Your browser is old and dusty. Try Google Chrome!

Details for slr1611

ORF slr1611
Accession NP_440225.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -91 -77 13.8643 0.164
NP_441061.1_2 Reverse -165 -179 1.96621 0.179
NP_440795.1_7 Forward -172 -165 14.6904 0.0123
NP_440795.1_7 Reverse -165 -172 14.6904 0.0123
NP_440795.1_7 Reverse -60 -67 13.1171 0.0477
NP_441418.1_6 Reverse -164 -183 -10.1286 0.0319
NP_441418.1_6 Forward -335 -316 -28.9099 0.213
NP_440897.1_6 Reverse -164 -183 3.63691 0.143
NP_441453.1_4 Reverse -164 -172 16.539 0.00633
NP_441453.1_4 Forward -173 -165 16.539 0.00633
NP_442151.1_6 Reverse -59 -73 12.7826 0.0674
NP_442151.1_6 Reverse -164 -178 10.816 0.114
NP_442151.1_6 Forward -173 -159 7.66941 0.192
NP_441818.1_1 Reverse -165 -176 9.69459 0.232
NP_441818.1_9 Forward -322 -303 -4.03212 0.234
NP_440226.1_1 Forward -173 -154 3.44104 0.225
NP_441465.1_8 Forward -184 -166 20.472 0.0785
NP_442744.1_8 Forward -173 -154 2.0644 0.203
NP_442173.1_1 Forward -172 -164 15.4574 0.00633
NP_442173.1_1 Reverse -165 -173 15.4574 0.00633
NP_442752.1_4 Forward -173 -166 13.8055 0.0199
NP_442752.1_4 Reverse -164 -171 13.8055 0.0199
NP_443027.1_4 Forward -175 -165 14.828 0.0437
NP_443027.1_4 Reverse -162 -172 5.87989 0.294
NP_441812.1_3 Forward -136 -122 10.521 0.222
NP_442975.1_10 Forward -177 -163 14.1586 0.0459
NP_442975.1_10 Reverse -160 -174 2.06395 0.284
NP_440784.1_7 Forward -172 -165 15.9687 0.0123
NP_440784.1_7 Reverse -165 -172 15.9687 0.0123
NP_440061.1_9 Forward -371 -357 4.91554 0.3
NP_442074.1_3 Forward -266 -253 15.85 0.285
NP_439979.1_9 Forward -334 -316 8.37728 0.263
NP_440878.1_9 Reverse -154 -173 4.03102 0.174
NP_440878.1_9 Reverse -289 -308 -2.36049 0.26
NP_442062.1_8 Forward -173 -163 19.4496 0.000558
NP_442062.1_8 Reverse -164 -174 19.4496 0.000558
NP_440761.1_4 Reverse -159 -178 -12.7836 0.257
NP_440304.1_4 Forward -175 -165 10.8948 0.051
NP_440304.1_4 Reverse -162 -172 1.84832 0.299
NP_440304.1_4 Forward -77 -67 1.84832 0.299
NP_442242.1_4 Forward -172 -165 14.3954 0.0124
NP_442242.1_4 Reverse -165 -172 14.3954 0.0124
NP_440044.1_8 Reverse -165 -184 3.44104 0.13
NP_441352.1_2 Forward -333 -314 -0.590531 0.299
NP_441208.1_9 Reverse -5 -19 8.65272 0.219
NP_441594.1_6 Forward -182 -163 2.65439 0.247
NP_441594.1_6 Forward -389 -370 1.0811 0.274
NP_440370.1_10 Forward -182 -163 7.07928 0.268
NP_441546.1_1 Forward -101 -88 17.9155 0.201
NP_442375.1_8 Forward -325 -307 17.3254 0.19
NP_442110.1_7 Reverse -164 -178 11.701 0.0593
NP_441925.1_4 Reverse -307 -326 -7.3761 0.194
NP_441925.1_4 Reverse -313 -332 -14.7509 0.263
NP_441925.1_4 Forward -172 -153 -17.0125 0.287
NP_441083.1_5 Forward -173 -163 11.3864 0.0159
NP_441083.1_5 Reverse -164 -174 11.3864 0.0159
NP_441738.1_2 Forward -171 -164 15.28 0.0102
NP_441738.1_2 Reverse -166 -173 15.28 0.0102
NP_440209.1_1 Reverse -164 -172 18.1123 0.00295
NP_440209.1_1 Forward -173 -165 18.1123 0.00295
NP_442889.1_8 Forward -176 -162 13.1753 0.0588
NP_442889.1_8 Reverse -161 -175 9.73373 0.0945
NP_440407.1_6 Forward -102 -88 12.586 0.262
NP_440447.1_1 Forward -178 -160 6.70565 0.194
NP_441713.1_1 Reverse -158 -177 -13.4719 0.257
NP_442111.1_3 Reverse -130 -143 13.1442 0.262
NP_441495.1_2 Forward -326 -307 15.5357 0.153
NP_440906.1_5 Forward -172 -165 15.8704 0.0124
NP_440906.1_5 Reverse -165 -172 15.8704 0.0124
NP_440747.1_10 Reverse -161 -173 5.34885 0.0141
NP_440747.1_10 Forward -176 -164 -2.02597 0.0196
NP_441486.1_1 Forward -176 -162 21.2391 0.00239
NP_441486.1_1 Reverse -161 -175 10.3243 0.0209
NP_441486.1_1 Reverse -56 -70 -5.90027 0.266
NP_440403.1_4 Forward -182 -163 -3.93378 0.203
NP_440057.1_6 Forward -379 -360 10.5039 0.29
NP_441014.1_10 Reverse -163 -182 -2.26292 0.274
