Your browser is old and dusty. Try Google Chrome!

Details for slr1622

ORF slr1622
Accession NP_441751.2
Symbol ppa
Category Phosphorus compounds
Definition soluble inorganic pyrophosphatase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -50 -64 -0.983719 0.246
NP_440795.1_7 Forward -63 -56 11.3472 0.0978
NP_440795.1_7 Forward -281 -274 7.80726 0.232
NP_442291.1_5 Reverse -54 -70 8.71166 0.0558
NP_440897.1_6 Forward -64 -45 0.392004 0.18
NP_441453.1_4 Forward -64 -56 7.19758 0.0757
NP_441453.1_4 Reverse -55 -63 4.93597 0.224
NP_441623.1_1 Reverse -36 -54 -0.865831 0.238
NP_441623.1_1 Reverse -35 -53 -4.20908 0.274
NP_441818.1_1 Reverse -56 -67 15.6928 0.0257
NP_441818.1_9 Forward -70 -51 -0.787193 0.196
NP_441630.1_3 Forward -296 -277 1.37609 0.248
NP_442655.1_10 Reverse -212 -231 -1.27885 0.182
NP_442173.1_1 Reverse -56 -64 5.62429 0.206
NP_442173.1_1 Forward -63 -55 4.73931 0.258
NP_442752.1_4 Forward -64 -57 10.8555 0.0846
NP_442752.1_4 Reverse -93 -100 6.52896 0.154
NP_442752.1_4 Forward -288 -281 5.54565 0.194
NP_443027.1_4 Reverse -53 -63 9.12481 0.177
NP_443027.1_4 Forward -66 -56 7.35486 0.24
NP_441745.1_3 Reverse -47 -66 14.0599 0.276
NP_442975.1_10 Reverse -275 -289 8.75042 0.0875
NP_440074.1_6 Forward -374 -355 14.6499 0.268
NP_441675.1_4 Reverse -352 -371 9.83255 0.218
NP_440784.1_7 Reverse -56 -63 12.4288 0.0475
NP_440784.1_7 Forward -63 -56 6.23397 0.241
NP_441250.1_3 Reverse -17 -36 6.98095 0.212
NP_440061.1_9 Reverse -53 -67 15.9285 0.035
NP_441145.1_1 Forward -75 -56 6.4893 0.254
NP_442062.1_8 Forward -64 -54 9.51814 0.0613
NP_442062.1_8 Reverse -55 -65 4.50326 0.212
NP_441900.1_2 Forward -105 -87 -3.42315 0.279
NP_441859.1_3 Forward -65 -46 5.99684 0.185
NP_441859.1_3 Forward -345 -326 1.27698 0.29
NP_440304.1_4 Forward -76 -66 5.68323 0.196
NP_441581.1_6 Reverse -56 -75 13.3647 0.283
NP_440916.1_1 Forward -371 -357 14.0609 0.206
NP_442110.1_7 Reverse -59 -73 -0.197071 0.276
NP_441925.1_4 Forward -351 -332 -13.3743 0.257
NP_441925.1_4 Reverse -51 -70 -17.1108 0.288
NP_441083.1_5 Reverse -55 -65 1.16001 0.215
NP_439957.1_9 Forward -30 -11 3.00757 0.3
NP_441571.1_8 Forward -27 -8 -2.45882 0.255
NP_441558.1_5 Reverse -156 -175 10.5209 0.0968
NP_440209.1_1 Forward -64 -56 8.37755 0.0576
NP_442889.1_8 Reverse -52 -66 4.8172 0.25
NP_441713.1_1 Reverse -49 -68 -7.37537 0.13
NP_442570.1_3 Forward -72 -53 -8.65367 0.291
NP_441716.1_1 Reverse -55 -69 10.521 0.0951
NP_441327.1_5 Reverse -143 -152 14.356 0.192
NP_441327.1_5 Forward -55 -46 14.356 0.192
NP_442111.1_4 Forward -65 -51 10.521 0.0535
NP_440906.1_5 Forward -63 -56 6.23397 0.234
NP_440906.1_5 Reverse -56 -63 6.0373 0.262
NP_440747.1_10 Reverse -52 -64 -2.61596 0.0556
NP_440747.1_10 Forward -67 -55 -2.61596 0.0556
NP_441130.1_10 Forward -66 -52 5.80112 0.214
NP_441486.1_1 Forward -240 -226 -1.77037 0.175
NP_442634.1_4 Forward -66 -52 -3.147 0.161
NP_440470.1_5 Reverse -363 -382 8.92807 0.243
NP_440403.1_4 Reverse -56 -75 -6.88371 0.236
NP_441014.1_10 Reverse -109 -128 5.01354 0.194
NP_441012.1_4 Reverse -328 -341 8.27909 0.272
NP_443018.1_3 Forward -63 -56 13.8055 0.024
NP_443018.1_3 Reverse -56 -63 13.6088 0.0352
NP_441634.1_8 Forward -66 -52 7.27608 0.114
