Your browser is old and dusty. Try Google Chrome!

Details for slr1636

ORF slr1636
Accession NP_441768.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -20 -39 -1.18052 0.27
NP_442100.1_2 Reverse -249 -268 13.2741 0.208
NP_443041.1_7 Forward -269 -252 9.97027 0.161
NP_441818.1_1 Reverse -103 -114 11.7595 0.164
NP_440259.1_4 Reverse -364 -378 15.9628 0.149
NP_440259.1_4 Reverse -236 -250 13.2634 0.226
NP_442062.1_3 Forward -341 -322 -2.75381 0.272
NP_442972.1_1 Forward -327 -309 9.9807 0.265
NP_441925.1_2 Forward -282 -263 2.55606 0.262
NP_442827.1_8 Reverse -172 -191 -1.37794 0.245
NP_441434.1_1 Forward -270 -256 12.3301 0.233
NP_441434.1_3 Reverse -306 -325 0.884433 0.198
NP_441327.1_1 Reverse -113 -132 2.29119 0.298
NP_440851.1_3 Forward -230 -211 3.53937 0.245
NP_442530.1_6 Reverse -125 -138 16.676 0.279
NP_442658.1_1 Forward -30 -20 4.89613 0.292
NP_440656.1_8 Forward -185 -166 -8.85033 0.273
NP_440995.1_8 Reverse -259 -278 -0.197208 0.284
NP_442690.1_1 Reverse -252 -271 -0.295539 0.126
NP_442690.1_1 Forward -330 -311 -3.83545 0.142
NP_442690.1_1 Reverse -239 -258 -12.2919 0.241
NP_442690.1_1 Reverse -112 -131 -14.4552 0.272
NP_441099.1_5 Reverse -92 -111 -2.36049 0.12
NP_440809.1_9 Reverse -150 -168 -9.0273 0.291
NP_440147.1_4 Reverse -178 -191 2.18257 0.209
NP_440715.1_1 Forward -173 -154 22.6156 0.0115
NP_441568.1_6 Forward -283 -265 16.1401 0.18
NP_442941.1_3 Reverse -103 -113 4.60159 0.14
NP_440289.1_2 Forward -18 -5 1.19926 0.135
NP_441079.1_7 Forward -271 -252 1.96529 0.177
NP_442172.1_5 Reverse -115 -129 18.728 0.205
NP_442500.1_8 Forward -272 -258 15.3843 0.146
NP_441860.1_4 Forward -294 -281 21.9471 0.0214
NP_440587.1_5 Reverse -168 -186 15.0428 0.245
NP_440421.1_1 Reverse -94 -108 16.8142 0.155
NP_441715.1_4 Reverse -103 -113 5.68323 0.189
NP_441826.1_2 Reverse -20 -34 -3.34366 0.284
NP_441330.1_9 Reverse -103 -122 10.1275 0.283
NP_442868.1_6 Forward -113 -103 3.22496 0.202
NP_440785.1_2 Forward -263 -244 6.29264 0.223
NP_441518.1_3 Forward -184 -165 -13.5702 0.264
NP_442830.1_7 Forward -200 -181 12.7825 0.111
NP_441819.1_5 Forward -329 -310 8.35512 0.295
NP_442347.1_2 Forward -110 -101 5.89959 0.21
NP_442347.1_2 Reverse -153 -162 3.7363 0.284
NP_440749.1_4 Reverse -6 -24 16.0463 0.0825
NP_440787.1_5 Forward -271 -257 10.3243 0.256
NP_441199.1_10 Reverse -251 -269 10.6016 0.3
NP_442959.1_5 Reverse -252 -271 10.2259 0.224
NP_440408.1_7 Forward -247 -228 7.17762 0.291
NP_442384.1_10 Forward -189 -176 1.9859 0.24
NP_442114.1_8 Forward -271 -257 8.84875 0.234
NP_441018.1_3 Reverse -86 -105 10.0284 0.286
NP_442917.1_1 Forward -219 -200 10.2251 0.181
NP_440297.1_9 Reverse -7 -17 3.81494 0.26
NP_440350.1_5 Reverse -287 -306 -5.70374 0.292
NP_440999.1_8 Forward -318 -299 5.80098 0.28
NP_442710.1_7 Forward -261 -242 -4.82 0.272
NP_443064.1_6 Reverse -180 -190 9.3673 0.226
NP_440673.1_3 Forward -187 -180 7.51227 0.252
NP_442430.1_6 Forward -253 -234 5.01433 0.271
NP_441851.1_10 Forward -163 -153 5.28991 0.218
NP_442011.1_1 Reverse -179 -198 -2.45882 0.273
NP_442515.1_1 Forward -16 -2 1.27789 0.165
NP_442515.1_1 Reverse -179 -193 -0.983719 0.241
NP_441982.1_6 Forward -184 -175 11.7214 0.288
NP_441982.1_6 Forward -218 -209 11.053 0.288
NP_440165.1_5 Reverse -318 -337 -4.32711 0.22
NP_442689.1_8 Forward -326 -309 0.92382 0.191
NP_442689.1_8 Reverse -243 -260 0.137172 0.191
NP_442689.1_8 Reverse -256 -273 -2.51776 0.235
NP_442689.1_8 Reverse -244 -261 -7.33598 0.292
NP_441409.1_6 Reverse -269 -288 -6.39206 0.124
NP_441150.1_4 Reverse -272 -291 15.8299 0.149
NP_441124.1_5 Reverse -305 -315 11.9577 0.239
NP_440431.1_4 Forward -101 -82 -10.0748 0.295
NP_442168.1_6 Forward -165 -146 8.94757 0.23
