Your browser is old and dusty. Try Google Chrome!

Details for slr1614

ORF slr1614
Accession NP_440228.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -204 -190 -2.55701 0.296
NP_441418.1_6 Reverse -268 -287 -20.65 0.121
NP_442291.1_5 Reverse -267 -283 -3.57971 0.245
NP_441623.1_1 Reverse -142 -160 -3.91409 0.273
NP_441818.1_1 Forward -238 -227 12.2512 0.135
NP_440226.1_1 Reverse -268 -287 2.26107 0.271
NP_442752.1_4 Reverse -196 -203 6.52896 0.154
NP_442752.1_4 Reverse -201 -208 4.56234 0.265
NP_442752.1_4 Reverse -268 -275 4.26735 0.293
NP_443027.1_4 Reverse -266 -276 9.22315 0.172
NP_441745.1_3 Forward -274 -255 13.8633 0.282
NP_441812.1_3 Reverse -267 -281 7.57108 0.272
NP_442975.1_10 Reverse -344 -358 2.26061 0.28
NP_442062.1_8 Reverse -268 -278 7.25653 0.104
NP_442062.1_8 Reverse -201 -211 5.48657 0.168
NP_439918.1_3 Reverse -268 -287 4.12936 0.265
NP_441925.1_4 Forward -209 -190 -14.7509 0.263
NP_441083.1_5 Forward -277 -267 1.35667 0.209
NP_441083.1_5 Reverse -268 -278 -0.708283 0.276
NP_441738.1_2 Forward -208 -201 11.7401 0.0647
NP_440209.1_1 Forward -277 -269 5.0343 0.194
NP_442570.1_3 Reverse -115 -134 -7.86702 0.279
NP_441716.1_1 Forward -277 -263 10.9143 0.0936
NP_442111.1_4 Reverse -267 -281 5.70279 0.154
NP_440906.1_5 Forward -213 -206 5.64398 0.292
NP_440747.1_10 Reverse -265 -277 -12.0557 0.199
NP_440747.1_10 Forward -280 -268 -12.3507 0.27
NP_441634.1_8 Reverse -266 -280 0.294584 0.234
NP_440376.1_1 Reverse -268 -277 0.0980582 0.285
NP_440376.1_1 Forward -277 -268 -0.000272808 0.285
NP_442687.1_7 Forward -278 -268 4.99491 0.225
NP_442485.1_3 Reverse -266 -285 -3.3438 0.273
NP_440228.1_1 Forward -97 -78 32.7437 0.000077
NP_440228.1_2 Forward -133 -115 28.3385 0.000535
NP_440228.1_3 Forward -227 -208 31.8587 0.000188
NP_442530.1_2 Forward -261 -251 14.0414 0.219
NP_440571.1_5 Reverse -379 -398 17.699 0.221
NP_442782.1_2 Reverse -43 -57 0.294584 0.291
NP_442205.1_9 Reverse -195 -211 -2.39974 0.268
NP_441414.1_9 Forward -277 -258 -6.49039 0.196
NP_441256.1_1 Forward -202 -183 -8.45701 0.256
NP_441958.1_5 Reverse -200 -210 1.06167 0.116
NP_441958.1_5 Reverse -267 -277 -6.90313 0.293
NP_440950.1_8 Forward -44 -25 11.2747 0.206
NP_441712.1_1 Forward -400 -381 11.0671 0.251
NP_441000.1_6 Reverse -267 -281 1.86788 0.159
NP_440147.1_4 Forward -212 -199 0.60927 0.249
NP_441916.1_7 Forward -210 -200 6.8632 0.0816
NP_442396.1_5 Reverse -264 -277 8.08242 0.164
NP_442004.1_6 Forward -210 -196 5.70279 0.184
NP_439966.1_7 Forward -279 -269 5.87944 0.204
NP_442941.1_3 Forward -276 -266 0.57002 0.199
NP_442281.1_1 Forward -215 -201 1.67063 0.293
NP_441334.1_7 Forward -212 -193 -15.7335 0.275
NP_442012.1_1 Reverse -195 -214 -0.4922 0.259