NP_441634.1_8 Reverse -90 -104 2.2612 0.169
NP_441634.1_8 Reverse -219 -233 -2.65535 0.295
NP_440376.1_1 Forward -64 -55 6.48957 0.0963
NP_440376.1_1 Forward -288 -279 1.47469 0.251
NP_440376.1_1 Reverse -55 -64 -0.196935 0.285
NP_442687.1_7 Reverse -54 -64 4.60159 0.243
NP_442485.1_3 Reverse -60 -79 1.17943 0.232
NP_441846.1_10 Forward -85 -66 -23.1083 0.277
NP_442958.1_3 Forward -75 -56 1.76941 0.267
NP_440642.1_1 Reverse -29 -48 6.98095 0.266
NP_440642.1_10 Forward -367 -353 9.53707 0.186
NP_440642.1_10 Forward -150 -136 7.76712 0.221
NP_440642.1_10 Reverse -109 -123 7.07881 0.223
NP_441013.1_3 Forward -70 -51 6.98095 0.276
NP_442658.1_1 Forward -66 -56 7.0594 0.214
NP_442658.1_1 Reverse -53 -63 5.87944 0.246
NP_442198.1_7 Reverse -62 -81 8.55343 0.292
NP_442544.1_6 Reverse -3 -22 -5.31042 0.297
NP_441414.1_9 Reverse -286 -305 -10.4236 0.284
NP_442300.1_1 Forward -133 -114 3.44104 0.29
NP_441958.1_5 Forward -65 -55 -6.60814 0.283
NP_442836.1_5 Reverse -89 -108 1.96607 0.27
NP_440203.1_1 Reverse -56 -75 20.5506 0.138
NP_439905.1_1 Reverse -56 -69 9.95071 0.216
NP_439990.1_5 Reverse -50 -63 8.86907 0.158
NP_442911.1_2 Reverse -45 -64 -0.787193 0.0786
NP_442911.1_2 Forward -247 -228 -4.72043 0.14
NP_440153.1_5 Reverse -56 -70 1.67122 0.245
NP_440153.1_8 Reverse -55 -68 4.93583 0.183
NP_440200.1_7 Reverse -351 -370 10.8206 0.204
NP_443055.1_3 Forward -73 -54 10.3587 0.291
NP_441348.1_3 Forward -69 -50 11.3075 0.176
NP_441099.1_5 Forward -215 -196 -2.36049 0.12
NP_442002.1_1 Reverse -84 -102 -8.83064 0.272
NP_441712.1_1 Forward -29 -10 10.9704 0.251
NP_441294.1_7 Forward -105 -91 9.73057 0.229
NP_441504.1_2 Forward -258 -241 13.6085 0.222
NP_441646.1_1 Reverse -48 -67 0.982764 0.24
NP_442438.1_10 Forward -242 -228 3.73617 0.157
NP_441000.1_6 Reverse -54 -68 3.8345 0.104
NP_440147.1_4 Reverse -53 -66 5.91914 0.109
NP_441550.1_8 Forward -66 -56 5.38779 0.252
NP_441916.1_7 Forward -64 -54 6.37155 0.0988
NP_441041.1_4 Forward -70 -51 -3.3438 0.121
NP_441041.1_4 Forward -64 -45 -9.34199 0.215
NP_441041.1_4 Forward -173 -154 -13.9635 0.299
NP_442004.1_6 Reverse -273 -287 1.47456 0.288
NP_441725.1_5 Reverse -66 -76 7.35486 0.101
NP_441725.1_5 Reverse -56 -66 -0.511621 0.26
NP_441725.1_5 Forward -107 -97 -1.00328 0.279
NP_439966.1_4 Forward -133 -114 13.0775 0.103
NP_439966.1_7 Reverse -53 -63 11.7793 0.0573
NP_439966.1_7 Forward -66 -56 5.58445 0.216
NP_442941.1_3 Reverse -56 -66 9.41981 0.0319
NP_440674.1_3 Forward -101 -82 0.982764 0.284
NP_441678.1_9 Forward -75 -56 -1.18052 0.238
NP_442012.1_2 Forward -66 -47 2.65439 0.249
NP_441556.1_10 Reverse -50 -64 13.0446 0.182
NP_441556.1_10 Forward -70 -56 10.3192 0.27
NP_441644.1_6 Reverse -99 -109 10.3043 0.0628
NP_441644.1_6 Reverse -55 -65 6.27276 0.163
NP_441644.1_6 Forward -64 -54 5.97777 0.172
NP_441644.1_6 Reverse -158 -168 4.7978 0.224
NP_443049.1_6 Forward -65 -55 11.6409 0.24
NP_442215.1_2 Reverse -26 -42 8.80999 0.0612
NP_442029.1_1 Forward -76 -57 -19.0768 0.281
NP_442029.1_1 Reverse -81 -100 -19.8634 0.297
NP_440929.1_8 Forward -64 -55 7.66954 0.0624
NP_440929.1_8 Reverse -55 -64 7.57121 0.0706
NP_440780.1_1 Forward -384 -365 11.6018 0.243
