 Forward -134 -124 -7.0998 0.204
NP_441878.1_6 Forward -215 -205 -7.39479 0.222
NP_441036.1_8 Forward -338 -328 12.5664 0.0744
NP_441036.1_8 Forward -128 -118 8.33817 0.174
NP_441036.1_8 Reverse -117 -127 8.33817 0.174
NP_442650.1_2 Reverse -118 -132 4.71948 0.163
NP_441557.1_5 Forward -127 -118 19.9609 0.000699
NP_441557.1_5 Reverse -118 -127 19.9609 0.000699
NP_441557.1_5 Forward -337 -328 8.94785 0.0289
NP_441557.1_5 Reverse -328 -337 0.688044 0.128
NP_441557.1_5 Forward -309 -300 0.491382 0.144
NP_441557.1_5 Reverse -300 -309 0.29472 0.174
NP_441520.1_8 Reverse -358 -377 11.9958 0.231
NP_441445.1_1 Forward -346 -327 6.19431 0.153
NP_441445.1_1 Reverse -319 -338 0.687771 0.27
NP_441590.1_4 Reverse -125 -144 2.06362 0.297
NP_441590.1_4 Reverse -296 -315 1.96529 0.299
NP_442066.2_9 Reverse -114 -127 8.37742 0.185
NP_442066.2_9 Forward -341 -328 8.37742 0.185
NP_441433.1_8 Reverse -347 -366 -2.95047 0.274
NP_442777.1_3 Reverse -293 -311 9.75313 0.158
NP_440101.1_3 Forward -132 -113 1.76941 0.269
NP_441458.1_10 Reverse -109 -128 21.7306 0.0227
NP_442830.1_7 Forward -63 -44 20.354 0.0343
NP_441564.1_10 Reverse -191 -210 0.786102 0.296
NP_442183.1_1 Reverse -118 -132 15.7325 0.0187
NP_442183.1_1 Forward -127 -113 7.27608 0.145
NP_442183.1_1 Forward -337 -323 4.91614 0.239
NP_441574.1_1 Forward -349 -330 -3.44213 0.238
NP_441574.1_1 Forward -139 -120 -5.21209 0.26
NP_440861.1_3 Reverse -107 -125 9.45892 0.296
NP_442347.1_2 Forward -126 -117 12.4878 0.056
NP_442347.1_2 Reverse -119 -128 12.4878 0.056
NP_442347.1_2 Reverse -329 -338 8.94785 0.0718
NP_442645.1_2 Reverse -110 -129 -12.4886 0.144
NP_442645.1_2 Forward -129 -110 -13.0786 0.145
NP_442645.1_2 Forward -135 -116 -22.715 0.293
NP_440547.1_1 Forward -266 -247 11.6017 0.197
NP_441037.1_4 Forward -129 -119 9.55921 0.21
NP_441037.1_4 Forward -311 -301 8.58464 0.237
NP_441037.1_4 Forward -339 -329 7.22024 0.237
NP_441633.1_3 Reverse -116 -129 13.1956 0.018
NP_441633.1_3 Reverse -298 -311 -3.52063 0.177
NP_441633.1_3 Forward -129 -116 -5.97891 0.236
NP_441633.1_3 Reverse -326 -339 -6.07724 0.236
NP_440136.1_2 Forward -126 -119 15.9687 0.0123
NP_440136.1_2 Reverse -119 -126 15.9687 0.0123
NP_440136.1_2 Forward -336 -329 6.23397 0.171
NP_440136.1_2 Reverse -329 -336 6.13563 0.193
NP_442590.1_10 Forward -133 -114 8.35759 0.208
NP_442590.1_10 Forward -322 -303 8.06259 0.215
NP_442998.1_10 Reverse -330 -337 15.5754 0.0102
NP_442998.1_10 Forward -125 -118 15.5754 0.0102
NP_442998.1_10 Reverse -120 -127 15.5754 0.0102
NP_442998.1_10 Reverse -302 -309 6.13563 0.181
NP_440899.1_2 Reverse -41 -60 7.17681 0.237
NP_440299.1_1 Forward -131 -118 19.4882 0.00234
NP_440299.1_1 Reverse -114 -127 12.0151 0.0427
NP_440299.1_1 Forward -313 -300 5.62358 0.169
NP_440299.1_1 Reverse -120 -133 2.18201 0.294
NP_441799.1_1 Reverse -324 -338 7.86545 0.13
NP_441799.1_1 Forward -131 -117 7.47213 0.141
NP_441799.1_1 Reverse -114 -128 4.71887 0.238
NP_440640.1_6 Forward -321 -302 -1.18052 0.299
NP_442802.1_6 Reverse -327 -346 -0.295539 0.204
NP_441007.1_10 Forward -132 -119 8.86907 0.108
NP_441007.1_10 Reverse -113 -126 2.57589 0.183
NP_441007.1_10 Forward -138 -125 -0.275709 0.273
NP_442334.1_2 Forward -137 -120 -13.0392 0.297
NP_441449.1_8 Reverse -191 -210 14.4695 0.24
NP_440256.1_1 Forward -130 -111 1.86774 0.0702
NP_440256.1_1 Reverse -115 -134 -8.45701 0.261
NP_440256.1_1 Forward -124 -105 -9.73531 0.287
NP_440087.1_1 Forward -136 -117 -8.26035 0.278
NP_442007.1_8 Reverse -285 -303 9.16315 0.287
NP_441559.1_8 Reverse -113 -127 -5.70361 0.27
NP_441559.1_8 Forward -132 -118 -6.68692 0.279
NP_441559.1_8 Forward -161 -147 -7.17857 0.287
NP_440915.1_6 Forward -313 -299 14.5526 0.0185
NP_440915.1_6 Reverse -114 -128 11.3077 0.0263
NP_440915.1_6 Forward -131 -117 5.60446 0.088
NP_441296.1_7 Forward -145 -126 16.5191 0.26
NP_440717.1_3 Reverse -303 -317 12.6836 0.227
NP_441704.1_8 Reverse -107 -126 8.55343 0.208
NP_442866.1_1 Forward -342 -323 -3.63879 0.221
NP_442031.1_5 Forward -141 -122 6.88262 0.251
NP_441464.1_8 Reverse -292 -306 5.80112 0.251
NP_440702.1_2 Forward -153 -134 -6.39206 0.257
NP_442453.1_6 Reverse -286 -300 15.1122 0.286
NP_441939.1_3 Forward -126 -107 11.3075 0.114
NP_442993.1_1 Forward -337 -321 -7.90627 0.148
NP_440677.1_1 Forward -136 -117 12.6841 0.136
NP_442386.1_9 Reverse -117 -126 13.8639 0.0289
NP_442386.1_9 Forward -128 -119 13.8639 0.0289
NP_442386.1_9 Reverse -327 -336 11.0124 0.107
NP_442386.1_9 Forward -338 -329 5.9975 0.23
NP_440570.1_5 Forward -137 -118 -3.44213 0.289
NP_440570.1_5 Forward -224 -205 -4.03212 0.299
NP_441340.1_5 Forward -126 -119 15.6737 0.0124
NP_441340.1_5 Reverse -119 -126 15.6737 0.0124
NP_441340.1_5 Forward -336 -329 13.5105 0.0314
NP_441340.1_5 Reverse -329 -336 5.84064 0.208
NP_442484.1_2 Reverse -302 -321 2.94938 0.217
NP_442791.1_5 Reverse -288 -307 -10.0303 0.279
NP_440168.1_8 Reverse -46 -65 4.81767 0.216
NP_440168.1_9 Reverse -116 -135 -2.85214 0.285
NP_440327.1_6 Forward -226 -207 2.94938 0.285
NP_439976.1_4 Reverse -283 -302 4.42355 0.287
NP_442240.1_2 Forward -126 -107 -19.7651 0.295