NP_442068.1_4 Forward -54 -35 6.39016 0.232
NP_442933.1_10 Forward -277 -268 11.5045 0.042
NP_442933.1_10 Forward -210 -201 5.89959 0.16
NP_441751.2_8 Forward -276 -262 -5.70361 0.231
NP_441751.2_8 Forward -209 -195 -6.68692 0.277
NP_441762.1_7 Forward -211 -199 -6.45087 0.284
NP_442292.1_1 Forward -276 -267 -0.786921 0.287
NP_442016.1_8 Forward -145 -126 18.7807 0.24
NP_440421.1_1 Reverse -114 -128 15.2409 0.213
NP_441726.1_7 Reverse -8 -27 6.19431 0.248
NP_441715.1_4 Reverse -269 -279 9.12481 0.103
NP_440015.1_9 Forward -277 -259 1.29745 0.239
NP_441020.2_6 Reverse -199 -216 10.8552 0.133
NP_441673.1_1 Reverse -268 -277 1.37636 0.114
NP_441673.1_1 Forward -277 -268 1.1797 0.163
NP_441637.1_9 Forward -346 -328 -3.52077 0.296
NP_442808.1_1 Forward -278 -268 7.55106 0.0756
NP_440601.1_3 Forward -65 -46 15.0441 0.207
NP_441114.1_3 Forward -265 -256 8.35786 0.231
NP_441518.1_3 Forward -287 -268 -8.752 0.195
NP_441557.1_5 Reverse -268 -277 0.491382 0.144
NP_441557.1_5 Forward -277 -268 0.29472 0.174
NP_441557.1_5 Reverse -201 -210 -0.491928 0.193
NP_441445.1_1 Reverse -181 -200 -0.197208 0.286
NP_442066.2_4 Reverse -62 -81 -6.58872 0.253
NP_441433.1_8 Forward -198 -179 -4.03212 0.286
NP_441308.1_8 Forward -364 -354 8.4365 0.254
NP_440979.1_3 Forward -213 -195 10.9339 0.235
NP_442347.1_2 Forward -276 -267 14.5527 0.056
NP_441037.1_4 Reverse -199 -209 6.53804 0.255
NP_442738.1_8 Forward -151 -132 7.07928 0.205
NP_441633.1_3 Forward -279 -266 -6.47056 0.253
NP_442998.1_10 Forward -208 -201 6.0373 0.205
NP_442998.1_10 Forward -275 -268 5.93897 0.206
NP_440299.1_1 Reverse -264 -277 5.62358 0.169
NP_440256.1_1 Reverse -265 -284 -4.91709 0.169
NP_440087.1_1 Reverse -196 -215 -1.67217 0.197
NP_441229.1_10 Forward -220 -201 -4.6221 0.288
NP_442526.1_5 Reverse -27 -45 13.7847 0.275
NP_440709.1_1 Reverse -381 -400 2.16195 0.22
NP_442785.1_7 Forward -66 -52 14.2576 0.228
NP_441704.1_8 Reverse -138 -157 14.5516 0.0981
NP_442866.1_1 Reverse -266 -285 3.14605 0.151
NP_440537.1_7 Reverse -373 -392 10.8379 0.278
NP_441271.1_3 Forward -210 -192 12.998 0.186
NP_442240.1_2 Reverse -63 -82 -13.6686 0.171
NP_440586.1_8 Reverse -269 -276 12.6251 0.0546
NP_440586.1_8 Reverse -202 -209 11.0518 0.0967
NP_440586.1_8 Forward -45 -38 7.1186 0.272
NP_441262.1_3 Reverse -201 -208 5.34899 0.181
NP_443051.1_1 Reverse -200 -209 0.589713 0.143
NP_440439.1_1 Reverse -198 -211 4.14919 0.105
NP_440139.1_1 Reverse -199 -218 4.22689 0.189
NP_442887.1_5 Reverse -41 -60 -9.44032 0.264
NP_442384.1_10 Forward -277 -264 6.1158 0.11
NP_440163.1_10 Reverse -254 -264 8.33817 0.278
NP_441565.1_7 Forward -186 -167 14.4533 0.169
NP_440999.1_9 Forward -281 -267 0.88457 0.174