NP_442933.1_10 Forward -64 -55 5.70292 0.165
NP_441310.1_10 Reverse -141 -151 15.7909 0.131
NP_440430.1_6 Forward -65 -47 13.7316 0.275
NP_441751.2_6 Forward -231 -212 22.418 0.0404
NP_441751.2_8 Reverse -56 -70 4.81781 0.0464
NP_442554.1_8 Reverse -56 -66 15.123 0.00944
NP_442554.1_8 Forward -63 -53 9.7148 0.0562
NP_442554.1_8 Reverse -159 -169 3.02829 0.245
NP_442142.1_4 Reverse -52 -65 7.98351 0.125
NP_442142.1_4 Forward -47 -34 5.13193 0.201
NP_442142.1_4 Forward -227 -214 3.7553 0.246
NP_442142.1_4 Reverse -58 -71 3.55864 0.251
NP_442142.1_4 Forward -338 -325 3.26365 0.262
NP_442142.1_4 Forward -170 -157 3.06699 0.268
NP_442292.1_1 Reverse -56 -65 15.536 0.0107
NP_442292.1_1 Forward -63 -54 -0.68859 0.268
NP_443009.1_5 Forward -65 -54 7.62965 0.124
NP_440125.1_1 Reverse -367 -386 7.66927 0.265
NP_441715.1_4 Reverse -56 -66 7.55152 0.108
NP_440183.1_9 Reverse -85 -104 -20.1584 0.282
NP_440379.1_5 Reverse -62 -81 -8.26035 0.25
NP_441468.1_1 Forward -63 -56 13.8055 0.0242
NP_441468.1_1 Reverse -56 -63 6.0373 0.223
NP_441673.1_1 Forward -64 -55 1.37636 0.114
NP_441673.1_1 Reverse -55 -64 1.1797 0.163
NP_441764.1_8 Forward -30 -20 13.2248 0.284
NP_442868.1_6 Forward -66 -56 9.51814 0.0447
NP_442719.1_2 Forward -196 -178 -4.2098 0.208
NP_442719.1_2 Forward -380 -362 -8.83133 0.257
NP_441612.1_2 Forward -131 -121 7.38753 0.255
NP_442361.1_8 Forward -232 -214 12.2122 0.282
NP_442808.1_1 Reverse -54 -64 7.25606 0.0831
NP_441101.1_10 Forward -244 -225 -5.99873 0.287
NP_441101.1_10 Reverse -51 -70 -6.68705 0.29
NP_442050.1_1 Forward -87 -68 9.0459 0.25
NP_440558.1_2 Reverse -52 -71 -3.54046 0.236
NP_440558.1_2 Reverse -224 -243 -6.49039 0.275
NP_442789.1_4 Forward -70 -51 -8.26035 0.299
NP_441878.1_6 Forward -65 -55 1.65166 0.0795
NP_441878.1_6 Reverse -54 -64 -0.41329 0.177
NP_441878.1_6 Forward -75 -65 -6.60814 0.193
NP_441878.1_6 Reverse -227 -237 -7.98478 0.285
NP_441036.1_8 Reverse -54 -64 6.96153 0.213
NP_441557.1_5 Reverse -55 -64 7.57121 0.049
NP_441557.1_5 Forward -64 -55 1.08137 0.0794
NP_441445.1_1 Reverse -1 -20 2.85105 0.226
NP_441445.1_1 Forward -246 -227 0.392778 0.275
NP_441445.1_1 Forward -73 -54 0.392778 0.275
NP_441590.1_6 Reverse -269 -288 13.2733 0.209
NP_441433.1_8 Reverse -133 -152 -3.44213 0.283
NP_441458.1_10 Reverse -46 -65 4.71934 0.227
NP_441458.1_10 Reverse -62 -81 1.57275 0.288
NP_442183.1_9 Reverse -89 -99 9.12481 0.296
NP_440276.1_8 Reverse -108 -127 8.16093 0.27
NP_442347.1_2 Reverse -280 -289 3.7363 0.284
NP_442645.1_2 Forward -72 -53 -13.8652 0.165
NP_441633.1_3 Forward -346 -333 2.18257 0.103
NP_441633.1_3 Reverse -53 -66 -1.65234 0.16
NP_440136.1_2 Forward -63 -56 6.52896 0.116
NP_440136.1_2 Reverse -56 -63 6.13563 0.193
NP_442590.1_10 Forward -71 -52 5.40766 0.26
NP_442590.1_10 Reverse -86 -105 4.916 0.27
NP_442998.1_10 Reverse -57 -64 6.13563 0.181
NP_440299.1_1 Reverse -51 -64 15.3583 0.017
NP_441799.1_1 Forward -68 -54 7.07881 0.153
NP_440640.1_6 Reverse -83 -102 5.89931 0.205
NP_441007.1_10 Forward -172 -159 0.510939 0.226
NP_441007.1_10 Forward -79 -66 -0.472371 0.285
NP_442201.1_10 Forward -75 -56 -5.21209 0.156
NP_440256.1_1 Forward -205 -186 -1.37718 0.103
