Your browser is old and dusty. Try Google Chrome!

Details for slr1634

ORF slr1634
Accession NP_441764.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_1 Forward -356 -337 6.44528 0.288
NP_441818.1_9 Reverse -79 -98 -5.99873 0.258
NP_442752.1_4 Forward -274 -267 5.54565 0.194
NP_442752.1_4 Reverse -28 -35 4.95566 0.26
NP_443027.1_4 Forward -276 -266 6.46988 0.275
NP_441812.1_3 Forward -275 -261 10.816 0.216
NP_442975.1_10 Reverse -43 -57 4.8172 0.239
NP_442062.1_3 Reverse -336 -355 11.4058 0.152
NP_442062.1_8 Forward -274 -264 3.22496 0.279
NP_441594.1_6 Reverse -25 -44 1.47442 0.268
NP_442742.1_9 Reverse -262 -281 -10.4236 0.269
NP_440014.1_3 Forward -300 -286 17.7936 0.261
NP_441942.1_6 Forward -379 -360 15.1558 0.239
NP_441770.1_5 Forward -263 -244 -1.7705 0.277
NP_441327.1_1 Forward -157 -138 4.59781 0.264
NP_441327.1_3 Reverse -193 -212 14.3549 0.202
NP_441486.1_1 Forward -318 -304 -3.24533 0.177
NP_442145.1_4 Reverse -335 -354 6.54077 0.216
NP_442145.1_4 Reverse -122 -141 2.43462 0.299
NP_440842.1_4 Reverse -123 -142 2.48445 0.224
NP_441014.1_10 Reverse -81 -100 0.785326 0.238
NP_441014.1_10 Reverse -264 -283 -3.34455 0.298
NP_441634.1_8 Forward -276 -262 0.392915 0.231
NP_440376.1_1 Forward -42 -33 9.34117 0.0399
NP_441797.1_1 Reverse -29 -48 12.7825 0.287
NP_441077.1_6 Forward -146 -130 5.01922 0.255
NP_441077.1_6 Forward -160 -144 2.60905 0.276
NP_441846.1_10 Reverse -294 -313 -12.9802 0.197
NP_442530.1_2 Reverse -194 -204 12.3697 0.276
NP_441422.1_7 Forward -79 -62 -6.84433 0.254
NP_440360.1_9 Forward -166 -147 11.2092 0.243
NP_440662.1_2 Reverse -47 -66 2.16274 0.19
NP_442205.1_9 Reverse -306 -322 -2.39974 0.268
NP_440184.1_1 Forward -173 -154 1.34491 0.28
NP_440184.1_1 Forward -140 -121 0.770688 0.291
NP_440203.1_5 Reverse -99 -109 11.5826 0.185
NP_442690.1_1 Reverse -337 -356 -8.06369 0.183
NP_442911.1_2 Reverse -296 -315 -5.99873 0.172
NP_440993.1_3 Forward -116 -97 0.195343 0.259
NP_441429.1_1 Reverse -21 -40 20.7473 0.0107
NP_441429.1_4 Forward -272 -253 12.88 0.158
NP_441099.1_5 Forward -396 -377 -12.0953 0.294
NP_441424.1_2 Forward -353 -334 11.9838 0.186
NP_441295.1_4 Forward -385 -366 -3.63879 0.29
NP_441916.1_10 Reverse -298 -317 7.96426 0.179
NP_440345.1_5 Reverse -132 -146 14.143 0.276
NP_441041.1_4 Reverse -72 -91 -7.86702 0.194
NP_441406.1_3 Reverse -343 -355 17.5419 0.239
NP_441079.1_7 Forward -160 -141 -0.787962 0.2
NP_441556.1_10 Forward -48 -34 11.1952 0.235
NP_443049.1_6 Forward -275 -265 12.4217 0.24
NP_440780.1_1 Forward -147 -128 12.1748 0.242
NP_440382.1_2 Forward -349 -330 4.62021 0.27
NP_441024.1_6 Reverse -183 -202 6.92274 0.292
NP_441715.1_4 Reverse -117 -127 6.56821 0.138
NP_440379.1_5 Reverse -291 -310 -4.13045 0.208
NP_441758.1_10 Forward -356 -337 1.47364 0.193
NP_441764.1_1 Forward -140 -121 20.649 0.0472
NP_441764.1_4 Forward -355 -338 17.3345 0.0666
NP_441764.1_4 Forward -142 -125 16.7615 0.0765
NP_441764.1_6 Forward -275 -264 16.8733 0.253
NP_441764.1_8 Forward -286 -276 12.5549 0.284
NP_442868.1_6 Reverse -293 -303 0.373358 0.234
NP_441251.1_8 Forward -138 -125 13.6216 0.254
NP_441612.1_2 Forward -226 -216 10.8728 0.21
NP_442227.1_2 Forward -319 -300 9.63589 0.171