NP_442848.1_1 Reverse -53 -67 1.47456 0.227
NP_442848.1_1 Forward -179 -165 -2.55701 0.263
NP_443018.1_3 Forward -172 -165 14.8871 0.0123
NP_443018.1_3 Reverse -165 -172 14.8871 0.0123
NP_441316.1_7 Forward -175 -160 3.42148 0.141
NP_441634.1_8 Reverse -162 -176 -4.4253 0.295
NP_440376.1_1 Forward -173 -164 19.4693 0.000692
NP_440376.1_1 Reverse -164 -173 19.4693 0.000692
NP_441857.1_5 Forward -180 -162 1.39578 0.297
NP_441588.1_4 Forward -171 -161 14.238 0.0773
NP_441588.1_4 Reverse -166 -176 6.96153 0.178
NP_442687.1_7 Forward -174 -164 15.8113 0.0125
NP_442687.1_7 Reverse -163 -173 15.8113 0.0125
NP_440066.1_5 Reverse -301 -320 8.16011 0.256
NP_442485.1_3 Reverse -315 -334 -3.63879 0.277
NP_442485.1_3 Forward -184 -165 -4.13045 0.278
NP_441846.1_10 Forward -89 -70 -12.1936 0.19
NP_441846.1_10 Forward -98 -79 -20.8467 0.256
NP_441846.1_10 Forward -342 -323 -22.0267 0.257
NP_441846.1_10 Forward -326 -307 -22.715 0.264
NP_442530.1_2 Reverse -24 -34 12.0747 0.281
NP_440642.1_10 Reverse -13 -27 7.27547 0.221
NP_440642.1_10 Reverse -291 -305 1.27731 0.296
NP_441763.1_10 Reverse -121 -140 13.6666 0.121
NP_440360.1_10 Reverse -68 -82 2.75286 0.261
NP_442658.1_1 Reverse -162 -172 15.9091 0.00966
NP_442658.1_1 Forward -175 -165 15.9091 0.00966
NP_442198.1_3 Reverse -155 -174 5.30933 0.259
NP_442782.1_2 Forward -332 -318 11.701 0.173
NP_442205.1_9 Forward -332 -316 -3.57971 0.287
NP_441414.1_9 Forward -173 -154 5.50599 0.0471
NP_440720.1_1 Reverse -153 -172 5.01433 0.253
NP_442321.1_1 Forward -115 -96 2.26107 0.148
NP_441317.1_4 Forward -151 -137 11.8512 0.244
NP_441958.1_5 Forward -174 -164 12.2714 0.00183
NP_441958.1_5 Reverse -163 -173 12.2714 0.00183
NP_439905.1_1 Forward -172 -159 8.57408 0.232
NP_440984.1_7 Reverse -295 -309 15.1426 0.0604
NP_440984.1_7 Reverse -159 -173 11.2093 0.122
NP_439990.1_5 Reverse -159 -172 7.6891 0.186
NP_442911.1_2 Reverse -154 -173 -2.45882 0.0982
NP_441580.1_6 Forward -184 -165 11.5042 0.0538
NP_440153.1_5 Reverse -165 -179 1.67122 0.245
NP_440153.1_8 Reverse -299 -312 -3.61896 0.296
NP_442064.1_1 Reverse -159 -178 -2.75381 0.146
NP_440993.1_2 Forward -178 -162 1.5335 0.279
NP_440602.1_8 Reverse -164 -178 9.5377 0.298
NP_442002.1_9 Forward -76 -69 11.3472 0.185
NP_442002.1_9 Forward -174 -167 10.7572 0.185
NP_442002.1_9 Reverse -163 -170 10.7572 0.185
NP_440809.1_9 Reverse -367 -385 -6.76569 0.225
NP_440475.1_1 Reverse -293 -312 10.0981 0.294
NP_441294.1_7 Forward -170 -156 12.6102 0.0916
NP_441294.1_7 Forward -72 -58 9.82656 0.223
NP_441294.1_7 Reverse -313 -327 8.48272 0.298
NP_442438.1_10 Forward -178 -164 16.5192 0.0212
NP_442438.1_10 Forward -121 -107 8.35772 0.0782
NP_442438.1_10 Reverse -54 -68 4.22782 0.15
NP_442885.1_4 Forward -290 -277 14.5663 0.294
NP_441000.1_6 Reverse -163 -177 4.81781 0.0933
NP_441000.1_6 Reverse -306 -320 0.88457 0.185
NP_441000.1_6 Forward -174 -160 -3.93365 0.225
NP_441674.1_2 Reverse -301 -320 5.80098 0.297
NP_440147.1_4 Reverse -162 -175 11.3273 0.0326
NP_440147.1_4 Forward -175 -162 2.18257 0.209
NP_441550.1_8 Reverse -162 -172 8.3377 0.124
NP_441550.1_8 Forward -175 -165 6.0761 0.214
NP_441916.1_7 Forward -173 -163 18.4663 0.00144
NP_441916.1_7 Reverse -164 -174 18.4663 0.00144
NP_440465.1_4 Reverse -163 -182 11.7992 0.217
NP_441041.1_4 Reverse -164 -183 5.40766 0.0512
NP_441041.1_7 Forward -176 -164 10.916 0.0864
NP_441041.1_7 Reverse -161 -173 9.55551 0.109
NP_442396.1_5 Reverse -160 -173 18.8988 0.0167
NP_441725.1_5 Reverse -165 -175 11.2881 0.0247
NP_441725.1_5 Forward -172 -162 2.04498 0.115
NP_439966.1_7 Forward -175 -165 18.4657 0.00473
NP_439966.1_7 Reverse -162 -172 9.91099 0.0968
NP_439966.1_9 Forward -175 -166 0.983037 0.253
NP_439966.1_9 Reverse -162 -171 0.884706 0.253