NP_440256.1_1 Forward -291 -272 -6.49039 0.213
NP_440087.1_1 Forward -73 -54 -2.85214 0.217
NP_442283.1_4 Reverse -339 -358 17.699 0.2
NP_441559.1_8 Reverse -50 -64 3.63784 0.143
NP_441559.1_8 Reverse -117 -131 2.5562 0.143
NP_441559.1_8 Forward -69 -55 -1.08205 0.18
NP_441559.1_8 Reverse -60 -74 -6.68692 0.279
NP_441559.1_8 Reverse -61 -75 -7.76856 0.299
NP_442158.1_4 Reverse -368 -378 10.3048 0.299
NP_440748.1_5 Reverse -58 -77 -1.7705 0.269
NP_440695.1_6 Forward -373 -359 13.0292 0.243
NP_441939.1_3 Reverse -321 -340 12.0942 0.103
NP_441199.1_6 Forward -228 -209 2.3594 0.198
NP_442993.1_1 Reverse -253 -269 -10.9545 0.231
NP_442993.1_1 Reverse -99 -115 -11.2495 0.24
NP_442386.1_9 Reverse -54 -63 12.979 0.0469
NP_442386.1_9 Forward -65 -56 11.799 0.0835
NP_441750.1_1 Forward -73 -54 -9.63698 0.3
NP_441340.1_5 Reverse -56 -63 13.5105 0.0314
NP_441340.1_5 Forward -63 -56 6.23397 0.132
NP_440327.1_6 Reverse -242 -261 2.3594 0.298
NP_442950.1_1 Reverse -141 -160 -5.11376 0.244
NP_440586.1_8 Reverse -56 -63 11.3468 0.0736
NP_440586.1_8 Forward -63 -56 9.47853 0.146
NP_440586.1_8 Reverse -159 -166 5.8403 0.283
NP_441262.1_3 Forward -64 -57 5.25066 0.215
NP_440027.1_3 Reverse -55 -73 5.22993 0.245
NP_440027.1_3 Forward -74 -56 1.78836 0.295
NP_440027.1_8 Reverse -52 -71 3.73524 0.297
NP_443051.1_1 Forward -65 -56 0.688044 0.134
NP_443051.1_5 Reverse -136 -155 5.30933 0.256
NP_440372.1_2 Forward -63 -56 6.62729 0.151
NP_440372.1_2 Reverse -56 -63 6.52896 0.188
NP_441789.1_7 Reverse -57 -76 5.2102 0.193
NP_440991.1_8 Forward -260 -241 14.7358 0.274
NP_440316.1_10 Forward -75 -65 6.17489 0.265
NP_439977.1_5 Reverse -49 -68 4.62101 0.152
NP_441572.1_7 Reverse -49 -68 -1.37718 0.188
NP_442384.1_10 Forward -64 -51 8.67241 0.0625
NP_442384.1_10 Reverse -55 -68 2.67422 0.216
NP_440693.1_8 Reverse -87 -106 14.1591 0.237
NP_442262.1_10 Forward -63 -56 13.0188 0.0314
NP_442262.1_10 Reverse -56 -63 11.6422 0.092
NP_440163.1_10 Reverse -329 -339 14.533 0.102
NP_440163.1_10 Forward -338 -328 8.82982 0.26
NP_440344.1_10 Reverse -48 -65 -5.56602 0.107
NP_440531.1_6 Forward -72 -53 3.04771 0.148
NP_441060.1_3 Forward -89 -70 11.9958 0.184
NP_442693.1_7 Forward -45 -26 8.75091 0.266
NP_440297.1_9 Reverse -66 -76 7.35486 0.126
NP_440297.1_9 Reverse -56 -66 0.176696 0.282
NP_440297.1_9 Forward -107 -97 -0.118297 0.282
NP_440297.1_9 Forward -63 -53 -0.118297 0.282
NP_441896.1_5 Forward -162 -155 12.2322 0.273
NP_441103.1_9 Forward -151 -141 15.3217 0.192
NP_441103.1_9 Reverse -47 -57 15.1264 0.192
NP_441103.1_9 Reverse -26 -36 12.3919 0.298
NP_440990.1_10 Reverse -83 -102 18.584 0.249
NP_440999.1_9 Reverse -51 -65 16.4209 0.021
NP_440999.1_9 Reverse -61 -75 5.21113 0.113
NP_440888.1_2 Forward -101 -87 8.3571 0.163
NP_440888.1_2 Reverse -55 -69 7.66879 0.186
NP_440491.1_1 Forward -74 -55 7.01447 0.28
NP_442033.1_10 Reverse -53 -72 -6.68705 0.186
NP_442871.1_4 Forward -106 -87 -2.16459 0.198
NP_441917.1_2 Reverse -80 -98 9.85225 0.249
NP_441543.1_2 Reverse -56 -65 14.651 0.0119
NP_442845.1_2 Forward -70 -56 7.47274 0.195
NP_442845.1_2 Forward -294 -280 4.32615 0.261
NP_442845.1_2 Forward -108 -94 4.03116 0.271
NP_441304.1_10 Reverse -360 -369 14.7494 0.164