NP_440586.1_1 Forward -137 -118 -1.57384 0.237
NP_440586.1_8 Forward -126 -119 13.2151 0.026
NP_440586.1_8 Reverse -119 -126 13.2151 0.026
NP_440586.1_8 Forward -308 -301 10.9535 0.119
NP_440586.1_8 Reverse -329 -336 9.47853 0.146
NP_440586.1_8 Forward -336 -329 5.74197 0.283
NP_440586.1_8 Reverse -206 -213 5.64364 0.297
NP_442251.1_6 Forward -126 -119 15.2804 0.0124
NP_442251.1_6 Reverse -119 -126 15.2804 0.0124
NP_440192.1_5 Forward -152 -133 3.53937 0.271
NP_440684.1_9 Forward -133 -119 10.6193 0.194
NP_441262.1_3 Reverse -118 -125 14.7888 0.0223
NP_441262.1_3 Forward -337 -330 14.7888 0.0223
NP_441262.1_3 Forward -127 -120 14.7888 0.0223
NP_441262.1_3 Forward -309 -302 5.25066 0.215
NP_440027.1_3 Reverse -108 -126 6.1149 0.23
NP_440027.1_3 Forward -127 -109 2.18168 0.292
NP_440027.1_3 Reverse -118 -136 2.08335 0.293
NP_440027.1_3 Reverse -286 -304 1.5917 0.3
NP_443051.1_1 Reverse -117 -126 10.4228 0.00754
NP_443051.1_1 Forward -128 -119 10.4228 0.00754
NP_443051.1_1 Forward -338 -329 7.47288 0.0571
NP_443051.1_1 Reverse -299 -308 -0.0986038 0.256
NP_443051.1_1 Forward -310 -301 -1.18024 0.297
NP_439996.1_9 Forward -64 -45 14.1583 0.19
NP_441232.1_10 Forward -138 -119 5.80098 0.173
NP_439937.1_8 Forward -138 -119 3.44104 0.204
NP_439937.1_8 Forward -135 -116 -4.72043 0.286
NP_439937.1_9 Reverse -117 -134 -15.9897 0.287
NP_439937.1_9 Reverse -218 -235 -16.4814 0.287
NP_439937.1_9 Reverse -327 -344 -16.973 0.291
NP_440408.1_7 Forward -322 -303 8.55425 0.276
NP_440439.1_1 Forward -130 -117 3.65753 0.11
NP_440439.1_1 Forward -340 -327 0.805932 0.175
NP_440439.1_1 Reverse -297 -310 0.707601 0.179
NP_440439.1_1 Reverse -60 -73 -1.35735 0.263
NP_442239.1_8 Forward -316 -297 9.3409 0.249
NP_439943.1_4 Forward -148 -129 4.52268 0.287
NP_440372.1_2 Forward -126 -119 16.3621 0.0124
NP_440372.1_2 Reverse -119 -126 16.3621 0.0124
NP_440372.1_2 Forward -336 -329 13.8055 0.0214
NP_440372.1_2 Reverse -329 -336 6.52896 0.188
NP_440819.1_5 Reverse -92 -100 7.98423 0.228
NP_441293.1_6 Reverse -333 -352 19.1457 0.1
NP_440316.1_10 Forward -134 -124 12.6647 0.214
NP_440316.1_10 Forward -14 -4 7.25653 0.251
NP_440316.1_10 Forward -296 -286 6.76487 0.253
NP_441803.1_2 Forward -321 -302 3.73603 0.191
NP_441803.1_2 Forward -132 -113 1.27776 0.235
NP_441803.1_7 Forward -267 -248 17.6982 0.158
NP_439977.1_5 Reverse -112 -131 18.289 0.0361
NP_439977.1_5 Reverse -294 -313 2.26107 0.176
NP_442416.1_1 Forward -115 -96 8.06865 0.219
NP_441572.1_7 Forward -315 -296 7.86593 0.0744
NP_440267.1_2 Reverse -295 -309 15.4369 0.0805
NP_442384.1_10 Forward -127 -114 13.4906 0.0197
NP_442384.1_10 Reverse -118 -131 12.9006 0.0241
NP_442384.1_10 Forward -309 -296 7.39411 0.0822
NP_442384.1_10 Forward -322 -309 6.70579 0.0963
NP_442384.1_10 Reverse -328 -341 4.44418 0.157
NP_442384.1_10 Forward -72 -59 2.67422 0.216
NP_442384.1_10 Reverse -205 -218 1.00259 0.271
NP_442114.1_4 Reverse -328 -339 10.3834 0.17
NP_440364.1_10 Forward -303 -284 15.3391 0.256
NP_441604.1_4 Forward -68 -49 -4.32711 0.224
NP_441877.1_5 Forward -60 -41 1.17943 0.276
NP_442235.1_3 Reverse -324 -343 7.66927 0.172
NP_441018.1_3 Forward -152 -133 12.1917 0.286
NP_441018.1_7 Forward -131 -112 15.0441 0.116
NP_441018.1_7 Forward -143 -124 11.2092 0.19
NP_441018.1_7 Forward -212 -193 9.63589 0.22
NP_442790.1_4 Forward -318 -299 2.45773 0.0729
NP_442790.1_4 Forward -136 -117 -7.67036 0.156
NP_442262.1_10 Forward -126 -119 14.1988 0.0123
NP_442262.1_10 Reverse -119 -126 14.1988 0.0123
NP_442262.1_10 Reverse -329 -336 13.2155 0.0213
NP_442262.1_10 Forward -308 -301 11.7405 0.0841
NP_441689.1_5 Reverse -326 -336 15.3192 0.0403
NP_441689.1_5 Forward -129 -119 5.87944 0.197
NP_441689.1_5 Reverse -116 -126 5.78111 0.197
NP_440344.1_10 Reverse -111 -128 2.20212 0.0286
NP_440344.1_10 Forward -134 -117 -8.41762 0.127
NP_440344.1_10 Reverse -321 -338 -10.8759 0.194
NP_440282.1_3 Reverse -302 -321 -4.81876 0.298
NP_440531.1_6 Reverse -110 -129 -1.86883 0.241
NP_440531.1_6 Reverse -226 -245 -5.01543 0.291
NP_440531.1_7 Forward -399 -380 17.5024 0.26
NP_440531.1_8 Forward -104 -85 4.03102 0.269
NP_440562.1_3 Reverse -119 -136 14.8868 0.0567
NP_441965.1_3 Forward -137 -118 5.89931 0.149
NP_441965.1_3 Reverse -108 -127 3.04771 0.196
NP_441965.1_3 Forward -308 -289 1.0811 0.224
NP_441965.1_10 Forward -312 -296 5.76173 0.197
NP_441965.1_10 Forward -120 -104 5.76173 0.197
NP_441965.1_10 Forward -130 -114 1.92682 0.297
NP_442693.1_6 Reverse -294 -313 1.67108 0.278
NP_442556.1_10 Forward -211 -192 15.6107 0.161
NP_440297.1_9 Reverse -301 -311 -0.0199663 0.282
NP_440297.1_9 Forward -233 -223 -0.0199663 0.282
NP_440297.1_9 Forward -126 -116 -0.118297 0.282
NP_440297.1_9 Reverse -119 -129 -0.216628 0.282
NP_442280.1_10 Forward -364 -346 8.47384 0.258
NP_441592.1_4 Reverse -118 -137 4.52268 0.148
NP_441592.1_4 Reverse -313 -332 0.392778 0.232
NP_441896.1_3 Reverse -109 -128 0.491109 0.225
NP_441679.1_6 Forward -132 -113 14.9458 0.08
NP_440999.1_9 Forward -131 -117 11.8976 0.0437
NP_440999.1_9 Reverse -114 -128 11.111 0.0474
NP_440999.1_9 Reverse -260 -274 0.589577 0.18