NP_441539.1_1 Reverse -251 -265 10.717 0.294
NP_441432.1_8 Reverse -179 -188 11.9961 0.0519
NP_441432.1_9 Reverse -235 -248 11.701 0.221
NP_441432.1_9 Reverse -258 -271 11.604 0.221
NP_441057.1_10 Forward -314 -295 12.1925 0.277
NP_440281.1_6 Forward -293 -274 8.94757 0.268
NP_442400.1_10 Forward -120 -107 12.4757 0.208
NP_441786.1_8 Reverse -240 -259 21.1397 0.0106
NP_440250.1_4 Reverse -240 -259 4.71854 0.253
NP_442934.1_9 Forward -275 -257 13.1955 0.282
NP_441888.1_7 Reverse -280 -294 6.09611 0.225
NP_441329.1_6 Forward -378 -359 -2.81744 0.294
NP_441112.1_8 Forward -259 -240 6.88262 0.207
NP_440671.1_1 Reverse -211 -230 4.12128 0.276
NP_442943.1_1 Forward -221 -206 9.03926 0.19
NP_441009.1_8 Forward -199 -180 14.4533 0.236
NP_442568.1_8 Forward -179 -165 7.86607 0.296
NP_442627.1_4 Forward -264 -246 20.0553 0.058
NP_442399.1_3 Forward -187 -168 13.3438 0.142
NP_441769.1_3 Reverse -254 -273 -4.52452 0.245
NP_440441.1_7 Forward -176 -157 9.93088 0.248
NP_440532.1_1 Reverse -159 -178 11.9958 0.138
NP_442499.1_4 Reverse -17 -31 11.406 0.226
NP_440402.1_3 Forward -120 -101 4.22769 0.276
NP_442402.1_2 Reverse -34 -48 10.3237 0.292
NP_442402.1_4 Reverse -236 -255 -7.96609 0.278
NP_441848.1_4 Forward -221 -205 7.83714 0.288
NP_441848.1_4 Forward -259 -243 7.64616 0.288
NP_439948.1_2 Forward -378 -360 13.0844 0.283
NP_442679.1_1 Forward -301 -282 -3.63879 0.261
NP_442829.1_2 Forward -271 -255 18.4809 0.12
NP_442844.1_5 Reverse -264 -283 4.03023 0.26
NP_442532.1_2 Forward -318 -299 9.40553 0.121
NP_440816.1_2 Forward -274 -255 6.72539 0.27
NP_441527.1_4 Forward -304 -285 -3.39039 0.166
NP_441527.1_4 Forward -381 -362 -4.53629 0.187
NP_441527.1_4 Forward -102 -83 -6.44613 0.218
NP_441527.1_4 Forward -301 -282 -8.45146 0.244
NP_441527.1_4 Forward -250 -231 -9.2154 0.255
NP_441527.1_4 Forward -248 -229 -12.1756 0.285
NP_441527.1_4 Forward -283 -264 -12.2711 0.285
NP_440007.1_9 Forward -115 -101 3.8345 0.267
NP_001035870.1_10 Forward -106 -87 13.3161 0.258
NP_442704.1_5 Reverse -112 -131 16.7157 0.0877
NP_442842.1_10 Reverse -286 -305 2.89236 0.251
NP_442238.1_1 Forward -173 -154 2.55606 0.215
NP_441401.1_4 Forward -269 -256 17.4239 0.131
NP_440114.1_10 Reverse -159 -173 8.65272 0.198
NP_442698.1_10 Forward -282 -263 3.44104 0.279
NP_440766.1_6 Reverse -193 -212 12.7825 0.26
NP_440422.1_10 Reverse -242 -261 10.017 0.2
NP_442930.1_1 Forward -318 -308 10.1076 0.278
NP_440987.1_4 Forward -272 -253 11.9958 0.143
NP_442680.1_5 Forward -275 -256 7.00825 0.201
NP_442680.1_5 Forward -186 -167 -0.904675 0.297
NP_441275.1_1 Reverse -236 -254 0.510803 0.294
NP_441397.1_8 Forward -49 -36 11.6163 0.297
NP_443010.1_10 Forward -171 -154 5.76644 0.198
NP_442638.1_3 Forward -266 -247 11.4109 0.298
NP_442638.1_3 Forward -299 -280 10.4559 0.298
NP_441207.1_7 Forward -272 -258 8.77134 0.282
NP_442918.1_4 Forward -326 -312 18.8791 0.181
NP_442918.1_6 Forward -22 -3 16.7086 0.175
NP_440172.1_1 Reverse -180 -190 2.7333 0.268
NP_442371.1_1 Forward -385 -375 14.2375 0.191
NP_442116.1_6 Forward -258 -241 17.8136 0.0788
NP_442116.1_6 Reverse -217 -234 9.60133 0.227
NP_442116.1_6 Reverse -230 -247 7.78699 0.254
NP_441974.1_3 Forward -365 -348 16.1507 0.257
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACTATATGGTTGGAACTGGAAAGAATAAAATAGAGAGTAGAGTGGTAATATTCACCCATGATAATTCAGAGTTTAGATTGGTTACAAATTTACCTATAGAAAGTAAAGAAATAGAAGGAGTTAGTGATGAAAAAATAGCAGAAATTTATAAAAAAAGATGGCAAATAGAATTGTTATGGAAATTCTTAAAAATGCACTTAAAGCTGAATAGACTGATTGCCAAAAATGAGAATGCAATTGGGATTCAAATCTATACCTGTATAATTGCTTATTTAATACTAAAATTACTGGTAATCCCAAAAGAAGCAGGTACAACAATGTTAGACAAACTACGTTATTTACAGGCTTTCATGTGTGAAAAAATAAGCTATGTACACTGGCTAAGGGAGTTAGCACTAAG