NP_441469.1_8 Reverse -54 -63 15.241 0.0202
NP_441469.1_8 Forward -75 -66 7.86621 0.227
NP_441469.1_8 Forward -65 -56 5.3096 0.277
NP_440710.1_2 Forward -193 -174 14.1591 0.198
NP_440071.1_2 Forward -134 -120 17.3058 0.24
NP_440220.1_4 Forward -378 -359 -2.65624 0.279
NP_443062.1_1 Reverse -55 -73 5.03566 0.242
NP_443062.1_1 Forward -64 -46 4.15809 0.272
NP_443062.1_6 Reverse -324 -343 5.30933 0.206
NP_443062.1_6 Forward -82 -63 3.44104 0.237
NP_443062.1_6 Forward -72 -53 1.0811 0.28
NP_441601.1_4 Reverse -54 -73 -5.31042 0.293
NP_441410.1_4 Reverse -41 -60 11.6017 0.244
NP_440519.1_8 Forward -133 -117 2.41848 0.262
NP_442204.1_1 Forward -68 -57 1.04198 0.281
NP_442204.1_1 Reverse -31 -42 0.648657 0.281
NP_442204.1_5 Reverse -89 -108 3.6377 0.186
NP_442487.1_2 Forward -235 -216 11.7 0.101
NP_442487.1_2 Forward -238 -219 2.6536 0.232
NP_440516.1_2 Reverse -49 -67 14.2771 0.0538
NP_440516.1_6 Reverse -29 -43 8.55376 0.246
NP_440516.1_8 Forward -64 -55 -0.196935 0.185
NP_442428.1_5 Forward -63 -56 14.1988 0.0242
NP_442428.1_5 Reverse -56 -63 6.0373 0.212
NP_440818.1_6 Reverse -80 -99 5.80098 0.284
NP_441443.1_7 Reverse -80 -99 2.26107 0.218
NP_442859.1_2 Reverse -56 -75 3.83436 0.235
NP_442120.1_10 Reverse -99 -118 -10.1286 0.254
NP_442120.1_10 Reverse -158 -177 -14.5535 0.288
NP_440673.1_3 Reverse -57 -64 11.6422 0.0724
NP_441052.1_2 Reverse -55 -65 8.33817 0.0462
NP_441052.1_2 Forward -44 -34 0.668351 0.256
NP_442219.1_9 Reverse -56 -65 7.96454 0.0696
NP_440436.1_4 Reverse -56 -65 14.2573 0.0147
NP_440314.1_9 Reverse -56 -75 -9.73531 0.276
NP_442907.1_9 Reverse -56 -75 2.0644 0.174
NP_441719.1_4 Forward -63 -56 6.62729 0.151
NP_441719.1_4 Reverse -56 -63 6.52896 0.188
NP_441004.1_1 Reverse -345 -364 -13.4719 0.257
NP_441004.1_1 Forward -80 -61 -16.6185 0.286
NP_441004.1_1 Reverse -209 -228 -17.9951 0.296
NP_441004.1_2 Forward -85 -66 -2.16383 0.263
NP_442813.1_4 Forward -149 -130 8.75091 0.139
NP_442813.1_5 Reverse -101 -120 1.0811 0.296
NP_439949.1_7 Reverse -360 -374 14.7492 0.215
NP_442206.1_10 Forward -64 -49 6.9614 0.178
NP_442854.1_6 Reverse -55 -74 6.09597 0.238
NP_443054.1_2 Reverse -90 -104 12.291 0.0722
NP_442586.1_7 Forward -191 -172 16.3704 0.287
NP_441851.1_10 Forward -65 -55 14.1397 0.0219
NP_441851.1_10 Reverse -54 -64 4.60159 0.259
NP_441545.1_1 Reverse -63 -82 -0.295539 0.294
NP_441668.1_3 Reverse -364 -383 10.4225 0.226
NP_441668.1_4 Reverse -244 -263 2.55606 0.196
NP_441046.1_2 Forward -85 -66 7.47261 0.221
NP_441349.1_10 Forward -74 -55 1.37609 0.084
NP_441661.1_3 Reverse -225 -242 -6.15601 0.294
NP_439960.1_10 Reverse -82 -100 -2.83245 0.258
NP_440474.1_8 Reverse -229 -243 4.91554 0.263
NP_440431.1_3 Reverse -191 -210 -7.57203 0.208
NP_440431.1_4 Forward -27 -8 -8.16498 0.275
NP_440588.1_3 Forward -75 -56 12.1925 0.248
NP_441570.1_1 Forward -70 -52 -17.2871 0.269
NP_441078.1_4 Forward -64 -55 7.66954 0.052
NP_441078.1_4 Reverse -55 -64 0.491382 0.188
NP_441094.1_6 Forward -269 -252 10.0679 0.257
NP_440526.1_3 Reverse -159 -170 7.138 0.161
NP_440526.1_3 Reverse -56 -67 0.943182 0.267
NP_441432.1_8 Forward -65 -56 14.0611 0.0258
NP_441432.1_9 Reverse -13 -26 16.0641 0.121