NP_440888.1_2 Reverse -118 -132 18.8785 0.00178
NP_440888.1_2 Forward -127 -113 18.2885 0.00261
NP_440888.1_2 Reverse -328 -342 12.192 0.0495
NP_440888.1_2 Forward -72 -58 5.1122 0.293
NP_440600.1_4 Reverse -110 -128 0.314141 0.14
NP_440179.1_6 Reverse -329 -348 6.19431 0.22
NP_440491.1_1 Forward -130 -111 13.4467 0.122
NP_439969.1_3 Forward -314 -295 9.43923 0.116
NP_442948.1_2 Forward -338 -319 9.43923 0.173
NP_442948.1_2 Reverse -117 -136 3.44104 0.283
NP_440237.1_5 Forward -212 -198 11.4053 0.256
NP_442033.1_10 Reverse -116 -135 1.57275 0.0882
NP_442033.1_10 Forward -129 -110 -4.91709 0.179
NP_442033.1_10 Forward -349 -330 -5.80207 0.18
NP_441543.1_2 Forward -126 -117 16.9127 0.00359
NP_441543.1_2 Reverse -119 -128 16.9127 0.00359
NP_441543.1_2 Reverse -329 -338 8.65285 0.0968
NP_441543.1_2 Forward -336 -327 4.52295 0.234
NP_441543.1_2 Forward -308 -299 4.52295 0.234
NP_442845.1_2 Forward -133 -119 14.0609 0.0872
NP_442845.1_2 Forward -328 -314 3.63784 0.282
NP_442845.1_2 Forward -101 -87 3.24451 0.298
NP_442845.1_4 Forward -339 -320 8.55425 0.185
NP_440739.1_1 Forward -29 -10 10.4225 0.284
NP_441258.1_9 Forward -273 -254 17.109 0.139
NP_440982.1_1 Reverse -271 -290 5.01354 0.294
NP_441469.1_8 Forward -128 -119 6.48957 0.227
NP_441469.1_8 Reverse -117 -126 6.48957 0.227
NP_441469.1_8 Forward -338 -329 6.39124 0.227
NP_442315.1_1 Forward -141 -123 9.65558 0.194
NP_443064.1_6 Forward -127 -117 12.5669 0.0796
NP_443064.1_6 Reverse -118 -128 12.5669 0.0796
NP_442337.1_8 Forward -30 -11 -0.787193 0.278
NP_442578.1_7 Forward -126 -119 14.5921 0.026
NP_442578.1_7 Reverse -119 -126 14.5921 0.026
NP_442578.1_7 Forward -336 -329 6.0373 0.18
NP_442578.1_7 Forward -308 -301 5.15232 0.291
NP_440710.1_1 Reverse -292 -310 1.39578 0.136
NP_440710.1_1 Reverse -110 -128 -2.0458 0.189
NP_440071.1_1 Reverse -50 -67 11.9361 0.226
NP_441462.1_2 Forward -127 -117 11.5831 0.00406
NP_441462.1_2 Reverse -118 -128 11.5831 0.00406
NP_441462.1_2 Forward -337 -327 8.82982 0.03
NP_441462.1_2 Forward -309 -299 1.16001 0.0976
NP_441462.1_2 Reverse -300 -310 0.471689 0.148
NP_441621.1_7 Forward -138 -124 -2.26202 0.188
NP_441621.1_7 Forward -311 -297 -6.58858 0.298
NP_443062.1_1 Reverse -328 -346 8.35091 0.155
NP_440349.1_3 Reverse -119 -138 11.5033 0.282
NP_442204.1_1 Reverse -309 -320 2.51695 0.266
NP_442204.1_1 Reverse -114 -125 2.22195 0.266
NP_442204.1_1 Forward -131 -120 0.648657 0.281
NP_442204.1_5 Reverse -254 -273 11.3075 0.0777
NP_441560.1_10 Forward -222 -203 7.37428 0.28
NP_441560.1_10 Reverse -110 -129 5.80098 0.292
NP_440544.1_5 Forward -365 -358 14.5681 0.264
NP_441351.1_8 Forward -129 -110 3.6377 0.232
NP_440516.1_8 Forward -127 -118 16.9127 0.00442
NP_440516.1_8 Reverse -118 -127 16.9127 0.00442
NP_440516.1_8 Forward -337 -328 9.4395 0.0183
NP_440516.1_8 Reverse -328 -337 5.11294 0.118
NP_442428.1_4 Reverse -263 -282 8.06259 0.18
NP_442428.1_5 Forward -126 -119 15.8704 0.0124
NP_442428.1_5 Reverse -119 -126 15.8704 0.0124
NP_442428.1_5 Forward -336 -329 6.13563 0.209
NP_442428.1_5 Reverse -329 -336 6.0373 0.212
NP_442428.1_5 Forward -308 -301 4.46401 0.267
NP_440618.1_1 Forward -290 -271 -11.2103 0.297
NP_440673.1_2 Reverse -108 -127 12.6333 0.142
NP_440673.1_2 Forward -137 -118 9.31652 0.248
NP_440673.1_3 Forward -125 -118 12.4288 0.0426
NP_440673.1_3 Reverse -330 -337 12.4288 0.0426
NP_440673.1_3 Reverse -120 -127 12.4288 0.0426
NP_440673.1_3 Reverse -302 -309 11.6422 0.0724
NP_440673.1_3 Forward -50 -43 9.08556 0.202
NP_440673.1_7 Forward -320 -301 4.916 0.185
NP_441052.1_2 Forward -127 -117 19.9412 0.00106
NP_441052.1_2 Reverse -118 -128 19.9412 0.00106
NP_441052.1_2 Forward -214 -204 4.99491 0.135
NP_441052.1_2 Reverse -205 -215 4.40493 0.159
NP_441052.1_2 Forward -309 -299 3.91327 0.17
NP_441052.1_2 Reverse -313 -323 0.865012 0.256
NP_441052.1_2 Forward -337 -327 0.57002 0.256
NP_442219.1_8 Forward -131 -112 14.6415 0.136
NP_442219.1_8 Forward -137 -118 13.192 0.153
NP_442219.1_9 Forward -126 -117 17.7976 0.00718
NP_442219.1_9 Reverse -119 -128 17.7976 0.00718
NP_442219.1_9 Forward -336 -327 8.75118 0.0681
NP_442219.1_9 Forward -213 -204 1.86802 0.295
NP_440436.1_4 Forward -126 -117 17.2072 0.00233
NP_440436.1_4 Reverse -119 -128 17.2072 0.00233
NP_440436.1_4 Reverse -329 -338 8.55409 0.0997
NP_440436.1_4 Forward -336 -327 6.39082 0.162
NP_441884.1_9 Reverse -115 -134 -4.81876 0.0594
NP_441884.1_9 Reverse -8 -27 -21.9284 0.272
NP_441884.1_9 Forward -130 -111 -22.125 0.275
NP_440314.1_9 Reverse -119 -138 11.5042 0.0289
NP_442414.1_8 Reverse -281 -300 7.7676 0.292
NP_442907.1_9 Reverse -284 -303 -1.57384 0.24
NP_441719.1_4 Forward -126 -119 16.3621 0.0124
NP_441719.1_4 Reverse -119 -126 16.3621 0.0124
NP_441719.1_4 Forward -336 -329 6.82395 0.0855
NP_441719.1_4 Reverse -329 -336 6.52896 0.188
NP_441719.1_4 Forward -308 -301 3.77569 0.285
NP_441733.1_10 Forward -340 -327 7.59077 0.153
NP_441004.1_1 Forward -315 -296 8.94757 0.065
NP_441004.1_1 Forward -290 -271 -5.31042 0.175
NP_441004.1_1 Forward -139 -120 -7.96535 0.2
NP_441004.1_1 Forward -293 -274 -11.2103 0.234
NP_441004.1_1 Forward -23 -4 -17.6018 0.292