NP_442941.1_3 Reverse -165 -175 11.4848 0.0116
NP_442941.1_3 Forward -172 -162 2.63497 0.14
NP_440289.1_2 Forward -176 -163 14.6706 0.0107
NP_440289.1_2 Reverse -161 -174 -3.61896 0.267
NP_442281.1_1 Forward -178 -164 19.6651 0.00247
NP_442281.1_1 Reverse -159 -173 3.04726 0.246
NP_440437.1_1 Forward -179 -160 -0.590531 0.183
NP_442012.1_2 Forward -394 -375 2.85105 0.239
NP_441644.1_6 Forward -173 -163 10.1076 0.0628
NP_441644.1_6 Reverse -164 -174 10.1076 0.0628
NP_441644.1_6 Reverse -317 -327 4.50281 0.235
NP_442215.1_2 Reverse -162 -178 17.6598 0.0139
NP_442215.1_2 Forward -70 -54 -5.05468 0.244
NP_442029.1_1 Forward -334 -315 -18.5851 0.274
NP_440253.1_2 Forward -205 -187 5.13236 0.098
NP_440929.1_8 Forward -173 -164 19.2726 0.000701
NP_440929.1_8 Reverse -164 -173 19.2726 0.000701
NP_442933.1_10 Forward -173 -164 17.601 0.00325
NP_442933.1_10 Reverse -164 -173 17.601 0.00325
NP_442554.1_8 Reverse -165 -175 13.8447 0.0145
NP_442554.1_8 Forward -172 -162 13.2547 0.0187
NP_441762.1_7 Forward -174 -162 19.3118 0.00342
NP_441762.1_7 Reverse -163 -175 12.0354 0.0142
NP_442142.1_4 Forward -176 -163 18.4065 0.0255
NP_442142.1_4 Reverse -161 -174 7.19687 0.144
NP_442142.1_4 Reverse -320 -333 3.16532 0.265
NP_442292.1_1 Forward -172 -163 9.63616 0.0183
NP_442292.1_1 Reverse -165 -174 9.63616 0.0183
NP_442476.1_6 Forward -172 -158 5.99778 0.13
NP_442381.1_8 Forward -176 -157 -14.0619 0.28
NP_443009.1_5 Reverse -163 -174 11.6612 0.0602
NP_443009.1_5 Forward -174 -163 11.6612 0.0602
NP_442301.1_2 Reverse -313 -332 17.8948 0.0906
NP_441715.1_4 Reverse -165 -175 16.303 0.0117
NP_441715.1_4 Forward -172 -162 9.41981 0.097
NP_441448.1_1 Reverse -171 -190 4.03102 0.28
NP_441468.1_1 Forward -172 -165 15.8704 0.0124
NP_441468.1_1 Reverse -165 -172 15.8704 0.0124
NP_441020.2_6 Reverse -162 -179 6.82368 0.251
NP_441015.1_10 Forward -334 -315 -0.787193 0.169
NP_441015.1_10 Forward -91 -72 -9.73531 0.282
NP_441015.1_10 Forward -325 -306 -10.9153 0.289
NP_441673.1_1 Forward -173 -164 20.8459 0.000698
NP_441673.1_1 Reverse -164 -173 20.8459 0.000698
NP_441876.1_9 Reverse -264 -274 15.4175 0.267
NP_441826.1_2 Forward -179 -165 13.6676 0.0214
NP_441637.1_9 Forward -150 -132 8.57394 0.223
NP_442868.1_6 Forward -175 -165 0.963343 0.205
NP_442868.1_6 Reverse -162 -172 0.865012 0.205
NP_442719.1_2 Forward -71 -53 -3.81647 0.203
NP_442719.1_2 Reverse -293 -311 -7.06138 0.232
NP_442719.1_2 Forward -150 -132 -11.5846 0.292
NP_441612.1_2 Forward -166 -156 6.70984 0.277
NP_442227.1_2 Reverse -316 -335 2.16274 0.238
NP_442227.1_2 Reverse -319 -338 -1.7705 0.266
NP_442361.1_3 Forward -179 -166 9.75405 0.272
NP_442808.1_1 Forward -174 -164 18.4657 0.00201
NP_442808.1_1 Reverse -163 -173 18.4657 0.00201
NP_442808.1_1 Reverse -87 -97 5.78111 0.141
NP_442808.1_1 Forward -181 -171 4.01116 0.212
NP_442808.1_1 Reverse -322 -332 2.92952 0.252
NP_442542.1_9 Forward -180 -166 11.1104 0.111
NP_442113.1_10 Reverse -313 -332 -5.99873 0.254
NP_442505.1_2 Reverse -363 -382 11.5187 0.259
NP_442050.1_1 Forward -333 -314 9.24257 0.247
NP_442050.1_5 Forward -175 -165 9.12434 0.193
NP_442576.1_9 Reverse -127 -141 18.4416 0.142
NP_440923.1_9 Forward -317 -298 9.73422 0.241
NP_441878.1_6 Forward -174 -164 10.4031 0.0176
NP_441878.1_6 Reverse -163 -173 10.4031 0.0176
NP_441878.1_6 Forward -327 -317 -7.19813 0.21
NP_441036.1_7 Forward -301 -291 15.8108 0.292
NP_441036.1_8 Forward -174 -164 17.7779 0.000554
NP_441036.1_8 Reverse -163 -173 17.7779 0.000554
NP_441036.1_9 Reverse -366 -384 2.96908 0.29
NP_441557.1_5 Forward -173 -164 19.9609 0.000699
NP_441557.1_5 Reverse -164 -173 19.9609 0.000699
NP_441557.1_8 Reverse -324 -334 10.8943 0.273
NP_441445.1_1 Forward -182 -163 2.94938 0.224