NP_442227.1_2 Forward -308 -289 -1.27885 0.262
NP_440789.1_1 Reverse -336 -355 21.2381 0.0189
NP_442050.1_1 Forward -187 -168 8.84924 0.25
NP_440342.1_1 Reverse -23 -42 11.3075 0.279
NP_442789.1_4 Reverse -48 -67 -3.93378 0.257
NP_440923.1_1 Reverse -335 -353 18.3079 0.0506
NP_440923.1_1 Reverse -122 -140 12.703 0.211
NP_442830.1_1 Forward -48 -29 16.2241 0.224
NP_441819.1_5 Reverse -338 -357 10.6469 0.261
NP_442347.1_2 Reverse -266 -275 17.7976 0.056
NP_441728.2_4 Forward -357 -338 14.1801 0.23
NP_440899.1_8 Reverse -354 -373 -7.57203 0.246
NP_442333.2_1 Reverse -175 -194 -0.983855 0.123
NP_440709.1_1 Reverse -121 -140 10.9134 0.0551
NP_441559.1_8 Forward -110 -96 -7.2769 0.289
NP_440164.1_1 Reverse -226 -245 10.3242 0.179
NP_441199.1_7 Forward -356 -337 11.4058 0.136
NP_441199.1_7 Forward -143 -124 2.0644 0.262
NP_441340.1_5 Reverse -189 -196 8.8889 0.084
NP_440586.1_8 Forward -248 -241 7.02027 0.279
NP_440408.1_7 Reverse -295 -314 17.994 0.111
NP_442488.1_7 Forward -257 -238 8.25926 0.287
NP_442114.1_8 Forward -291 -277 12.487 0.213
NP_441877.1_7 Reverse -86 -105 1.27698 0.242
NP_441877.1_9 Forward -142 -125 4.46374 0.284
NP_440530.1_6 Reverse -281 -295 15.0979 0.255
NP_441689.1_5 Forward -127 -117 5.09279 0.285
NP_440937.1_5 Forward -26 -7 10.2259 0.275
NP_440999.1_9 Reverse -261 -275 1.17956 0.169
NP_440888.1_2 Forward -42 -28 8.94708 0.142
NP_440888.1_2 Reverse -178 -192 7.86545 0.179
NP_440600.1_1 Reverse -337 -356 12.6523 0.29
NP_441949.1_5 Forward -355 -336 13.2829 0.2
NP_442710.1_7 Forward -137 -118 3.63766 0.147
NP_442710.1_7 Forward -171 -152 -8.66439 0.299
NP_442315.1_2 Forward -47 -35 15.2803 0.27
NP_440148.1_1 Forward -282 -263 -4.13045 0.219
NP_441462.1_4 Forward -89 -70 7.37428 0.0975
NP_443062.1_1 Reverse -240 -258 5.42569 0.229
NP_440936.1_10 Reverse -156 -175 1.19323 0.241
NP_442780.1_1 Forward -351 -332 9.93088 0.195
NP_440516.1_6 Forward -386 -372 11.5037 0.202
NP_442219.1_9 Reverse -266 -275 1.76968 0.298
NP_440314.1_1 Forward -140 -121 13.6675 0.159
NP_440296.1_6 Reverse -118 -136 11.7475 0.295
NP_440094.1_2 Reverse -295 -314 2.3594 0.254
NP_441501.1_4 Forward -60 -41 17.2074 0.177
NP_441982.1_6 Reverse -193 -202 11.3395 0.288
NP_441046.1_2 Forward -360 -341 3.44104 0.233
NP_442689.1_8 Reverse -341 -358 -3.69774 0.251
NP_442689.1_8 Forward -329 -312 -8.0243 0.292
NP_442944.1_6 Reverse -209 -223 17.7717 0.28
NP_441031.1_1 Forward -357 -338 6.82273 0.259
NP_441333.1_1 Reverse -278 -288 16.0703 0.164
NP_440629.1_1 Forward -139 -121 12.4089 0.0706
NP_442624.1_3 Reverse -311 -325 13.2743 0.286
NP_442400.1_10 Reverse -199 -212 9.13351 0.271
NP_442749.1_5 Forward -216 -199 7.45244 0.261
NP_440284.1_9 Forward -343 -324 6.68596 0.298
NP_442346.1_5 Reverse -96 -106 5.09324 0.262
NP_440170.1_2 Reverse -38 -57 2.55606 0.297
NP_441329.1_6 Forward -235 -216 4.82192 0.198
NP_440671.1_1 Forward -142 -123 5.26973 0.26
NP_442943.1_1 Forward -357 -342 4.15836 0.24
NP_441813.1_7 Forward -301 -287 10.1271 0.235
NP_442028.1_1 Reverse -276 -289 8.56056 0.281
NP_440590.1_4 Reverse -91 -104 -2.63565 0.247
NP_441508.1_1 Forward -139 -120 11.5187 0.239
NP_441508.1_1 Forward -352 -333 10.2692 0.295