NP_441004.1_1 Forward -388 -369 -17.7985 0.294
NP_441004.1_4 Forward -312 -302 16.4013 0.152
NP_441004.1_5 Forward -313 -299 9.63603 0.252
NP_439949.1_7 Forward -374 -360 12.3893 0.269
NP_440296.1_10 Forward -312 -293 -11.1119 0.269
NP_441115.1_4 Reverse -299 -317 12.5064 0.102
NP_441115.1_4 Reverse -107 -125 9.26148 0.221
NP_442206.1_1 Forward -229 -210 -6.68705 0.219
NP_442206.1_10 Forward -337 -322 2.92983 0.196
NP_442206.1_10 Forward -93 -78 0.0782283 0.274
NP_443054.1_2 Reverse -326 -340 1.57289 0.245
NP_443054.1_2 Reverse -116 -130 0.786239 0.254
NP_441851.1_10 Forward -128 -118 15.8113 0.00552
NP_441851.1_10 Reverse -117 -127 15.8113 0.00552
NP_441851.1_10 Forward -310 -300 12.0747 0.0568
NP_441851.1_10 Forward -338 -328 7.55152 0.137
NP_442208.1_5 Forward -324 -305 -9.83364 0.295
NP_442856.1_7 Reverse -304 -323 2.26107 0.161
NP_442856.1_7 Forward -136 -117 -0.295539 0.207
NP_442856.1_7 Reverse -109 -128 -4.03212 0.254
NP_441668.1_4 Forward -242 -223 9.93088 0.113
NP_442515.1_1 Reverse -117 -131 11.406 0.0412
NP_442515.1_1 Forward -128 -114 2.06454 0.143
NP_442515.1_1 Forward -229 -215 1.08123 0.172
NP_442515.1_1 Reverse -327 -341 -3.63866 0.295
NP_442515.1_1 Reverse -29 -43 -4.4253 0.298
NP_441396.1_5 Forward -378 -369 18.0926 0.141
NP_440593.1_3 Reverse -113 -132 4.03102 0.145
NP_440593.1_3 Forward -132 -113 1.76941 0.185
NP_440593.1_3 Reverse -119 -138 -5.40875 0.259
NP_440463.1_8 Reverse -274 -293 11.9533 0.203
NP_440165.1_5 Forward -310 -291 -8.35868 0.298
NP_441349.1_10 Reverse -108 -127 8.45592 0.0272
NP_441349.1_10 Forward -137 -118 -6.68705 0.235
NP_441409.1_6 Forward -133 -114 -12.0953 0.225
NP_440432.1_9 Forward -126 -111 -3.75668 0.19
NP_440432.1_9 Forward -336 -321 -4.93665 0.228
NP_442843.1_1 Forward -354 -335 -11.8986 0.295
NP_439960.1_10 Reverse -111 -129 3.46073 0.163
NP_439960.1_10 Forward -296 -278 1.49411 0.198
NP_440474.1_8 Reverse -44 -58 5.40719 0.25
NP_440396.1_10 Reverse -119 -135 15.3974 0.151
NP_441477.1_10 Forward -134 -116 9.16393 0.181
NP_441477.1_10 Forward -316 -298 -0.7675 0.294
NP_440588.1_2 Forward -136 -117 -0.0988766 0.15
NP_440195.1_4 Forward -349 -330 23.5006 0.0148
NP_442006.1_2 Forward -121 -104 -16.8741 0.265
NP_442006.1_2 Reverse -85 -102 -19.1357 0.299
NP_441003.1_9 Forward -223 -204 12.9791 0.213
NP_441003.1_9 Forward -76 -57 5.211 0.266
NP_442243.1_1 Reverse -307 -325 -1.16155 0.269
NP_441570.1_1 Forward -127 -109 10.1472 0.0095
NP_441570.1_1 Forward -337 -319 -8.73231 0.12
NP_441570.1_1 Reverse -118 -136 -16.7954 0.254
NP_441570.1_1 Forward -39 -21 -17.5821 0.283
NP_441078.1_4 Forward -127 -118 19.6659 0.0007
NP_441078.1_4 Reverse -118 -127 19.6659 0.0007
NP_441078.1_4 Forward -309 -300 7.66954 0.052
NP_441078.1_4 Reverse -300 -309 0.491382 0.188
NP_441078.1_4 Reverse -328 -337 0.0980582 0.205
NP_441078.1_4 Forward -337 -328 0.0980582 0.205
NP_441078.1_4 Forward -214 -205 -1.96689 0.282
NP_442729.1_8 Forward -131 -118 8.77074 0.125
NP_440539.1_9 Reverse -22 -41 -6.98204 0.294
NP_442348.1_2 Forward -371 -362 17.011 0.055
NP_442443.1_1 Reverse -256 -275 -3.14714 0.264
NP_440526.1_3 Reverse -119 -130 10.6779 0.0646
NP_440526.1_3 Forward -126 -115 10.2846 0.0646
NP_440526.1_3 Reverse -226 -237 8.51463 0.122
NP_440526.1_3 Reverse -301 -312 1.82816 0.267
NP_440526.1_3 Reverse -125 -136 0.353199 0.287
NP_441432.1_8 Reverse -117 -126 16.8143 0.00595
NP_441432.1_8 Forward -128 -119 16.8143 0.00595
NP_441432.1_8 Forward -338 -329 5.50626 0.151
NP_441432.1_8 Reverse -312 -321 3.14632 0.259
NP_442320.1_8 Reverse -322 -336 11.0127 0.0184
NP_442320.1_8 Reverse -112 -126 6.29277 0.029
NP_442320.1_8 Forward -133 -119 4.81781 0.0459
NP_442344.1_7 Reverse -329 -348 -8.65367 0.222
NP_441732.1_2 Reverse -114 -130 4.18844 0.0141
NP_441732.1_2 Forward -131 -115 -6.52964 0.0495
NP_440497.1_2 Reverse -119 -138 11.9958 0.172
NP_440760.1_1 Forward -127 -108 -5.60541 0.0503
NP_440760.1_1 Reverse -118 -137 -14.7502 0.135
NP_440760.1_1 Reverse -264 -283 -21.4367 0.237
NP_442797.1_1 Reverse -125 -144 -5.70374 0.288
NP_442797.1_7 Reverse -111 -129 2.28076 0.243
NP_440199.1_10 Reverse -115 -125 7.25653 0.231
NP_440578.1_10 Forward -369 -350 12.5858 0.246
NP_440913.1_1 Forward -129 -111 18.8004 0.0951
NP_442489.1_7 Forward -127 -118 20.1576 0.000695
NP_442489.1_7 Reverse -118 -127 20.1576 0.000695
NP_442489.1_7 Forward -309 -300 8.1612 0.0294
NP_442489.1_7 Reverse -300 -309 7.47288 0.0613
NP_442489.1_7 Reverse -328 -337 0.786375 0.152
NP_442489.1_7 Forward -337 -328 0.589713 0.17
NP_442489.1_7 Forward -214 -205 -1.47524 0.203
NP_442079.1_7 Reverse -329 -348 7.07928 0.145
NP_440559.1_1 Forward -126 -117 17.4043 0.00658
NP_440559.1_1 Reverse -119 -128 17.4043 0.00658
NP_440559.1_1 Forward -336 -327 14.7494 0.0118
NP_441659.2_8 Forward -127 -117 18.1713 0.00133
NP_441659.2_8 Reverse -118 -128 18.1713 0.00133
NP_441659.2_8 Reverse -300 -310 7.64985 0.0576
NP_441659.2_8 Reverse -328 -338 6.56821 0.0714
NP_441659.2_8 Forward -309 -299 1.65166 0.233
NP_441659.2_8 Reverse -124 -134 1.455 0.24
NP_440426.1_7 Reverse -290 -309 1.0811 0.248
