Your browser is old and dusty. Try Google Chrome!

Details for slr1616

ORF slr1616
Accession NP_440230.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -273 -259 -2.26202 0.287
NP_442291.1_5 Reverse -190 -206 -2.89139 0.229
NP_442272.1_2 Forward -349 -330 9.97848 0.27
NP_441812.1_3 Forward -176 -162 7.07942 0.287
NP_442972.1_2 Reverse -151 -165 14.9452 0.141
NP_440044.1_8 Reverse -199 -218 1.86774 0.161
NP_440916.1_1 Reverse -225 -239 7.9644 0.284
NP_441200.1_4 Forward -113 -94 10.8159 0.185
NP_441935.1_1 Reverse -106 -125 5.11266 0.293
NP_440300.1_5 Reverse -330 -348 12.1295 0.271
NP_441925.1_2 Forward -342 -323 3.44104 0.262
NP_441738.1_2 Reverse -200 -207 10.2652 0.101
NP_442889.1_8 Forward -327 -313 6.0955 0.203
NP_442570.1_3 Forward -193 -174 -0.295539 0.208
NP_441130.1_10 Reverse -263 -277 9.83269 0.12
NP_440403.1_4 Forward -273 -254 -8.35868 0.254
NP_442848.1_9 Forward -129 -110 4.916 0.202
NP_441422.1_7 Reverse -263 -280 -6.25434 0.248
NP_442782.1_2 Forward -108 -94 2.35953 0.275
NP_442937.1_2 Forward -33 -14 11.7983 0.293
NP_441958.1_1 Reverse -216 -235 12.9369 0.27
NP_440021.1_3 Forward -395 -376 8.16093 0.281
NP_441646.1_1 Reverse -191 -210 -0.0988766 0.259
NP_441916.1_10 Forward -305 -286 0.392778 0.285
NP_442004.1_6 Forward -279 -265 3.04785 0.251
NP_440703.1_9 Reverse -176 -189 5.82024 0.29
NP_440260.1_8 Forward -193 -175 -4.8974 0.273
NP_441514.1_1 Reverse -93 -103 14.1541 0.28
NP_442281.1_1 Reverse -260 -274 3.44058 0.231
NP_441644.1_6 Reverse -265 -275 5.28945 0.199
NP_441795.1_4 Forward -16 -3 17.3165 0.211
NP_442029.1_1 Forward -209 -190 -19.8634 0.297
NP_440096.1_9 Forward -112 -93 17.0491 0.253
NP_442292.1_2 Reverse -338 -352 19.4277 0.179
NP_441726.1_4 Forward -161 -147 13.7659 0.288
NP_441015.1_10 Forward -386 -367 -9.83364 0.282
NP_441764.1_8 Forward -347 -337 14.1818 0.284
NP_442719.1_2 Reverse -217 -235 -3.12816 0.199
NP_441612.1_2 Forward -324 -314 6.61303 0.283
NP_442808.1_1 Reverse -190 -200 1.06124 0.296
NP_441849.1_2 Reverse -328 -347 2.14815 0.245
NP_440558.1_2 Reverse -111 -130 -2.55715 0.229
NP_440558.1_2 Reverse -62 -81 -6.88371 0.283
NP_442347.1_2 Reverse -316 -325 6.78456 0.15
NP_442594.1_8 Forward -299 -280 10.3242 0.181
NP_441118.1_2 Forward -83 -64 13.6675 0.12
NP_441362.1_5 Reverse -326 -344 13.0549 0.187
NP_441559.1_8 Reverse -320 -334 -7.47356 0.294
NP_440748.1_5 Reverse -123 -142 1.86774 0.224
NP_442240.1_2 Reverse -5 -24 -18.5851 0.293
NP_442714.1_4 Forward -398 -379 13.7658 0.241
NP_440027.1_8 Reverse -285 -304 9.34008 0.243
NP_441138.1_6 Forward -69 -50 14.8474 0.255
NP_440819.1_5 Forward -236 -228 7.98423 0.228
NP_440210.1_8 Reverse -288 -304 7.53169 0.293
NP_442123.1_10 Forward -184 -165 8.06259 0.288
NP_442917.1_1 Forward -363 -344 9.93006 0.184
NP_440894.1_10 Reverse -250 -269 4.42435 0.254
NP_440888.1_2 Reverse -191 -205 5.40719 0.28
NP_442147.1_7 Forward -209 -190 18.7807 0.0993
NP_442033.1_10 Reverse -262 -281 -9.83364 0.222
NP_442845.1_2 Forward -206 -192 3.93283 0.272
NP_441918.1_7 Forward -179 -160 -1.18052 0.297