NP_442066.2_4 Reverse -164 -183 8.06259 0.0828
NP_442066.2_9 Reverse -160 -173 11.4257 0.154
NP_441308.1_8 Forward -175 -165 10.1081 0.22
NP_440101.1_3 Reverse -159 -178 2.0644 0.259
NP_441564.1_10 Forward -169 -150 17.404 0.0598
NP_442183.1_1 Reverse -164 -178 11.996 0.0648
NP_442183.1_1 Forward -173 -159 5.1128 0.231
NP_442444.1_6 Forward -334 -316 19.4981 0.112
NP_442347.1_2 Forward -172 -163 11.1111 0.056
NP_442347.1_2 Reverse -165 -174 11.1111 0.056
NP_442347.1_2 Forward -67 -58 2.94966 0.292
NP_441037.1_4 Reverse -162 -172 14.7245 0.028
NP_441037.1_4 Forward -175 -165 7.02532 0.237
NP_442594.1_8 Forward -99 -80 1.96607 0.295
NP_441633.1_3 Reverse -162 -175 10.7374 0.0286
NP_441633.1_3 Forward -175 -162 3.65753 0.0699
NP_440136.1_2 Forward -172 -165 15.9687 0.0123
NP_440136.1_2 Reverse -165 -172 15.9687 0.0123
NP_442590.1_10 Forward -110 -91 4.32602 0.276
NP_442998.1_5 Reverse -141 -151 9.41981 0.241
NP_442998.1_10 Forward -171 -164 15.5754 0.0102
NP_442998.1_10 Reverse -166 -173 15.5754 0.0102
NP_442998.1_10 Forward -195 -188 7.21728 0.144
NP_440299.1_1 Forward -177 -164 11.9167 0.0427
NP_440299.1_1 Reverse -160 -173 10.8351 0.0529
NP_441799.1_1 Reverse -160 -174 17.1085 0.0121
NP_441799.1_1 Forward -177 -163 4.71887 0.238
NP_442201.1_10 Reverse -153 -172 -11.3086 0.267
NP_442333.2_5 Forward -184 -165 -12.8819 0.249
NP_440256.1_1 Reverse -161 -180 9.53756 0.0203
NP_442007.1_10 Reverse -234 -253 20.0581 0.162
NP_441559.1_8 Forward -178 -164 -6.29359 0.276
NP_441559.1_8 Reverse -159 -173 -6.49025 0.279
NP_441559.1_8 Reverse -328 -342 -6.98191 0.281
NP_440915.1_5 Forward -325 -306 14.2263 0.283
NP_440915.1_6 Forward -177 -163 6.3911 0.0826
NP_440329.1_4 Forward -358 -344 19.7913 0.217
NP_442866.1_1 Reverse -159 -178 -5.60541 0.243
NP_441464.1_8 Forward -173 -159 3.63784 0.291
NP_441939.1_4 Forward -219 -200 18.4773 0.137
NP_442993.1_1 Forward -173 -157 0.156866 0.0653
NP_442993.1_1 Reverse -164 -180 -7.21796 0.146
NP_442386.1_9 Reverse -163 -172 15.7322 0.0144
NP_442386.1_9 Forward -174 -165 15.7322 0.0144
NP_441750.1_1 Forward -335 -316 -11.6036 0.3
NP_441340.1_5 Forward -172 -165 15.6737 0.0124
NP_441340.1_5 Reverse -165 -172 15.6737 0.0124
NP_442327.1_3 Forward -60 -41 4.91741 0.283
NP_441947.1_4 Forward -184 -165 17.5024 0.0861
NP_442791.1_5 Forward -334 -315 -4.81876 0.279
NP_442791.1_5 Forward -181 -162 -11.4069 0.29
NP_440161.1_3 Forward -175 -156 13.8641 0.13
NP_442714.1_7 Forward -172 -153 -1.7705 0.292
NP_440586.1_8 Forward -172 -165 13.2151 0.026
NP_440586.1_8 Reverse -165 -172 13.2151 0.026
NP_442251.1_6 Forward -172 -165 15.2804 0.0124
NP_442251.1_6 Reverse -165 -172 15.2804 0.0124
NP_441262.1_3 Reverse -164 -171 14.7888 0.0223
NP_441262.1_3 Forward -173 -166 14.7888 0.0223
NP_440027.1_3 Reverse -307 -325 7.58986 0.208
NP_443051.1_1 Reverse -163 -172 10.4228 0.00754
NP_443051.1_1 Forward -174 -165 10.4228 0.00754
NP_439984.1_1 Forward -49 -30 12.8009 0.236
NP_439937.1_8 Forward -334 -315 7.07928 0.191
NP_439937.1_9 Forward -174 -157 -8.51661 0.176
NP_439937.1_9 Reverse -163 -180 -10.2866 0.227
NP_440439.1_1 Forward -176 -163 8.37742 0.0537
NP_440439.1_1 Reverse -161 -174 1.29759 0.157
NP_442239.1_8 Forward -333 -314 7.57094 0.255
NP_440372.1_2 Forward -172 -165 16.3621 0.0124
NP_440372.1_2 Reverse -165 -172 16.3621 0.0124
NP_441138.1_5 Forward -149 -136 12.3802 0.17
NP_440819.1_5 Reverse -202 -210 7.8859 0.266
NP_440316.1_10 Forward -98 -88 8.1415 0.24
NP_440316.1_10 Forward -317 -307 5.38824 0.299
NP_441803.1_2 Reverse -159 -178 0.0977854 0.26
NP_441803.1_2 Forward -178 -159 -1.08219 0.294
NP_439977.1_5 Reverse -158 -177 4.916 0.15
NP_439977.1_8 Reverse -372 -391 16.852 0.196