NP_441541.1_1 Forward -354 -336 1.24338 0.225
NP_441541.1_1 Reverse -335 -353 -2.67179 0.264
NP_442809.1_6 Reverse -300 -319 0.982764 0.277
NP_440546.1_4 Reverse -188 -198 8.97947 0.16
NP_440546.1_4 Forward -197 -187 7.91294 0.214
NP_442402.1_4 Forward -400 -381 -7.86776 0.278
NP_441848.1_4 Forward -350 -334 8.88755 0.288
NP_441848.1_4 Forward -134 -118 8.69657 0.288
NP_442829.1_2 Reverse -5 -21 7.75456 0.295
NP_442837.1_3 Reverse -266 -273 6.52896 0.2
NP_440160.1_1 Forward -357 -338 21.5394 0.0145
NP_440160.1_1 Forward -144 -125 8.42796 0.289
NP_442532.1_1 Forward -290 -276 9.23901 0.284
NP_440914.1_1 Reverse -20 -30 6.07773 0.297
NP_441697.1_5 Reverse -118 -137 -5.87318 0.232
NP_441697.1_5 Forward -145 -126 -9.78835 0.274
NP_441028.1_6 Forward -391 -381 5.19112 0.265
NP_441028.1_6 Forward -202 -192 4.30615 0.278
NP_441028.1_6 Reverse -266 -276 3.42118 0.296
NP_441527.1_4 Forward -138 -119 -12.4621 0.288
NP_441106.1_3 Forward -356 -337 10.0292 0.288
NP_439903.1_6 Forward -109 -90 10.6184 0.103
NP_441930.1_3 Forward -137 -118 5.07931 0.266
NP_442213.1_5 Reverse -284 -303 4.22769 0.231
NP_439899.1_1 Forward -143 -125 13.337 0.157
NP_441427.1_2 Forward -34 -15 3.6377 0.291
NP_440841.1_4 Forward -284 -265 -8.55534 0.25
NP_441988.1_3 Reverse -173 -192 23.9913 0.0163
NP_441431.1_2 Reverse -185 -199 13.372 0.0918
NP_441836.1_2 Reverse -182 -201 -4.22878 0.255
NP_440143.1_9 Reverse -329 -348 -1.27961 0.188
NP_440422.1_10 Reverse -118 -137 5.85408 0.259
NP_442930.1_1 Reverse -197 -207 11.7793 0.257
NP_442930.1_1 Reverse -129 -139 10.206 0.278
NP_440801.1_9 Forward -200 -186 15.0653 0.227
NP_441984.1_1 Forward -55 -37 10.7372 0.204
NP_441984.1_3 Forward -84 -66 5.23069 0.293
NP_441984.1_6 Reverse -22 -34 14.4936 0.253
NP_442439.1_8 Forward -198 -179 6.78429 0.299
NP_440628.1_1 Forward -288 -278 15.8039 0.248
NP_440191.1_6 Reverse -132 -146 13.094 0.294
NP_440552.1_8 Reverse -338 -355 10.6517 0.262
NP_442513.1_5 Reverse -53 -72 6.78348 0.282
NP_440727.1_8 Reverse -109 -123 17.2002 0.198
NP_441359.1_5 Reverse -37 -56 5.40766 0.195
NP_441635.1_1 Reverse -109 -128 7.49569 0.236
NP_442495.1_4 Reverse -376 -386 10.8948 0.296
NP_440046.1_7 Reverse -97 -116 8.16093 0.297
NP_440261.1_5 Forward -86 -73 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTCCCCACGTTTGTCCCTATGTCCTTAATGAGATTCAAGCGACAAATTGTTAACAAATGTAAAACTAACTGAGTCTTGCATTAATTGCCTTCTCCATGCCGTCTCCAGCACAAAAAAGAAAAATGTGGGGATCAAAGCTAAACGACAAACTAGCCATGAAATCAGGCTTTAAACTGAGATAAATAGAGTTGAGGTTAATTTTTACCTATGGCTGGGAAACAGCAGAGTGTAAGAATAATGAATAAATGTCAATGATTAAATGTAAATAATTATAAAGAAATCTCAGTTTCTCGAAGTCGTTGCCTATACTGGACTCAACAGCCCCCAGTCGGAGCCTTCAATTTGGGCACCGTTGTTTGGGGTCTGCCTCACCCGATTGTTGTTGTTGGAGTTAATAGTT

CDS

ATGGAGCTTTCGTCAAGGGAAGGAGTAGGAATGAGCTATATGCTCGTCCTAATGAAGAGTTTTTCTGTTTGGACTTTCACCCTGTTAGTTTGTCTATTGGTGGTCGGTTTCCCGCTGGTGTTTTTGGTCGCTACAGTGGGGGTTTTGGCGACGGTGGTATTACAGTCAGTTTTACCGATGAGTGCTGTGCTCTTAGTAGCCAGCAGTCTTTTGGGAGGGACAGTTTTATTGGTTCTTTCTGGGGCCGCCACCTTGACCGCCAAAGGAATCCATCCTCAGGAAGTGCGTTGGTTAAGTTGGCTCCATGGGGAAACTAATTTAATTCATAAACCCATGTTTGCATCCTGCCCGTTGACGTGCAGTCTCATTCAGTGA

Protein

MELSSREGVGMSYMLVLMKSFSVWTFTLLVCLLVVGFPLVFLVATVGVLATVVLQSVLPMSAVLLVASSLLGGTVLLVLSGAATLTAKGIHPQEVRWLSWLHGETNLIHKPMFASCPLTCSLIQ