NP_441732.1_2 Reverse -51 -67 -16.4611 0.167
NP_442003.1_4 Forward -73 -54 15.9291 0.19
NP_440578.1_10 Reverse -41 -60 9.53756 0.282
NP_440461.1_3 Reverse -220 -239 14.4541 0.281
NP_441057.1_4 Reverse -82 -100 -1.65248 0.272
NP_441057.1_4 Forward -74 -56 -2.0458 0.272
NP_442353.1_4 Forward -236 -217 12.585 0.0776
NP_442510.1_5 Forward -83 -64 14.0608 0.22
NP_441072.1_2 Forward -75 -56 15.8307 0.12
NP_441072.1_2 Forward -299 -280 9.3409 0.219
NP_441072.1_2 Reverse -217 -236 6.39097 0.28
NP_442400.1_10 Forward -25 -12 17.6323 0.112
NP_442489.1_7 Forward -64 -55 8.1612 0.0294
NP_442489.1_7 Reverse -55 -64 0.491382 0.178
NP_440559.1_1 Reverse -56 -65 7.76787 0.0918
NP_441659.2_8 Reverse -55 -65 6.56821 0.0714
NP_441659.2_8 Reverse -65 -75 2.24165 0.207
NP_441659.2_8 Reverse -99 -109 1.35667 0.242
NP_442749.1_5 Reverse -354 -371 8.80213 0.225
NP_441040.1_5 Reverse -88 -107 4.32602 0.25
NP_442346.1_2 Forward -75 -56 5.99764 0.281
NP_442346.1_5 Forward -65 -55 14.6313 0.0115
NP_442346.1_5 Reverse -157 -167 9.51814 0.118
NP_442346.1_5 Reverse -98 -108 4.69992 0.276
NP_442346.1_5 Forward -75 -65 4.50326 0.286
NP_440352.1_5 Reverse -134 -153 12.6557 0.228
NP_440352.1_5 Reverse -351 -370 11.293 0.267
NP_440545.1_3 Forward -68 -51 11.2486 0.0268
NP_440545.1_3 Reverse -224 -241 -1.43612 0.168
NP_441629.1_1 Reverse -308 -327 6.98095 0.253
NP_441126.1_8 Forward -73 -60 12.114 0.291
NP_440459.1_2 Forward -73 -56 8.39697 0.264
NP_440847.1_5 Reverse -82 -101 11.7992 0.281
NP_442828.1_5 Forward -393 -374 11.2084 0.289
NP_441888.1_7 Reverse -50 -64 11.701 0.0781
NP_441888.1_7 Reverse -60 -74 2.2612 0.225
NP_441502.1_2 Forward -383 -364 16.3694 0.272
NP_441833.1_4 Forward -63 -56 6.23397 0.163
NP_441833.1_4 Reverse -56 -63 6.13563 0.198
NP_442162.1_9 Forward -63 -56 6.62729 0.142
NP_442162.1_9 Reverse -56 -63 6.43063 0.208
NP_442140.1_1 Reverse -46 -65 14.7962 0.21
NP_442140.1_3 Forward -63 -53 14.238 0.0486
NP_442140.1_3 Reverse -159 -169 8.23984 0.122
NP_442140.1_3 Reverse -56 -66 6.46988 0.168
NP_440875.1_9 Forward -62 -52 15.575 0.028
NP_440875.1_9 Forward -165 -155 9.05339 0.233
NP_441813.1_5 Reverse -53 -63 8.82982 0.0367
NP_441813.1_5 Forward -66 -56 8.4365 0.0432
NP_440590.1_4 Reverse -56 -69 3.65753 0.0702
NP_440590.1_4 Forward -63 -50 -4.01229 0.257
NP_442497.1_10 Reverse -56 -65 0.589713 0.153
NP_442497.1_10 Forward -63 -54 -1.18024 0.256
NP_440821.1_4 Reverse -53 -63 -0.216628 0.244
NP_440821.1_4 Forward -66 -56 -0.314959 0.251
NP_441239.1_9 Reverse -53 -65 14.7886 0.0258
NP_441239.1_9 Forward -66 -54 3.18557 0.292
NP_441951.1_6 Forward -188 -169 11.1109 0.248
NP_441009.1_4 Forward -64 -45 14.6508 0.167
NP_440156.1_4 Forward -371 -361 13.2542 0.176
NP_440400.1_1 Reverse -67 -86 -1.8696 0.285
NP_442643.1_3 Reverse -77 -96 -3.83545 0.261
NP_442629.1_3 Reverse -373 -392 6.19431 0.272
NP_440833.1_6 Forward -53 -39 13.372 0.166
NP_442809.1_6 Forward -86 -67 5.40766 0.256
NP_440546.1_4 Forward -288 -278 8.39772 0.192
NP_441230.1_3 Reverse -53 -72 4.12936 0.269
NP_440868.1_4 Forward -68 -56 7.90546 0.0637
NP_442402.1_4 Forward -193 -174 -4.03287 0.22
NP_441848.1_4 Forward -381 -365 15.381 0.154
NP_441848.1_7 Reverse -18 -37 -3.73788 0.284