NP_440139.1_1 Forward -179 -160 5.50519 0.159
NP_441572.1_7 Forward -179 -160 5.89931 0.0856
NP_442384.1_10 Forward -173 -160 14.1789 0.0163
NP_442384.1_10 Reverse -164 -177 8.37742 0.0656
NP_440699.1_1 Reverse -32 -51 1.4797 0.291
NP_441018.1_7 Reverse -160 -179 14.0608 0.13
NP_441018.1_10 Reverse -74 -93 17.2065 0.236
NP_442790.1_4 Reverse -155 -174 -5.99873 0.144
NP_442262.1_10 Forward -172 -165 14.1988 0.0123
NP_442262.1_10 Reverse -165 -172 14.1988 0.0123
NP_441689.1_5 Forward -175 -165 8.53436 0.132
NP_441689.1_5 Forward -371 -361 4.89613 0.286
NP_440163.1_10 Forward -176 -166 15.2213 0.0762
NP_440344.1_10 Forward -180 -163 19.41 0.00206
NP_440344.1_10 Reverse -157 -174 -0.649475 0.0444
NP_440531.1_6 Forward -181 -162 15.1424 0.0375
NP_442910.1_1 Forward -180 -161 -7.27704 0.254
NP_441335.1_8 Forward -108 -89 10.6192 0.204
NP_441335.1_8 Forward -100 -81 5.99764 0.299
NP_441965.1_10 Forward -176 -160 10.4816 0.107
NP_440297.1_9 Reverse -165 -175 9.32148 0.0917
NP_440297.1_9 Forward -172 -162 -0.118297 0.282
NP_440350.1_1 Forward -328 -309 2.94938 0.21
NP_442280.1_10 Forward -145 -127 16.7529 0.0984
NP_441896.1_3 Reverse -155 -174 -3.14714 0.297
NP_440894.1_10 Reverse -159 -178 16.8141 0.0683
NP_442129.1_6 Reverse -125 -144 13.6556 0.262
NP_440999.1_9 Forward -177 -163 5.1128 0.113
NP_440999.1_9 Reverse -313 -327 -2.65535 0.273
NP_440888.1_2 Reverse -164 -178 19.8618 0.000937
NP_440888.1_2 Forward -173 -159 7.17714 0.205
NP_440803.1_10 Forward -335 -316 17.404 0.18
NP_440491.1_1 Forward -326 -307 9.15853 0.219
NP_442807.1_10 Forward -50 -36 20.4524 0.138
NP_440105.1_3 Reverse -305 -319 17.9935 0.245
NP_441543.1_2 Forward -172 -163 18.486 0.00236
NP_441543.1_2 Reverse -165 -174 18.486 0.00236
NP_442845.1_2 Forward -316 -302 4.71948 0.254
NP_442845.1_2 Forward -179 -165 4.62115 0.256
NP_442845.1_2 Reverse -158 -172 4.22782 0.264
NP_441178.1_6 Reverse -85 -104 10.0284 0.234
NP_441469.1_8 Reverse -163 -172 16.126 0.00797
NP_441469.1_8 Forward -174 -165 16.126 0.00797
NP_442578.1_7 Forward -172 -165 14.5921 0.026
NP_442578.1_7 Reverse -165 -172 14.5921 0.026
NP_442578.1_7 Reverse -60 -67 9.87221 0.122
NP_441462.1_2 Forward -173 -163 11.5831 0.00406
NP_441462.1_2 Reverse -164 -174 11.5831 0.00406
NP_441462.1_2 Reverse -317 -327 -0.806614 0.254
NP_441621.1_7 Forward -175 -161 -3.54032 0.19
NP_441621.1_7 Reverse -162 -176 -3.83532 0.195
NP_443062.1_1 Reverse -164 -182 10.8861 0.108
NP_443062.1_6 Reverse -146 -165 0.687771 0.291
NP_443062.1_6 Reverse -156 -175 0.58944 0.292
NP_442204.1_1 Forward -177 -166 0.353664 0.281
NP_442204.1_5 Forward -183 -164 10.7175 0.0866
NP_442204.1_5 Reverse -154 -173 9.83255 0.0977
NP_440516.1_2 Reverse -158 -176 -1.84914 0.292
NP_440516.1_8 Forward -173 -164 16.9127 0.00442
NP_440516.1_8 Reverse -164 -173 16.9127 0.00442
NP_441785.1_1 Reverse -293 -307 12.8353 0.24
NP_441033.1_2 Reverse -250 -269 -5.40875 0.293
NP_442428.1_5 Forward -172 -165 15.8704 0.0124
NP_442428.1_5 Reverse -165 -172 15.8704 0.0124
NP_440673.1_2 Forward -183 -164 15.1696 0.0942
NP_440673.1_3 Forward -171 -164 12.4288 0.0426
NP_440673.1_3 Reverse -166 -173 12.4288 0.0426
NP_441052.1_2 Forward -173 -163 10.5014 0.0285
NP_441052.1_2 Reverse -164 -174 10.5014 0.0285
NP_442219.1_9 Forward -172 -163 8.35786 0.0681
NP_442219.1_9 Reverse -165 -174 8.35786 0.0681
NP_440436.1_4 Forward -172 -163 18.1905 0.00233
NP_440436.1_4 Reverse -165 -174 18.1905 0.00233
NP_441884.1_9 Reverse -161 -180 -23.01 0.284
NP_440314.1_9 Forward -172 -153 12.5858 0.0261
NP_441719.1_4 Forward -172 -165 16.3621 0.0124
NP_441719.1_4 Reverse -165 -172 16.3621 0.0124
NP_441719.1_6 Reverse -297 -316 7.66846 0.269
NP_441733.1_10 Forward -176 -163 10.2457 0.106
NP_441733.1_10 Reverse -161 -174 7.39411 0.153