CDS

GTGATGAATTTGCTTTGCTATAGGATTATTCTGTCTATTTTTAGGTCGTACATAAGTGCGATTCAACGATTCTGGGCGATCGCCATTCGGAAAAGCAAAAAAGCAGAAACCGGGTGGAAGAAAAATCCGCAGAATACGCTTCCCAGTCTAGCGGAAAATTACCTCGGCTCCATCCCAACTGACCTAATATTGACCCTCCCCTCTATCGACATATCGACAGTGCATCCATTAACCATGGACGAAAATATCGGCCTAAGCCTAGGCATCGAACAATTTAACCGGCAAGATTTTTACGCCTGCCATAACACCCTCGAAGCAGTGTGGCTAGAGGCTAACCCGACGGAGAAAAATTTCTACCAAGGTATTTTGCAAATTGCCGTAGCCCACTATCATCTTGGCAATCACAATTGGCGGGGAGCAGTGACTTTACTGGGGGAGGGTATCCGCCGCTTGAAGGGTTTTCGCCCTGACCATCGGGAAGTGGATATAGAGAGTTTATTTCGGTCCAGCGTTTTGCTGTTAGAGAATCTACAAACTATTACGCCAGAAAATCTCCCCCAATGGTTAGAATCCGCTGCAGCGGAACAACTAACCCCCCAAATTGAGATTAAGTCGAAATAG

Protein

MMNLLCYRIILSIFRSYISAIQRFWAIAIRKSKKAETGWKKNPQNTLPSLAENYLGSIPTDLILTLPSIDISTVHPLTMDENIGLSLGIEQFNRQDFYACHNTLEAVWLEANPTEKNFYQGILQIAVAHYHLGNHNWRGAVTLLGEGIRRLKGFRPDHREVDIESLFRSSVLLLENLQTITPENLPQWLESAAAEQLTPQIEIKSK