NP_441022.1_1 Reverse -249 -258 11.0666 0.284
NP_442913.1_10 Forward -136 -117 3.44104 0.107
NP_439956.1_7 Forward -315 -296 4.03102 0.257
NP_439956.1_7 Forward -123 -104 2.75272 0.273
NP_442346.1_5 Forward -128 -118 16.6963 0.00248
NP_442346.1_5 Reverse -117 -127 16.6963 0.00248
NP_442346.1_5 Reverse -312 -322 10.5014 0.0934
NP_442346.1_5 Forward -323 -313 8.1415 0.146
NP_442346.1_5 Forward -310 -300 8.04317 0.149
NP_442346.1_5 Reverse -123 -133 6.46988 0.201
NP_442346.1_5 Reverse -299 -309 5.28991 0.253
NP_442346.1_5 Reverse -327 -337 4.69992 0.276
NP_442346.1_5 Forward -197 -187 4.60159 0.281
NP_442346.1_5 Forward -271 -261 4.20827 0.296
NP_442346.1_10 Forward -306 -287 4.12936 0.184
NP_440545.1_3 Forward -131 -114 7.217 0.0518
NP_440545.1_3 Forward -313 -296 2.98877 0.0903
NP_440545.1_3 Reverse -114 -131 -0.0594896 0.147
NP_440545.1_3 Reverse -296 -313 -1.73112 0.173
NP_441923.1_6 Reverse -253 -267 11.8976 0.249
NP_441126.1_8 Forward -298 -285 6.21414 0.291
NP_440459.1_2 Reverse -298 -315 17.2468 0.0834
NP_441653.1_3 Forward -45 -31 13.9626 0.265
NP_440010.1_4 Forward -137 -118 -1.47628 0.267
NP_440010.1_10 Forward -139 -120 2.26107 0.285
NP_441943.1_8 Reverse -55 -74 4.916 0.164
NP_441943.1_8 Forward -319 -300 -13.2752 0.265
NP_442603.1_7 Reverse -118 -132 18.7801 0.0119
NP_442603.1_7 Reverse -300 -314 11.9953 0.107
NP_442603.1_7 Forward -270 -256 5.60385 0.284
NP_441585.1_6 Reverse -226 -245 12.6833 0.284
NP_441888.1_7 Reverse -107 -121 5.40779 0.225
NP_441888.1_7 Forward -132 -118 3.8345 0.225
NP_441888.1_7 Reverse -113 -127 2.5562 0.225
NP_440449.1_6 Forward -317 -299 17.3986 0.0724
NP_441047.1_2 Forward -126 -107 -2.36049 0.273
NP_440170.1_6 Reverse -295 -314 13.8641 0.245
NP_441833.1_4 Forward -126 -119 15.9687 0.0124
NP_441833.1_4 Reverse -119 -126 15.9687 0.0124
NP_441833.1_4 Reverse -329 -336 6.52896 0.0924
NP_441833.1_4 Forward -336 -329 6.23397 0.163
NP_441112.1_6 Reverse -14 -33 2.3594 0.242
NP_442162.1_9 Forward -126 -119 16.2637 0.0124
NP_442162.1_9 Reverse -119 -126 16.2637 0.0124
NP_442162.1_9 Forward -336 -329 12.9205 0.0282
NP_442162.1_9 Reverse -329 -336 12.9205 0.0282
NP_440671.1_4 Reverse -322 -336 11.0127 0.142
NP_440671.1_4 Reverse -112 -126 8.45605 0.198
NP_440224.1_1 Reverse -317 -336 -1.96717 0.192
NP_442199.1_5 Reverse -320 -339 -7.08038 0.286
NP_442140.1_3 Reverse -329 -339 15.418 0.0393
NP_442140.1_3 Reverse -119 -129 13.5497 0.0542
NP_442140.1_3 Forward -126 -116 10.3048 0.0902
NP_441671.1_1 Forward -123 -104 9.83255 0.176
NP_440875.1_9 Forward -307 -297 12.2655 0.127
NP_440875.1_9 Reverse -288 -298 10.1241 0.231
NP_440875.1_9 Reverse -330 -340 9.44274 0.233
NP_440875.1_9 Forward -320 -310 8.5667 0.233
NP_440875.1_9 Forward -125 -115 7.69067 0.255
NP_441813.1_5 Reverse -116 -126 18.1713 0.00743
NP_441813.1_5 Reverse -326 -336 11.9764 0.0208
NP_441813.1_5 Forward -129 -119 8.73149 0.0367
NP_441813.1_5 Forward -339 -329 0.275027 0.206
NP_440590.1_4 Forward -126 -113 21.0621 0.00401
NP_440590.1_4 Reverse -119 -132 14.2773 0.011
NP_440590.1_4 Reverse -329 -342 2.77255 0.0813
NP_440567.1_1 Reverse -119 -133 14.8476 0.0186
NP_440567.1_1 Reverse -301 -315 1.08123 0.219
NP_440567.1_1 Forward -126 -112 0.196253 0.254
NP_442497.1_10 Forward -126 -117 10.4228 0.0087
NP_442497.1_10 Reverse -119 -128 10.4228 0.0087
NP_442497.1_10 Reverse -329 -338 0.589713 0.153
NP_442497.1_10 Reverse -301 -310 0.196389 0.208
NP_442497.1_10 Forward -336 -327 -1.18024 0.256
NP_440821.1_4 Forward -129 -119 17.9746 0.00497
NP_440821.1_4 Reverse -116 -126 9.41981 0.0286
NP_440821.1_4 Forward -339 -329 9.02648 0.0364
NP_440821.1_4 Forward -311 -301 0.0783647 0.205
NP_440821.1_4 Reverse -326 -336 -0.314959 0.251
NP_441239.1_9 Reverse -298 -310 7.80712 0.148
NP_441239.1_9 Forward -129 -117 7.11881 0.169
NP_441239.1_9 Reverse -116 -128 5.25052 0.223
NP_441239.1_9 Forward -311 -299 4.26721 0.256
NP_441239.1_9 Reverse -326 -338 4.07055 0.264
NP_441951.1_4 Forward -139 -120 2.0644 0.283
NP_441727.1_3 Reverse -111 -130 2.65439 0.299
NP_441892.1_1 Reverse -109 -126 1.12048 0.157
NP_441892.1_1 Forward -318 -301 -3.8944 0.251
NP_441892.1_1 Reverse -202 -219 -4.38605 0.26
NP_441892.1_1 Reverse -34 -51 -5.36936 0.279
NP_440665.1_1 Forward -226 -207 -16.6185 0.292
NP_442044.1_1 Reverse -113 -132 -13.4719 0.277
NP_442044.1_1 Reverse -163 -182 -14.5535 0.291
NP_440796.1_3 Forward -134 -116 11.4247 0.204
NP_442193.1_8 Forward -130 -111 16.9115 0.211
NP_442270.1_9 Reverse -107 -126 -7.57203 0.213
NP_442270.1_9 Forward -138 -119 -9.63698 0.238
NP_441017.1_6 Reverse -114 -128 14.6503 0.138
NP_441017.1_6 Reverse -324 -338 11.012 0.285
NP_440833.1_6 Reverse -372 -386 12.487 0.189
NP_440354.1_7 Forward -343 -325 7.88563 0.26
NP_442138.1_10 Forward -337 -318 -0.39387 0.153
NP_440546.1_4 Forward -337 -327 12.6639 0.0641
NP_440546.1_4 Reverse -328 -338 10.046 0.109
NP_440546.1_4 Forward -127 -117 10.046 0.109
NP_440546.1_4 Reverse -118 -128 10.046 0.109
NP_443033.1_7 Reverse -52 -71 11.7992 0.281
NP_442041.1_5 Reverse -241 -260 2.85105 0.246
NP_440675.1_1 Forward -304 -285 1.76941 0.285