NP_440888.1_2 Forward -277 -263 6.78381 0.22
NP_442892.1_9 Reverse -54 -68 13.5686 0.293
NP_442948.1_2 Reverse -267 -286 10.9142 0.143
NP_441543.1_2 Reverse -269 -278 13.5694 0.0248
NP_442845.1_2 Reverse -190 -204 5.70279 0.225
NP_441319.1_8 Reverse -262 -280 11.4255 0.15
NP_442578.1_7 Reverse -269 -276 12.6255 0.0418
NP_442578.1_7 Forward -356 -349 6.62729 0.18
NP_442578.1_7 Reverse -202 -209 5.25066 0.251
NP_441462.1_2 Reverse -201 -211 0.766681 0.125
NP_443062.1_1 Forward -277 -259 7.47334 0.175
NP_440603.1_4 Reverse -137 -156 14.6508 0.145
NP_440673.1_3 Forward -275 -268 10.1672 0.149
NP_441052.1_2 Forward -277 -267 7.84651 0.0605
NP_441052.1_2 Reverse -268 -278 4.10993 0.166
NP_442219.1_9 Forward -276 -267 4.71961 0.198
NP_442219.1_9 Reverse -231 -240 2.458 0.27
NP_441719.1_4 Reverse -202 -209 4.07068 0.21
NP_441719.1_4 Reverse -269 -276 3.77569 0.285
NP_441004.1_1 Reverse -279 -298 -17.9951 0.296
NP_439949.1_7 Reverse -293 -307 10.7177 0.291
NP_442622.1_8 Reverse -268 -286 -18.9587 0.293
NP_441542.1_4 Reverse -42 -56 3.53951 0.272
NP_442515.1_1 Reverse -267 -281 -0.295402 0.217
NP_442515.1_1 Forward -49 -35 -2.06536 0.268
NP_441349.1_10 Reverse -258 -277 0.196116 0.0902
NP_441349.1_10 Reverse -52 -71 -9.63698 0.297
NP_442843.1_1 Forward -63 -44 -9.24366 0.264
NP_440431.1_4 Forward -43 -24 -5.87318 0.248
NP_441031.1_1 Forward -395 -376 8.46164 0.243
NP_439950.1_1 Reverse -295 -304 13.4711 0.277
NP_441570.1_1 Forward -277 -259 -17.4838 0.278
NP_441570.1_1 Reverse -268 -286 -17.8771 0.295
NP_441078.1_4 Reverse -268 -277 0.393051 0.205
NP_441078.1_4 Forward -277 -268 -0.000272808 0.205
NP_442443.1_1 Reverse -281 -300 -4.32711 0.271
NP_441432.1_8 Reverse -267 -276 4.22796 0.235
NP_441432.1_9 Forward -253 -240 12.1858 0.22
NP_439935.1_2 Reverse -114 -133 16.1257 0.153
NP_442489.1_7 Forward -277 -268 7.47288 0.0613
NP_442489.1_7 Reverse -268 -277 0.688044 0.152
NP_442489.1_7 Forward -210 -201 -1.96689 0.28
NP_440559.1_1 Reverse -202 -211 4.91628 0.175
NP_442346.1_5 Reverse -267 -277 4.20827 0.296
NP_440875.1_9 Forward -208 -198 10.7081 0.201
NP_442547.1_5 Forward -72 -53 17.3586 0.243
NP_441813.1_5 Forward -279 -269 -0.0199663 0.227
NP_440567.1_1 Forward -209 -195 16.8142 0.0165
NP_442497.1_10 Reverse -202 -211 -1.18024 0.256
NP_442897.1_3 Reverse -27 -46 13.7658 0.23
NP_441892.1_1 Forward -219 -202 1.71047 0.148
NP_441769.1_3 Reverse -381 -400 -7.76943 0.298
NP_442138.1_10 Reverse -268 -287 -6.39206 0.284
NP_441509.1_1 Reverse -29 -48 11.1109 0.216
NP_440462.1_6 Reverse -199 -209 6.76487 0.102
NP_440868.1_4 Forward -281 -269 8.49544 0.0602
NP_441474.1_1 Forward -287 -268 7.57013 0.212
NP_440812.1_10 Forward -360 -347 14.3756 0.259
NP_442402.1_4 Forward -60 -41 -4.52452 0.226