NP_440696.1_3 Forward -74 -56 4.9357 0.198
NP_440696.1_3 Reverse -55 -73 -2.3408 0.274
NP_442039.1_4 Forward -63 -56 6.3323 0.289
NP_442039.1_7 Reverse -249 -259 11.4848 0.257
NP_441811.1_8 Forward -70 -56 6.98109 0.259
NP_441811.1_8 Reverse -222 -236 6.58777 0.267
NP_442837.1_3 Forward -63 -56 6.0373 0.25
NP_442837.1_3 Reverse -56 -63 5.93897 0.265
NP_440160.1_9 Forward -44 -25 11.8975 0.216
NP_440505.1_3 Forward -66 -56 9.32148 0.122
NP_440505.1_3 Forward -290 -280 5.38824 0.23
NP_442255.1_1 Forward -63 -44 14.5524 0.095
NP_440013.1_5 Forward -378 -364 17.2068 0.29
NP_441011.1_8 Forward -63 -54 5.70292 0.237
NP_442533.1_1 Reverse -345 -364 -11.4069 0.236
NP_442533.1_1 Reverse -77 -96 -14.7502 0.247
NP_442533.1_1 Reverse -218 -237 -17.8968 0.297
NP_442533.1_6 Reverse -55 -64 7.66954 0.0897
NP_442533.1_6 Forward -64 -55 6.8829 0.101
NP_442533.1_6 Forward -74 -65 2.94966 0.232
NP_442541.1_10 Reverse -55 -69 6.29216 0.248
NP_442232.1_3 Forward -72 -53 -8.16202 0.219
NP_442232.1_3 Reverse -220 -239 -11.0136 0.277
NP_442322.1_4 Reverse -58 -75 -9.59824 0.295
NP_441028.1_6 Forward -368 -358 5.48612 0.255
NP_441028.1_6 Reverse -47 -57 5.38779 0.255
NP_441527.1_4 Forward -126 -107 -9.78835 0.262
NP_441527.1_4 Forward -38 -19 -12.1756 0.285
NP_440115.1_6 Forward -67 -57 5.28991 0.259
NP_440007.1_9 Reverse -95 -109 1.37622 0.285
NP_442728.1_7 Reverse -350 -364 13.1759 0.263
NP_441106.1_1 Forward -65 -56 6.48957 0.0895
NP_439903.1_6 Forward -266 -247 3.04693 0.213
NP_442306.1_10 Forward -69 -50 -21.4367 0.27
NP_440670.1_8 Forward -64 -55 6.78456 0.099
NP_440670.1_8 Reverse -55 -64 5.3096 0.167
NP_440670.1_8 Forward -108 -99 3.14632 0.296
NP_441886.1_2 Reverse -84 -103 8.35759 0.216
NP_440886.1_7 Reverse -54 -64 8.63269 0.0805
NP_440886.1_7 Reverse -278 -288 4.50281 0.232
NP_440886.1_7 Forward -102 -92 4.30615 0.243
NP_440083.1_6 Forward -372 -353 15.3382 0.296
NP_442382.1_9 Reverse -118 -137 13.47 0.259
NP_442382.1_9 Reverse -31 -50 8.65176 0.281
NP_442963.1_3 Forward -207 -189 15.0638 0.273
NP_441021.1_1 Reverse -56 -75 -9.44032 0.216
NP_441021.1_1 Reverse -159 -178 -11.3086 0.259
NP_441463.1_3 Forward -247 -228 -3.44213 0.176
NP_441626.1_2 Forward -63 -56 6.52896 0.137
NP_441626.1_2 Reverse -56 -63 5.93897 0.231
NP_442211.1_3 Forward -70 -51 13.8914 0.22
NP_442365.1_7 Reverse -51 -70 -1.96717 0.198
NP_441962.1_4 Forward -69 -50 -12.9802 0.268
NP_441962.1_4 Reverse -321 -340 -13.8652 0.279
NP_441431.1_2 Reverse -62 -76 7.57046 0.238
NP_441836.1_2 Forward -70 -51 3.93269 0.147
NP_441836.1_2 Forward -173 -154 -6.49039 0.298
NP_440114.1_10 Forward -295 -281 6.98109 0.25
NP_440114.1_10 Reverse -99 -113 5.70279 0.296
NP_442698.1_10 Forward -41 -22 1.86774 0.291
NP_442698.1_10 Forward -62 -43 0.982764 0.297
NP_440287.1_5 Forward -101 -82 6.98015 0.286
NP_440766.1_4 Forward -253 -239 0.491246 0.28
NP_440766.1_5 Forward -32 -20 6.98735 0.29
NP_439988.1_7 Reverse -230 -244 16.8135 0.292
NP_440422.1_10 Reverse -7 -26 6.24133 0.245
NP_442930.1_1 Forward -373 -363 14.0409 0.239
NP_442930.1_1 Forward -372 -362 12.9592 0.239
NP_442867.1_8 Forward -99 -80 9.0459 0.229
NP_442867.1_8 Forward -100 -81 8.55425 0.232