NP_440462.1_6 Forward -129 -119 10.3048 0.0396
NP_440462.1_6 Reverse -116 -126 9.61647 0.0429
NP_440462.1_6 Forward -339 -329 8.4365 0.062
NP_440462.1_6 Reverse -326 -336 4.10993 0.216
NP_442611.1_1 Forward -309 -290 15.2408 0.0513
NP_442611.1_1 Reverse -113 -132 -2.36049 0.292
NP_440868.1_4 Forward -131 -119 9.97041 0.0405
NP_440868.1_4 Forward -341 -329 9.38042 0.049
NP_440868.1_4 Reverse -296 -308 3.67722 0.134
NP_440868.1_4 Reverse -114 -126 1.02229 0.193
NP_442499.1_3 Reverse -117 -135 20.2753 0.0596
NP_441084.1_6 Reverse -311 -325 15.8402 0.0737
NP_440653.1_10 Reverse -301 -320 2.3594 0.289
NP_440696.1_3 Forward -127 -109 1.88744 0.217
NP_440696.1_6 Forward -321 -302 12.6841 0.207
NP_442039.1_4 Forward -126 -119 15.1821 0.0124
NP_442039.1_4 Reverse -119 -126 15.1821 0.0124
NP_442039.1_4 Forward -336 -329 11.6422 0.0747
NP_441811.1_8 Forward -133 -119 9.83269 0.225
NP_441811.1_8 Forward -139 -125 7.57108 0.241
NP_442409.1_6 Forward -122 -103 15.7324 0.18
NP_442837.1_3 Forward -126 -119 15.7721 0.0124
NP_442837.1_3 Reverse -119 -126 15.7721 0.0124
NP_442837.1_3 Forward -336 -329 6.0373 0.25
NP_442837.1_3 Reverse -329 -336 6.0373 0.25
NP_440160.1_2 Forward -273 -254 -8.55534 0.286
NP_440160.1_9 Forward -285 -266 13.8641 0.204
NP_442053.1_1 Forward -127 -118 18.3876 0.0007
NP_442053.1_1 Reverse -118 -127 18.3876 0.0007
NP_442053.1_1 Reverse -328 -337 7.17789 0.104
NP_442053.1_1 Reverse -300 -309 6.48957 0.13
NP_440505.1_3 Reverse -116 -126 18.3679 0.00213
NP_440505.1_3 Forward -129 -119 16.598 0.00683
NP_440505.1_3 Forward -339 -329 12.5664 0.0482
NP_440505.1_7 Forward -59 -40 3.24438 0.216
NP_441203.1_1 Reverse -301 -320 -5.80207 0.107
NP_442532.1_7 Reverse -118 -132 6.29277 0.171
NP_442009.1_9 Reverse -231 -250 8.65258 0.256
NP_441408.2_7 Reverse -379 -398 -3.3438 0.272
NP_440914.1_1 Forward -127 -117 17.5935 0.000537
NP_440914.1_1 Reverse -118 -128 17.5935 0.000537
NP_441699.1_2 Reverse -83 -102 7.96426 0.265
NP_441011.1_8 Forward -126 -117 8.25953 0.144
NP_441011.1_8 Reverse -119 -128 8.25953 0.144
NP_441011.1_8 Reverse -329 -338 7.07956 0.179
NP_441011.1_8 Forward -336 -327 5.99792 0.208
NP_442533.1_1 Forward -290 -271 -8.45701 0.205
NP_442533.1_6 Forward -127 -118 17.2076 0.00137
NP_442533.1_6 Reverse -118 -127 17.2076 0.00137
NP_442533.1_6 Reverse -313 -322 11.8978 0.0362
NP_442533.1_6 Reverse -300 -309 7.86621 0.0862
NP_442533.1_6 Forward -309 -300 6.48957 0.109
NP_442533.1_6 Reverse -205 -214 5.70292 0.132
NP_442533.1_6 Forward -337 -328 5.40793 0.14
NP_442533.1_6 Reverse -328 -337 4.52295 0.179
NP_442533.1_6 Forward -273 -264 2.55633 0.25
NP_441089.1_8 Reverse -298 -317 14.6499 0.266
NP_442541.1_10 Reverse -102 -116 0.785655 0.298
NP_441482.1_7 Reverse -112 -126 8.94771 0.0162
NP_441482.1_7 Forward -133 -119 -10.1285 0.209
NP_439944.1_9 Reverse -119 -129 19.1546 0.00329
NP_439944.1_9 Forward -126 -116 10.5014 0.0887
NP_439944.1_9 Forward -336 -326 8.04317 0.121
NP_441028.1_6 Forward -366 -356 4.7978 0.277
NP_440116.1_8 Forward -308 -289 -3.83545 0.158
NP_440116.1_8 Reverse -329 -348 -5.9004 0.197
NP_441527.1_4 Reverse -166 -185 -8.54695 0.247
NP_440115.1_6 Forward -130 -120 17.9746 0.0163
NP_440115.1_6 Reverse -40 -50 7.84651 0.146
NP_440115.1_6 Reverse -115 -125 6.8632 0.167
NP_440007.1_9 Reverse -114 -128 8.55439 0.175
NP_440007.1_9 Forward -218 -204 6.58777 0.221
NP_440007.1_9 Forward -282 -268 1.27789 0.289
NP_441347.1_5 Forward -310 -296 12.2903 0.245
NP_441602.1_3 Reverse -113 -132 7.86593 0.117
NP_441602.1_3 Forward -132 -113 -1.7705 0.231
NP_441602.1_3 Forward -25 -6 -5.31042 0.282
NP_441972.1_5 Forward -126 -107 -5.70374 0.224
NP_441106.1_1 Forward -128 -119 9.63616 0.0311
NP_441106.1_1 Reverse -117 -126 9.63616 0.0311
NP_441106.1_1 Forward -338 -329 8.45619 0.0548
NP_440429.1_2 Reverse -113 -132 7.66927 0.28
NP_440429.1_9 Reverse -224 -243 3.93269 0.256
NP_442306.1_10 Reverse -295 -314 -20.8467 0.231
NP_441286.1_1 Reverse -117 -129 21.6718 0.00196
NP_441286.1_1 Forward -128 -116 12.9203 0.00815
NP_441286.1_1 Forward -21 -9 0.923956 0.102
NP_441286.1_1 Reverse -327 -339 -4.18925 0.152
NP_441286.1_1 Reverse -299 -311 -4.87757 0.18
NP_441286.1_1 Forward -338 -326 -6.84419 0.283
NP_441286.1_1 Reverse -123 -135 -6.94252 0.288
NP_442674.1_3 Reverse -110 -129 9.7334 0.174
NP_441385.1_1 Forward -379 -364 16.4995 0.254
NP_440670.1_8 Forward -127 -118 18.3876 0.000699
NP_440670.1_8 Reverse -118 -127 18.3876 0.000699
NP_440670.1_8 Forward -337 -328 8.65285 0.0627
NP_440670.1_8 Reverse -328 -337 6.29291 0.124
NP_440886.1_7 Forward -128 -118 7.94438 0.0805
NP_440886.1_7 Reverse -117 -127 7.94438 0.0805
NP_440886.1_7 Forward -265 -255 4.69947 0.22
NP_442382.1_7 Reverse -192 -211 8.65258 0.229
NP_442072.1_9 Reverse -117 -135 -22.1053 0.22
NP_442072.1_9 Forward -128 -110 -23.3836 0.292
NP_442401.1_2 Reverse -117 -136 8.35677 0.248
NP_442800.1_7 Forward -351 -332 4.62101 0.264
NP_440028.1_6 Forward -147 -129 12.0155 0.253
NP_442022.1_4 Forward -208 -189 11.8975 0.198
NP_442022.1_4 Forward -334 -315 7.66927 0.268
NP_440907.2_8 Reverse -329 -339 15.7125 0.0168
NP_440907.2_8 Reverse -119 -129 10.8943 0.0969