NP_441004.1_1 Forward -338 -319 -18.1918 0.298
NP_441004.1_4 Forward -311 -301 9.41981 0.259
NP_441004.1_5 Forward -273 -259 7.07942 0.292
NP_442813.1_4 Reverse -327 -346 -3.14714 0.289
NP_442813.1_4 Reverse -149 -168 -5.9004 0.299
NP_442366.1_3 Reverse -163 -181 -0.0791831 0.183
NP_442366.1_3 Forward -174 -156 -0.7675 0.199
NP_442366.1_5 Reverse -161 -171 13.3526 0.0775
NP_441115.1_4 Reverse -163 -181 11.1298 0.151
NP_441115.1_4 Forward -174 -156 10.5398 0.173
NP_443054.1_2 Forward -175 -161 11.3077 0.0761
NP_443054.1_2 Reverse -162 -176 3.53951 0.24
NP_443054.1_2 Forward -328 -314 1.08123 0.251
NP_441851.1_10 Forward -174 -164 16.008 0.00552
NP_441851.1_10 Reverse -163 -173 16.008 0.00552
NP_441542.1_4 Reverse -176 -190 6.48943 0.262
NP_442011.1_1 Forward -174 -155 -2.26216 0.272
NP_441668.1_4 Forward -89 -70 -1.37718 0.273
NP_442515.1_1 Forward -174 -160 -2.06536 0.268
NP_441683.1_7 Forward -35 -16 -5.99873 0.264
NP_441683.1_7 Forward -88 -69 -10.7186 0.284
NP_441982.1_6 Forward -168 -159 11.4349 0.288
NP_442709.1_3 Reverse -136 -155 4.71934 0.233
NP_441046.1_2 Forward -331 -312 1.17943 0.26
NP_441349.1_10 Reverse -154 -173 -1.08219 0.0988
NP_441349.1_10 Forward -183 -164 -7.76869 0.258
NP_441409.1_6 Reverse -158 -177 -14.7502 0.266
NP_440432.1_9 Reverse -165 -180 -2.77337 0.175
NP_442843.1_1 Forward -96 -77 -0.197208 0.181
NP_442843.1_1 Forward -325 -306 -1.57384 0.199
NP_440474.1_8 Reverse -165 -179 5.89884 0.237
NP_440474.1_8 Forward -172 -158 5.40719 0.25
NP_442450.1_5 Forward -175 -165 9.32148 0.115
NP_442450.1_5 Reverse -162 -172 7.55152 0.13
NP_440588.1_2 Reverse -155 -174 6.58763 0.0543
NP_441031.1_8 Forward -337 -318 -3.93378 0.248
NP_441570.1_1 Reverse -164 -182 9.85225 0.00993
NP_441078.1_4 Forward -173 -164 19.6659 0.0007
NP_441078.1_4 Reverse -164 -173 19.6659 0.0007
NP_441078.1_4 Forward -326 -317 -1.86856 0.272
NP_442729.1_8 Reverse -160 -173 10.344 0.125
NP_442729.1_8 Forward -177 -164 8.18076 0.125
NP_441663.1_8 Forward -400 -381 0.687771 0.215
NP_442443.1_1 Forward -334 -315 -5.01543 0.28
NP_442443.1_2 Reverse -299 -318 14.2574 0.174
NP_440526.1_3 Reverse -165 -176 1.92649 0.267
NP_441432.1_8 Reverse -163 -172 8.25953 0.0755
NP_441432.1_8 Forward -174 -165 8.25953 0.0755
NP_442320.1_8 Forward -179 -165 23.009 0.0038
NP_442320.1_8 Reverse -158 -172 -1.08205 0.0817
NP_441732.1_2 Forward -177 -161 -16.1661 0.165
NP_442003.1_4 Forward -325 -306 18.0924 0.141
NP_442003.1_4 Reverse -301 -320 9.3409 0.3
NP_440760.1_1 Forward -173 -154 -22.125 0.249
NP_440199.1_10 Forward -176 -166 14.533 0.0861
NP_442489.1_7 Forward -173 -164 20.1576 0.000695
NP_442489.1_7 Reverse -164 -173 20.1576 0.000695
NP_442489.1_7 Forward -326 -317 -1.37691 0.195
NP_440559.1_1 Reverse -165 -174 8.75118 0.0586
NP_440559.1_1 Forward -172 -163 8.75118 0.0586
NP_441659.2_8 Forward -173 -163 11.9764 0.0147
NP_441659.2_8 Reverse -164 -174 11.9764 0.0147
NP_441659.2_8 Reverse -317 -327 6.17489 0.084
NP_442913.1_10 Forward -77 -58 2.3594 0.126
NP_441040.1_2 Reverse -291 -310 2.0644 0.119
NP_442346.1_5 Forward -174 -164 9.02648 0.118
NP_442346.1_5 Reverse -163 -173 9.02648 0.118
NP_442346.1_5 Reverse -103 -113 6.8632 0.188
NP_441856.1_3 Forward -176 -157 -0.688862 0.225
NP_441629.1_3 Reverse -307 -326 0.0970122 0.236
NP_440459.1_2 Forward -182 -165 11.0519 0.183
NP_440459.1_2 Reverse -162 -179 10.1669 0.207
NP_440847.1_3 Reverse -322 -336 15.2402 0.18
NP_441888.1_7 Forward -178 -164 2.5562 0.225
NP_441948.1_4 Forward -180 -162 -2.0458 0.158
NP_441047.1_2 Forward -178 -159 6.68596 0.193
NP_440170.1_5 Forward -183 -164 10.6192 0.134
NP_441833.1_4 Forward -172 -165 15.9687 0.0124
NP_441833.1_4 Reverse -165 -172 15.9687 0.0124