NP_442402.1_4 Forward -301 -282 -7.6711 0.278
NP_441084.1_6 Forward -169 -155 9.15021 0.292
NP_442837.1_3 Forward -276 -269 9.87221 0.106
NP_442053.1_1 Forward -277 -268 6.5879 0.124
NP_441701.1_3 Reverse -186 -203 8.69197 0.247
NP_441203.1_1 Reverse -206 -225 -14.7502 0.202
NP_442255.1_5 Reverse -38 -57 11.7008 0.227
NP_442532.1_4 Forward -40 -22 9.12842 0.273
NP_440914.1_1 Forward -239 -229 6.07773 0.297
NP_442533.1_6 Reverse -268 -277 4.91628 0.165
NP_439944.1_9 Forward -209 -199 5.48657 0.247
NP_441697.1_5 Forward -38 -19 -8.35597 0.258
NP_440816.1_7 Forward -218 -199 9.0459 0.258
NP_440115.1_6 Reverse -198 -208 6.76487 0.167
NP_439965.1_1 Reverse -259 -278 -4.91709 0.197
NP_441602.1_4 Forward -288 -269 12.2908 0.278
NP_440841.1_4 Forward -168 -149 -7.76869 0.245
NP_441463.1_3 Forward -287 -268 -8.55534 0.271
NP_442615.1_1 Reverse -192 -210 -6.76569 0.26
NP_442467.1_8 Forward -133 -114 18.4857 0.258
NP_441431.1_2 Reverse -198 -212 5.89884 0.284
NP_440114.1_10 Reverse -55 -69 8.25939 0.21
NP_440457.1_1 Reverse -197 -209 0.137309 0.25
NP_440457.1_1 Reverse -191 -203 -0.256015 0.259
NP_440457.1_1 Reverse -264 -276 -0.452677 0.263
NP_440213.1_5 Forward -151 -132 10.2259 0.247
NP_442439.1_8 Forward -53 -34 10.2259 0.246
NP_441885.1_5 Forward -277 -267 1.25834 0.11
NP_442703.1_9 Reverse -296 -314 13.6872 0.194
NP_443000.1_7 Reverse -266 -276 4.50326 0.188
NP_441842.1_10 Reverse -194 -208 6.6861 0.278
NP_442638.1_3 Forward -172 -153 11.6018 0.298
NP_440149.1_8 Forward -158 -139 -7.96535 0.296
NP_440216.1_1 Reverse -268 -282 -3.04867 0.0682
NP_442015.1_10 Forward -281 -268 -0.0790467 0.25
NP_440117.1_1 Forward -397 -378 -1.47551 0.258
NP_441111.1_7 Forward -209 -201 -0.668896 0.274
NP_442116.1_6 Forward -395 -378 5.87715 0.289
NP_440988.1_10 Reverse -188 -202 7.02871 0.224
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAGAAATATTCGTAAAATATGTTAGTCACCCGGATCAATATGATGCGGTAACTGAATTTATTGATGAGTTAACCTGTCTATAATCGTTTTTATTGCTAAATCCCGCATTTACTACACCAAGCCGTTGATCGCCATACAATGCCCATTATTAGTCGTTTTTTAGGAATCACAATCTGCATGTACTAGAATGATCGTTCGCCTCCCCACTACCATGCAAGATACGGTGAATATGAAATCATTGTCGAAATCGAAACAGGTGTAGTGAATGGGTCATTTCCAAAACGAGCATTACGTCATGTTTTAGAATGGCATGATTTACATCAACCCGAGTTAATAGCCAATTGGCAACTTTGTCGCCAACAAGAAGATCTAAAATTCATTCTTCCTTTGGAGTAAAGTT

CDS

ATGTTTTTACATGTTGTTTCTGCTTCTTACATGGATAACTACAAAATTAAGCTTCAATTTAATGATCATCGTACTGGAATTGTCGATCTAGTCGATAGTTTAAACGGCAAGATGTTTAGTCCATTGCAAGATCTGGTTTTGTTTCAACAATTTGGAGTTGATGCAGAATTGGGAACAGTTTGTTGGTCAAATGGTGCTGACTTTGCGCCTGAATATCTGTATTTTCTCGCATTTCGTGATCTTCCTGAATTGAAGGAACAGTTTGAAAAATGGGGGTATTTGCGAGCTAAAGTTGCCGTTAGTTGA

Protein

MFLHVVSASYMDNYKIKLQFNDHRTGIVDLVDSLNGKMFSPLQDLVLFQQFGVDAELGTVCWSNGADFAPEYLYFLAFRDLPELKEQFEKWGYLRAKVAVS