NP_442264.1_2 Forward -137 -120 5.05372 0.287
NP_441021.1_1 Reverse -119 -138 19.2723 0.0142
NP_441021.1_1 Reverse -301 -320 -0.0988766 0.0959
NP_441463.1_3 Reverse -318 -337 0.0977854 0.132
NP_441463.1_3 Forward -62 -43 -6.49039 0.246
NP_441463.1_3 Forward -347 -328 -9.73531 0.284
NP_441463.1_6 Reverse -116 -130 8.34861 0.25
NP_441626.1_2 Forward -126 -119 15.7721 0.0124
NP_441626.1_2 Reverse -119 -126 15.7721 0.0124
NP_441626.1_2 Forward -336 -329 12.2322 0.0511
NP_441626.1_2 Reverse -329 -336 5.93897 0.231
NP_442365.1_7 Reverse -114 -133 10.4225 0.0723
NP_442365.1_7 Forward -131 -112 -0.688862 0.183
NP_442365.1_7 Forward -125 -106 -2.55715 0.201
NP_442794.1_1 Reverse -114 -126 10.4621 0.0721
NP_442794.1_1 Forward -218 -206 5.34885 0.225
NP_442794.1_1 Forward -131 -119 3.48056 0.286
NP_442615.1_1 Forward -346 -328 9.26226 0.0259
NP_441962.1_4 Reverse -113 -132 8.45592 0.0651
NP_441962.1_4 Forward -132 -113 -1.86883 0.127
NP_441962.1_4 Reverse -119 -138 -9.63698 0.218
NP_441962.1_4 Reverse -53 -72 -11.9969 0.25
NP_441962.1_4 Forward -275 -256 -13.2752 0.271
NP_441962.1_4 Forward -278 -259 -13.6686 0.277
NP_441962.1_4 Reverse -262 -281 -14.7502 0.293
NP_441796.1_8 Forward -62 -44 8.67227 0.297
NP_440387.1_1 Reverse -118 -134 25.1329 0.00118
NP_440387.1_1 Forward -309 -293 -3.18639 0.156
NP_440387.1_1 Forward -127 -111 -3.67804 0.164
NP_441488.1_7 Forward -133 -114 8.65258 0.121
NP_441488.1_8 Reverse -113 -127 8.16044 0.204
NP_441836.1_2 Forward -133 -114 -4.72043 0.262
NP_441836.1_2 Forward -328 -309 -5.60541 0.284
NP_441993.1_1 Forward -127 -108 12.7645 0.0926
NP_441993.1_1 Forward -315 -296 12.3746 0.101
NP_441993.1_1 Forward -133 -114 10.2306 0.129
NP_440814.1_4 Forward -346 -327 -12.7836 0.244
NP_440467.1_3 Reverse -220 -239 13.0141 0.214
NP_440114.1_10 Forward -337 -323 7.27608 0.239
NP_441817.1_7 Forward -387 -368 22.2223 0.0467
NP_441817.1_9 Forward -240 -221 19.8623 0.0726
NP_442323.1_7 Reverse -295 -314 4.62021 0.215
NP_441510.2_6 Reverse -108 -127 15.9282 0.132
NP_441552.1_3 Reverse -321 -340 13.0766 0.292
NP_441720.1_6 Forward -212 -193 11.2092 0.25
NP_440293.1_3 Forward -129 -110 -3.93378 0.256
NP_440293.1_10 Forward -312 -293 0.491109 0.219
NP_440293.1_10 Forward -304 -285 -0.4922 0.251
NP_440293.1_10 Forward -385 -366 -2.55715 0.274
NP_440766.1_4 Forward -131 -117 7.86607 0.0871
NP_439988.1_3 Forward -321 -307 12.4876 0.195
NP_441237.1_9 Reverse -119 -129 14.9263 0.0242
NP_441237.1_9 Reverse -301 -311 14.238 0.0429
NP_442743.1_4 Forward -126 -107 -8.45701 0.294
NP_441133.1_1 Forward -147 -128 12.0942 0.273
NP_439910.1_2 Reverse -320 -337 -3.5994 0.0611
NP_442867.1_8 Forward -119 -100 8.16093 0.24
NP_442867.1_8 Reverse -278 -297 6.58763 0.259
NP_440457.1_1 Forward -313 -301 12.3303 0.092
NP_440457.1_1 Forward -131 -119 7.21714 0.105
NP_440457.1_1 Reverse -114 -126 6.33216 0.123
NP_440457.1_1 Forward -137 -125 0.628964 0.25
NP_440457.1_1 Forward -341 -329 0.530633 0.25
NP_441801.1_4 Reverse -304 -314 2.92996 0.231
NP_441801.1_4 Reverse -54 -64 2.63497 0.29
NP_441984.1_1 Forward -139 -121 12.9988 0.181
NP_441984.1_6 Reverse -302 -314 14.002 0.258
NP_441436.1_2 Forward -302 -283 2.16274 0.221
NP_441436.1_8 Reverse -117 -136 10.4225 0.262
NP_440473.1_1 Reverse -297 -316 11.9323 0.261
NP_442509.1_9 Forward -127 -117 8.14104 0.192
NP_442509.1_9 Reverse -118 -128 8.14104 0.192
NP_442514.1_5 Reverse -50 -69 -6.49113 0.267
NP_441440.1_1 Forward -139 -120 10.9142 0.273
NP_440554.1_4 Reverse -329 -339 10.9931 0.0429
NP_440554.1_4 Forward -126 -116 8.92815 0.0646
NP_440554.1_4 Reverse -119 -129 6.37155 0.123
NP_441885.1_5 Forward -127 -117 20.9245 0.000538
NP_441885.1_5 Reverse -118 -128 20.9245 0.000538
NP_441885.1_5 Forward -337 -327 17.3846 0.00578
NP_441885.1_5 Reverse -11 -21 -1.49493 0.264
NP_440478.1_9 Reverse -202 -221 13.9625 0.214
NP_442341.1_7 Reverse -117 -131 19.9608 0.00702
NP_442341.1_7 Reverse -299 -313 11.3077 0.0565
NP_442341.1_7 Forward -128 -114 11.2093 0.0567
NP_442341.1_7 Reverse -327 -341 7.86607 0.0985
NP_442341.1_7 Reverse -204 -218 5.50613 0.154
NP_442341.1_7 Forward -274 -260 3.8345 0.21
NP_442341.1_9 Reverse -203 -217 5.1122 0.279
NP_441756.1_5 Forward -313 -294 6.19431 0.179
NP_441756.1_5 Forward -131 -112 -5.21209 0.299
NP_440423.1_6 Forward -135 -116 -12.9802 0.204
NP_440423.1_6 Reverse -110 -129 -15.9302 0.229
NP_443000.1_7 Reverse -116 -126 19.9412 0.00223
NP_443000.1_7 Forward -129 -119 10.4031 0.0345
NP_443000.1_7 Reverse -326 -336 6.56821 0.123
NP_443000.1_7 Forward -216 -206 1.94665 0.226
NP_443000.1_7 Reverse -298 -308 0.668351 0.293
NP_440507.2_3 Forward -136 -117 19.0748 0.0344
NP_440507.2_3 Forward -142 -123 6.78348 0.299
NP_441842.1_1 Reverse -13 -26 11.7201 0.245
NP_441842.1_10 Forward -134 -120 7.07942 0.267
NP_440275.1_3 Forward -129 -119 17.6796 0.0102
NP_440275.1_3 Forward -339 -329 15.418 0.0178
NP_440275.1_3 Reverse -116 -126 15.123 0.0182
NP_440091.1_1 Reverse -324 -336 9.28209 0.0567
NP_440091.1_1 Forward -131 -119 8.29878 0.0653
NP_440091.1_1 Reverse -114 -126 1.31728 0.198
NP_440679.1_10 Reverse -257 -276 -10.9153 0.182