NP_441112.1_6 Forward -183 -164 -0.885524 0.295
NP_442162.1_9 Forward -172 -165 16.2637 0.0124
NP_442162.1_9 Reverse -165 -172 16.2637 0.0124
NP_440671.1_4 Forward -179 -165 17.5025 0.0199
NP_440224.1_1 Forward -184 -165 10.1275 0.0569
NP_442546.1_5 Reverse -166 -185 24.3855 0.0225
NP_442140.1_3 Forward -172 -162 16.2046 0.0255
NP_442140.1_3 Reverse -165 -175 8.33817 0.119
NP_442723.1_1 Reverse -313 -332 2.35861 0.291
NP_442914.1_8 Forward -331 -312 8.06259 0.237
NP_441609.1_5 Forward -152 -133 8.94757 0.279
NP_440875.1_9 Reverse -166 -176 8.37203 0.233
NP_441813.1_5 Forward -175 -165 17.188 0.00979
NP_441813.1_5 Reverse -162 -172 9.91146 0.021
NP_440594.1_10 Forward -154 -140 17.1085 0.263
NP_441259.1_8 Reverse -167 -186 15.3382 0.226
NP_440590.1_4 Reverse -165 -178 13.0973 0.013
NP_440590.1_4 Forward -172 -159 10.5407 0.0262
NP_440567.1_1 Reverse -165 -179 15.6342 0.017
NP_440567.1_1 Forward -172 -158 6.48943 0.0831
NP_440567.1_4 Forward -320 -301 9.14423 0.162
NP_440567.1_4 Reverse -152 -171 -0.39387 0.291
NP_442497.1_1 Reverse -66 -85 13.2733 0.146
NP_442497.1_10 Forward -172 -163 10.4228 0.0087
NP_442497.1_10 Reverse -165 -174 10.4228 0.0087
NP_440821.1_4 Forward -175 -165 19.0562 0.00399
NP_440821.1_4 Reverse -162 -172 10.2065 0.0163
NP_441239.1_9 Forward -175 -163 15.8703 0.0178
NP_441239.1_9 Reverse -162 -174 14.887 0.0247
NP_441892.1_1 Forward -182 -165 5.44704 0.101
NP_441017.1_6 Forward -177 -163 14.0603 0.157
NP_442629.1_5 Forward -85 -71 19.5675 0.0585
NP_441541.1_1 Forward -51 -33 -1.14392 0.237
NP_442138.1_1 Reverse -315 -334 6.68515 0.24
NP_442138.1_10 Reverse -164 -183 -0.787193 0.162
NP_442052.1_8 Forward -310 -300 11.8781 0.297
NP_440546.1_4 Forward -173 -163 11.8882 0.0679
NP_440546.1_4 Reverse -164 -174 11.8882 0.0679
NP_440546.1_4 Forward -97 -87 6.65249 0.288
NP_440675.1_10 Forward -325 -306 12.8808 0.236
NP_440462.1_4 Forward -333 -319 18.6825 0.109
NP_440462.1_6 Forward -175 -165 15.418 0.0142
NP_440462.1_6 Reverse -162 -172 9.02648 0.0498
NP_440868.1_4 Reverse -160 -172 10.6587 0.0364
NP_440868.1_4 Forward -177 -165 1.7106 0.174
NP_441474.1_1 Reverse -315 -334 -3.34455 0.298
NP_441474.1_1 Reverse -60 -79 -3.34455 0.298
NP_440638.2_10 Forward -367 -350 17.7384 0.103
NP_442402.1_9 Reverse -153 -172 10.0292 0.275
NP_441848.1_4 Reverse -136 -152 7.93263 0.288
NP_441848.1_7 Reverse -65 -84 -1.8696 0.257
NP_441084.1_6 Reverse -240 -254 11.962 0.179
NP_440696.1_3 Forward -326 -308 -1.35749 0.257
NP_440696.1_3 Reverse -160 -178 -2.73412 0.279
NP_440696.1_3 Forward -183 -165 -3.32411 0.285
NP_440696.1_6 Reverse -152 -171 8.75091 0.231
NP_442039.1_4 Forward -172 -165 15.1821 0.0124
NP_442039.1_4 Reverse -165 -172 15.1821 0.0124
NP_442039.1_5 Forward -318 -299 17.3057 0.265
NP_440825.1_7 Forward -172 -162 12.4217 0.155
NP_442837.1_3 Forward -172 -165 15.7721 0.0124
NP_442837.1_3 Reverse -165 -172 15.7721 0.0124
NP_440160.1_9 Reverse -164 -183 9.14423 0.246
NP_442053.1_1 Forward -173 -164 18.3876 0.0007
NP_442053.1_1 Reverse -164 -173 18.3876 0.0007
NP_440505.1_3 Forward -175 -165 13.8447 0.0247
NP_440505.1_3 Reverse -162 -172 6.76487 0.169
NP_441701.1_3 Forward -95 -78 9.77361 0.245
NP_441203.1_1 Forward -172 -153 -4.03212 0.0741
NP_440548.1_10 Forward -335 -316 3.93269 0.275
NP_440914.1_1 Forward -173 -163 8.6151 0.186
NP_440914.1_1 Reverse -164 -174 8.6151 0.186
NP_441011.1_8 Forward -172 -163 16.9127 0.00602
NP_441011.1_8 Reverse -165 -174 16.9127 0.00602
NP_442533.1_1 Forward -338 -319 -12.8819 0.236
NP_442533.1_1 Forward -95 -76 -16.8151 0.277
NP_442533.1_6 Forward -173 -164 17.2076 0.00137
NP_442533.1_6 Reverse -164 -173 17.2076 0.00137
NP_442533.1_6 Reverse -317 -326 5.60459 0.137
NP_442533.1_6 Forward -326 -317 3.7363 0.204