NP_441267.1_1 Reverse -114 -133 1.47442 0.279
NP_440618.1_1 Reverse -174 -193 -7.17871 0.25
NP_441052.1_2 Reverse -191 -201 2.24165 0.213
NP_440436.1_4 Reverse -106 -115 4.81753 0.239
NP_442414.1_1 Forward -288 -269 13.8641 0.291
NP_441004.1_1 Forward -296 -277 -2.75381 0.149
NP_441004.1_5 Forward -294 -280 7.17775 0.292
NP_440296.1_6 Forward -101 -83 11.3655 0.295
NP_442694.1_9 Reverse -317 -336 9.53756 0.244
NP_440593.1_3 Reverse -290 -309 -7.4737 0.295
NP_441982.1_6 Reverse -208 -217 11.9124 0.288
NP_441046.1_2 Reverse -94 -113 -1.27885 0.288
NP_441409.1_8 Forward -21 -2 13.3793 0.209
NP_441432.1_3 Forward -38 -19 10.52 0.275
NP_441432.1_5 Forward -280 -266 10.7177 0.271
NP_442751.1_2 Reverse -263 -282 3.53858 0.266
NP_439970.1_3 Forward -266 -247 11.6025 0.104
NP_442799.1_2 Reverse -119 -138 4.71934 0.198
NP_440875.1_9 Reverse -267 -277 8.95605 0.233
NP_440706.1_1 Forward -278 -259 -3.24547 0.258
NP_441874.1_1 Forward -217 -203 8.65272 0.298
NP_442083.1_10 Reverse -255 -274 10.2259 0.111
NP_442809.1_1 Reverse -380 -399 15.1416 0.26
NP_441509.1_1 Reverse -336 -355 8.45592 0.245
NP_441474.1_1 Reverse -190 -209 -0.492971 0.255
NP_442402.1_2 Reverse -224 -238 10.1271 0.298
NP_441848.1_7 Reverse -95 -114 -4.03287 0.287
NP_441848.1_7 Reverse -196 -215 -4.42619 0.292
NP_442039.1_7 Reverse -267 -277 7.74818 0.271
NP_442409.1_10 Reverse -194 -208 14.2569 0.293
NP_442532.1_1 Forward -351 -337 14.7781 0.215
NP_442532.1_7 Reverse -265 -279 1.57289 0.279
NP_441011.1_8 Reverse -316 -325 7.86621 0.165
NP_441697.1_5 Reverse -327 -346 -3.48588 0.217
NP_441527.1_4 Reverse -169 -188 1.19323 0.134
NP_441527.1_4 Forward -24 -5 -5.01375 0.194
NP_441527.1_4 Forward -23 -4 -7.78302 0.237
NP_441527.1_4 Reverse -170 -189 -11.8892 0.284
NP_440007.1_9 Reverse -261 -275 5.70279 0.249
NP_441420.1_2 Reverse -265 -284 13.1758 0.268
NP_439903.1_6 Reverse -96 -115 3.73524 0.207
NP_442614.1_2 Forward -324 -310 13.3726 0.128
NP_441403.1_4 Forward -183 -165 8.18062 0.282
NP_442125.1_2 Forward -295 -276 6.58763 0.244
NP_441021.1_8 Forward -288 -270 4.34571 0.223
NP_441463.1_6 Forward -202 -188 12.7938 0.216
NP_440855.1_3 Forward -184 -165 14.8466 0.158
NP_441431.1_2 Forward -307 -293 5.80051 0.288
NP_440935.1_4 Reverse -98 -116 15.1613 0.274
NP_441510.2_9 Forward -124 -105 8.25926 0.165
NP_441984.1_6 Reverse -296 -308 13.9036 0.262
NP_442534.1_7 Reverse -190 -209 6.4893 0.272
NP_441105.1_3 Forward -134 -115 -6.78538 0.241
NP_441226.1_7 Forward -273 -266 9.47853 0.147
NP_442116.1_6 Reverse -98 -115 11.2247 0.206
NP_442154.1_7 Reverse -297 -315 18.9479 0.168
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGAGCGCATTGAAGAGTTGGTTAGCCGTAAACGGGAAATCCTTAGTTACTATAAAGAAAATTTGGAGTCTTTACCGGGGATAACAATGAATCCTGAGCCAAAGGGTATGGTTAATGGTGGATGGATGCCAACGGCGGTATTTAGCCCTGAATCTGGTATTACTCGGGAAAAGTTACAAGTCCTTTTTAAGGAGGCGAATGTGGATGCCCGTGTTTTCTTTTGGCCGTTATCGAGTTTATCGATGTTTGATGATAAGCCCACAAATAAGTTGGCATGGGATATTCCAACAAGGGCAATAAATTTGCCTAGTTATCATGATTTGAGTGGCAAGGATATTAAACAGGTTATTGATTCTATGACAGACAATCTTTATCCGAAAAACGCAAATAGATCAAAAAA