NP_440679.1_10 Forward -143 -124 -20.5517 0.286
NP_443010.1_10 Forward -340 -323 5.76644 0.198
NP_442451.1_2 Reverse -110 -129 9.83255 0.0755
NP_442451.1_2 Forward -135 -116 -10.227 0.265
NP_440175.1_4 Forward -129 -110 0.58944 0.122
NP_440175.1_7 Forward -224 -206 9.46071 0.28
NP_442495.1_4 Forward -318 -308 17.5813 0.0771
NP_442495.1_4 Forward -14 -4 17.2863 0.0771
NP_440149.1_8 Forward -127 -108 11.1109 0.0437
NP_441105.1_3 Reverse -107 -126 5.40766 0.0685
NP_441105.1_3 Reverse -200 -219 -6.88371 0.243
NP_440216.1_1 Forward -309 -295 6.78443 0.0124
NP_440216.1_1 Forward -127 -113 0.0979218 0.0284
NP_440216.1_1 Reverse -118 -132 -9.44018 0.145
NP_440216.1_1 Reverse -300 -314 -12.0951 0.24
NP_440172.1_1 Forward -127 -117 15.0247 0.00945
NP_440172.1_1 Reverse -118 -128 15.0247 0.00945
NP_440172.1_1 Forward -337 -327 7.55152 0.0761
NP_440172.1_1 Forward -309 -299 5.09324 0.153
NP_440172.1_1 Reverse -313 -323 2.04498 0.286
NP_440167.1_3 Reverse -108 -127 21.7306 0.0393
NP_440167.1_3 Forward -137 -118 10.8159 0.233
NP_442015.1_10 Forward -131 -118 12.6056 0.0365
NP_442015.1_10 Reverse -114 -127 12.6056 0.0365
NP_442015.1_10 Forward -218 -205 4.24752 0.177
NP_441226.1_7 Forward -126 -119 14.4934 0.0123
NP_441226.1_7 Reverse -119 -126 14.4934 0.0123
NP_441226.1_7 Forward -336 -329 12.7234 0.0312
NP_441226.1_7 Reverse -329 -336 11.5435 0.0757
NP_441111.1_7 Forward -126 -118 18.7023 0.00294
NP_441111.1_7 Reverse -119 -127 18.7023 0.00294
NP_441111.1_7 Reverse -329 -337 8.86921 0.0589
NP_442379.1_10 Forward -134 -117 -0.944468 0.223
NP_442379.1_10 Reverse -90 -107 -2.22277 0.226
NP_441766.1_2 Forward -127 -118 17.5026 0.00297
NP_441766.1_2 Reverse -118 -127 17.5026 0.00297
NP_441766.1_2 Forward -337 -328 8.1612 0.0645
NP_441766.1_2 Reverse -328 -337 5.89959 0.103
NP_440416.1_1 Forward -337 -318 -13.2752 0.281
NP_440416.1_9 Reverse -111 -130 -15.5368 0.193
NP_440416.1_9 Reverse -293 -312 -17.9951 0.25
NP_443052.1_8 Forward -286 -267 -3.14714 0.0981
NP_443052.1_8 Reverse -318 -337 -4.81876 0.122
NP_443052.1_9 Reverse -285 -304 -2.75381 0.242
NP_443052.1_9 Reverse -129 -148 -4.91709 0.262
NP_443052.1_9 Reverse -126 -145 -6.39206 0.282
NP_442403.1_8 Forward -212 -193 -0.787193 0.256
NP_440591.1_9 Forward -134 -116 15.2604 0.0839
NP_440591.1_9 Forward -316 -298 12.7038 0.0931
NP_442154.1_1 Forward -303 -285 -5.48739 0.127
NP_442154.1_1 Reverse -253 -271 -13.5505 0.217
NP_442154.1_1 Forward -135 -117 -15.4188 0.218
NP_442154.1_1 Forward -144 -126 -16.3038 0.238
NP_442154.1_1 Forward -312 -294 -17.1888 0.249
NP_442154.1_1 Forward -50 -32 -18.9587 0.288
NP_440261.1_5 Reverse -119 -132 -2.63565 0.0924
NP_440261.1_5 Reverse -329 -342 -3.22564 0.12
NP_440261.1_5 Forward -308 -295 -4.7006 0.165
NP_440261.1_5 Reverse -301 -314 -10.8955 0.221
NP_440261.1_5 Forward -126 -113 -12.0754 0.27
NP_440988.1_10 Reverse -116 -130 11.1917 0.187
NP_440988.1_10 Forward -129 -115 7.7064 0.215
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTACGCCCTTAGCATTGGTCTATTGGTGGGGGGATTTTTCTCCCTTGGACTGCCGATATTTGCGGCGATCGGTATTTTAGTCATGGCCTGGGGCGATGGACTGGCGGCCCTGGTGGGACAAAGGTGGGGGCGTCACCGCTACCAAGTCTTTGGTTTCCGCAAAAGTTGGGAGGGCACTCTCACCATGGTGTTGGCCAGTTTTTTGGTCACGGTTGTATTTCTTAGTTACACCTTCGGCTTCACAGTTATTGTCCTTGTTGTGGCTGGGACGGTGGCGATCGCCAGTGCTGGACTGGAGAGCTTTTCCCGCTGGGGCATTGATAACTTAACTGTTCCCCTGGGCAGTGCTTTGATTGCTTGGGCTGGTAGCTATCTTTGGTTGGGATAGTCCCTGGGGTAA

CDS

ATGGTTAAAATGCAAATACCATCCTGCTTTTCCACCATGGTTTTTACCCTTCCCCAGCCAACTAATTTACCCAGCACTAATGTCCGTTTGCCTATCCAAGCACTACACGGTCAATTGATCCAATGGCGACGGCAGTTTCACCAATACCCGGAATTGGGCTTCCAAGAGCAGTTAACGGCGGCCCACATTGCCGAAACCCTGACTAAATTAGAAATTCCCCACACCCCAGGCATTGCCAAAACCGGGATTATGGCGACGGTTGACAGCGGTAAGCCGGGACCTGTGCTGGCCATCCGAGCCGATATGGATGCTCTGCCGGTAACGGAAGAAAATGAAGTAGATTACCGTTCCCTCCACCCCGGTAAAATGCACGCCTGTGGCCACGACGGTCACACGGCGATCGCCTTAGGCACCGCGCAATATTTAGCGGCCCATCGGGATAGTTTTCGGGGCCAGGTAAAATTCTTTTTTCAGCCAGCGGAGGAAGGCCCTGGTGGTGCCAAGCCCATGATTGAAGCGGGGGTGCTGGAAAATCCGGCGGTGGATGCCATTGTCGGTTTACATTTGTGGAATGACCTACCTGTGGGCACGGTGGGCATCAAGCCGGGGCCAGTAATGGCGGCGGTGGAACACTTTGAATGTCAACTGTTCGGCCAAGGAGGCCACGGAGCCATGCCCCACCAAACCGTGGATACCCTGGTGATCAGTGCCCAAATTGTCATGGCTTTGCAAGGTATTGTGGCCCGCAATTTAAATCCCCTCCAGTCTGCTGTGGTTACTGTGGGACAGTTGCAGTCCGGCACTGCTTTTAACGTCATCCCCGACAGCGCCTATTTCCGGGGCACAGTGCGCTACTTTGACCCCAGTTTTGCTGGTTATTTTGCCCAACGCATTGAGGAAATTATCAAGGGCATTTGCCAGAGTCACGGGGCTAATTACCAATTTACCTACGAAAATATTTATCCCCCCGTGGTTAACGATCGCCGTTTGGCGGATTTGGTGCGATCGGCGGCGGCGGATGTATTACTCACCGATGACCATCTCCAACCGGATTACCAAACCCTAGCAGGGGAAGATATGTCATTTTTTCTCCAGGCAGTGCCAGGTTGTTACTTCTTCCTAGGGTCTGCCAATGGGGATCTTGGTTTGGCCTATCCCCACCACCATCCCCGCTTCAATTTTGACGAGGCTGTGTTGCCAGTGGGGGTAGAGCTATTTGTCCGTTGCGTGGAAAGGTTCTGCAATGCCTAG

Protein

MVKMQIPSCFSTMVFTLPQPTNLPSTNVRLPIQALHGQLIQWRRQFHQYPELGFQEQLTAAHIAETLTKLEIPHTPGIAKTGIMATVDSGKPGPVLAIRADMDALPVTEENEVDYRSLHPGKMHACGHDGHTAIALGTAQYLAAHRDSFRGQVKFFFQPAEEGPGGAKPMIEAGVLENPAVDAIVGLHLWNDLPVGTVGIKPGPVMAAVEHFECQLFGQGGHGAMPHQTVDTLVISAQIVMALQGIVARNLNPLQSAVVTVGQLQSGTAFNVIPDSAYFRGTVRYFDPSFAGYFAQRIEEIIKGICQSHGANYQFTYENIYPPVVNDRRLADLVRSAAADVLLTDDHLQPDYQTLAGEDMSFFLQAVPGCYFFLGSANGDLGLAYPHHHPRFNFDEAVLPVGVELFVRCVERFCNA