NP_440457.1_1 Forward -68 -56 8.20045 0.101
NP_440457.1_1 Reverse -95 -107 1.80894 0.223
NP_441801.1_4 Reverse -167 -177 3.12662 0.231
NP_442680.1_5 Forward -32 -13 6.5198 0.207
NP_442680.1_5 Forward -33 -14 1.83066 0.237
NP_442680.1_5 Reverse -295 -314 -0.416223 0.284
NP_441984.1_3 Reverse -55 -73 12.5072 0.163
NP_441253.1_7 Reverse -51 -69 6.31233 0.276
NP_440554.1_4 Forward -63 -53 8.04317 0.0851
NP_440554.1_4 Reverse -56 -66 5.97822 0.128
NP_441885.1_5 Reverse -55 -65 1.84832 0.0957
NP_440478.1_10 Reverse -53 -67 16.8142 0.107
NP_442341.1_7 Forward -345 -331 7.76774 0.0994
NP_442341.1_7 Forward -332 -318 2.2612 0.263
NP_442341.1_9 Reverse -53 -67 6.19383 0.238
NP_441756.1_5 Reverse -51 -70 -1.37718 0.255
NP_441173.1_9 Forward -259 -251 13.2937 0.17
NP_443000.1_7 Forward -66 -56 10.2065 0.0355
NP_440275.1_3 Reverse -53 -63 5.68323 0.136
NP_440275.1_3 Forward -66 -56 5.38824 0.153
NP_442753.1_6 Reverse -155 -174 7.17681 0.239
NP_439962.1_4 Forward -102 -83 -7.4737 0.289
NP_441105.1_3 Reverse -44 -63 6.68596 0.0586
NP_441730.1_2 Reverse -365 -383 15.1621 0.222
NP_440216.1_1 Reverse -55 -69 -10.0302 0.145
NP_440216.1_1 Forward -64 -50 -11.8001 0.219
NP_442371.1_1 Forward -56 -46 13.9425 0.191
NP_442015.1_10 Reverse -51 -64 13.884 0.0354
NP_442015.1_10 Forward -68 -55 -0.472371 0.268
NP_441226.1_7 Reverse -56 -63 14.1984 0.024
NP_441111.1_7 Reverse -56 -64 8.86921 0.0589
NP_440244.1_1 Forward -61 -42 -9.047 0.287
NP_441766.1_2 Reverse -55 -64 6.39124 0.0993
NP_440416.1_9 Reverse -48 -67 5.60432 0.0355
NP_440416.1_9 Forward -244 -225 -5.40875 0.0797
NP_440416.1_9 Forward -148 -129 -12.6852 0.159
NP_440416.1_9 Forward -108 -89 -18.3884 0.256
NP_442116.1_6 Reverse -367 -384 9.02838 0.235
NP_442154.1_1 Reverse -84 -102 -17.2871 0.251
NP_440261.1_5 Forward -63 -50 -6.37223 0.201
NP_440261.1_5 Reverse -56 -69 -6.56889 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCTGTAAATCTGCATCAATAACTCCTAAAAAATTTCCCCTAGCTTCTTGCCAACCTCGAATCACCGCCGTGGATAAACCTCGTCCTTCTGTTCTTCTAATTACTCGCAATTGGGGATAGGTGTCGCTTAAGTTAAAAGCCTTTTGCCAAGTTAAATCGGGACTGTCATCGTCCACCACAATCAACTCATACTGTCCAGACCAACGGTTTTCCAACAGTTTCACCAGGGTAGTTACCATGGCTTGGATATTTTCCCCTTCGTTATAGGTGGGCAACACTAGGGAAAGGAAAATACCATCGGCCTCCCCCAGCTTGGGCACTGTTAGGGCAGTGGCTGGCGATGGCAGGGGAAAATAGACCATGGACAGGGGCAGAAAAATTGACAATAACCGTCCTAATT

CDS

ATGGCCTGTGAAAGGGCCAAGGGAAATTCCCCTCAGCTAAGGCTAGGTACAAGGGGAGCCCAACGAGTAAAATGCGATCGGGTTTTGAGCCCGTTTGGTTGTGACTCTTTTGTATTTCGTTGGAGAAAAATTGTGGATCTAAGCCGTATTCCTGCCCAGCCCAAAGCCGGTTTGATCAATGTGTTGATCGAAATTCCCGCAGGGAGCAAAAATAAATACGAGTTCGACAAAGACATGAATTGCTTTGCCCTCGACCGGGTACTGTATTCCTCTGTGCAATATCCCTACGACTACGGTTTTATCCCCAACACCCTGGCTGACGATGGCGATCCCCTCGATGGCATGGTGATTATGGACCAGCCCACTTTCCCCGGTTGCGTAATTACCGCCCGCCCCATTGGTATGTTGGAAATGATTGACGGTGGCGATCGGGACGAAAAAATTCTTTGTGTTCCCGCCAAAGATCCCCGCTACACCTACGTTAAATCCATCAATGACCTGGCTGGGCACCGCTTGGATGAAATTGCCGAGTTCTTCCGCTCCTACAAAAATTTGGAGAAAAAGGTGACAGAAATTCTGGGCTGGAAAGATGTAGATGCAGTGCTGCCCTTGGTGGAAGAGTGCGTTAAGAACTACAAATAG

Protein

MACERAKGNSPQLRLGTRGAQRVKCDRVLSPFGCDSFVFRWRKIVDLSRIPAQPKAGLINVLIEIPAGSKNKYEFDKDMNCFALDRVLYSSVQYPYDYGFIPNTLADDGDPLDGMVIMDQPTFPGCVITARPIGMLEMIDGGDRDEKILCVPAKDPRYTYVKSINDLAGHRLDEIAEFFRSYKNLEKKVTEILGWKDVDAVLPLVEECVKNYK