CDS

ATGAATCAACGAATCAAAGTAATGATTGCTGGGATTGGAGGGGCTTCTCTTGGCACAGAAATTTGTAAGTCCCTCAAACTGGCTAAAATATACGACGTATTTGGATGTGATATTTCTGCTACTGCCTATGGTATGTATGAAAATGACTTTTTGAATACCTATCAAGTCTCATCTAGTAACTATGCGAGAAATGTTCTGGATGTTTGTGTTGATGCGGGCGTAAAATGGCTAATCCCAGGTGGCGAAGAGCCAATGAAACTGTTAGGTCAAGAAACAAAAATGTTTGCTGCGGCAAATATTCATGTGGTAGCAAATTCACCTAGTTTAATATCTATTTGCTCCAATAAAAAGCGTACTTTTAATAAATTAACTGAGTTAGAAATATCAATTCCTAAAACTATTGCGCTACAAAGTAAATCAGATTTAGACTACATCGGATTGCCCTGTATTGTTAAGCCTTCAACGGGAACAGGGGGTAGTGTTTCTGTCTTTTTTGCTGTTAGTTTTGAAGAGGCTATGGTTTATGCTGAGTTTATTAAACGTAATGGAAGCGAGCCTATCGCTCAAGAATATATTGATATTAACGAGGGCGAATTTACGATTGGTGTTTTGTCTCTTCCCAACCAAAATGTTGTCGGTTCGATTGCTCTAAAGCGAGAATTGAGCGCCAAATTATCCGTTGCATACCGAGGCCGTGGTGGTATTATTTCTAGTGGCTACTCCCAAGGGTACATTGGTGAATATCCAGAATTGTGTAAGCAAGCGGAAGATATAGCTAAAGCACTCAATAGTGCTGGCCCTATTAATATCCAAGCAAGAGTCAGGAATGGAAAACTTATGCCATTTGAGATTAATCCACGATTTTCAGCATCAACATATCTTCGGGCTATGGCTGGTTTTAATGAAGTTGACATAATGCTTCGGTATTTAGCCTTGCAAATAGAACCTCAAAAACCGTTAATTCAGACTGGTTGGTATTTGCGTAGTTTAACTGAGCAGTATGTTTCAGAAGAGGCCTTAAGATGA

Protein

MNQRIKVMIAGIGGASLGTEICKSLKLAKIYDVFGCDISATAYGMYENDFLNTYQVSSSNYARNVLDVCVDAGVKWLIPGGEEPMKLLGQETKMFAAANIHVVANSPSLISICSNKKRTFNKLTELEISIPKTIALQSKSDLDYIGLPCIVKPSTGTGGSVSVFFAVSFEEAMVYAEFIKRNGSEPIAQEYIDINEGEFTIGVLSLPNQNVVGSIALKRELSAKLSVAYRGRGGIISSGYSQGYIGEYPELCKQAEDIAKALNSAGPINIQARVRNGKLMPFEINPRFSASTYLRAMAGFNEVDIMLRYLALQIEPQKPLIQTGWYLRSLTEQYVSEEALR