NP_442533.1_6 Reverse -300 -309 3.24465 0.219
NP_442232.1_3 Forward -83 -64 -14.4552 0.288
NP_442322.1_4 Reverse -314 -331 -7.82829 0.286
NP_442322.1_4 Reverse -315 -332 -9.59824 0.295
NP_442229.1_1 Reverse -162 -176 10.8154 0.18
NP_441482.1_7 Forward -179 -165 -8.75187 0.193
NP_439944.1_9 Reverse -165 -175 10.3048 0.0887
NP_442203.1_1 Forward -21 -7 17.1047 0.16
NP_442203.1_3 Forward -374 -355 5.36445 0.268
NP_441028.1_6 Reverse -263 -273 6.0761 0.232
NP_442202.1_10 Reverse -306 -320 6.29277 0.255
NP_439965.1_1 Forward -182 -163 3.44104 0.0999
NP_441680.1_4 Forward -178 -159 6.58763 0.176
NP_441059.1_2 Forward -342 -323 -3.54046 0.242
NP_441602.1_3 Reverse -159 -178 -0.590531 0.224
NP_441972.1_5 Reverse -165 -184 -8.85033 0.272
NP_441106.1_1 Reverse -163 -172 18.191 0.0028
NP_441106.1_1 Forward -174 -165 18.191 0.0028
NP_441286.1_1 Reverse -163 -175 4.95553 0.027
NP_441286.1_1 Forward -174 -162 -3.50094 0.145
NP_440670.1_8 Forward -173 -164 18.3876 0.000699
NP_440670.1_8 Reverse -164 -173 18.3876 0.000699
NP_440886.1_7 Forward -174 -164 17.7774 0.0011
NP_440886.1_7 Reverse -163 -173 17.7774 0.0011
NP_440886.1_7 Reverse -316 -326 15.9091 0.0203
NP_442382.1_7 Reverse -304 -323 4.52268 0.253
NP_442072.1_9 Reverse -163 -181 -13.3539 0.11
NP_440907.2_8 Forward -172 -162 14.2375 0.0312
NP_440907.2_8 Reverse -165 -175 7.84605 0.117
NP_441021.1_8 Forward -178 -160 5.82068 0.215
NP_440326.1_5 Reverse -358 -371 14.4739 0.226
NP_442459.1_2 Reverse -132 -151 11.8975 0.179
NP_441463.1_3 Forward -183 -164 -2.45882 0.154
NP_441626.1_2 Forward -172 -165 15.7721 0.0124
NP_441626.1_2 Reverse -165 -172 15.7721 0.0124
NP_442238.1_7 Reverse -362 -381 10.7167 0.201
NP_442615.1_1 Reverse -155 -173 21.2586 0.0038
NP_440387.1_1 Forward -173 -157 6.45005 0.0282
NP_441431.1_2 Forward -176 -162 9.93039 0.172
NP_442020.1_1 Reverse -135 -154 -0.591301 0.278
NP_441993.1_1 Forward -332 -313 3.70092 0.23
NP_441993.1_1 Forward -326 -307 0.777198 0.292
NP_440358.1_8 Forward -364 -345 0.982764 0.258
NP_440114.1_10 Forward -173 -159 9.2427 0.179
NP_440114.1_10 Reverse -164 -178 7.57108 0.231
NP_442323.1_7 Reverse -268 -287 1.27698 0.285
NP_440766.1_4 Forward -177 -163 18.0925 0.0255
NP_442743.1_1 Reverse -78 -97 10.815 0.241
NP_439910.1_2 Forward -181 -164 -12.5475 0.0894
NP_439910.1_2 Reverse -156 -173 -21.9873 0.202
NP_442867.1_8 Forward -111 -92 4.71934 0.277
NP_440457.1_1 Forward -177 -165 7.02048 0.105
NP_441981.1_3 Forward -346 -332 15.1853 0.268
NP_441984.1_3 Reverse -160 -178 8.27895 0.232
NP_441984.1_6 Reverse -98 -110 13.5103 0.274
NP_441332.1_6 Reverse -306 -316 10.8723 0.282
NP_441436.1_6 Reverse -164 -183 8.25926 0.26
NP_442509.1_9 Forward -173 -163 16.2041 0.00739
NP_442509.1_9 Reverse -164 -174 16.2041 0.00739
NP_442509.1_9 Forward -394 -384 7.35439 0.225
NP_442582.1_3 Reverse -136 -150 12.9985 0.284
NP_442587.1_9 Reverse -2 -15 12.6056 0.218
NP_440554.1_4 Reverse -165 -175 14.6313 0.02
NP_440554.1_4 Forward -172 -162 7.35486 0.103
NP_442862.1_3 Forward -151 -134 23.6383 0.00671
NP_441845.1_6 Reverse -152 -170 4.14905 0.211
NP_441325.1_3 Reverse -163 -182 16.0274 0.108
NP_441885.1_5 Forward -173 -163 11.4848 0.00668
NP_441885.1_5 Reverse -164 -174 11.4848 0.00668
NP_442341.1_7 Reverse -163 -177 19.7641 0.00702
NP_442341.1_7 Forward -174 -160 15.3392 0.0229
NP_442341.1_9 Reverse -162 -176 7.76712 0.187
NP_441173.1_9 Reverse -264 -272 10.8354 0.243
NP_442395.2_4 Reverse -163 -182 0.195343 0.276
NP_440686.1_6 Reverse -255 -274 19.0748 0.297
NP_442534.1_7 Reverse -163 -182 6.09597 0.283
NP_440423.1_6 Forward -96 -77 -21.4367 0.294
NP_443000.1_7 Forward -175 -165 8.73149 0.0437
NP_443000.1_7 Reverse -162 -172 1.94665 0.226
NP_441842.1_10 Forward -180 -166 13.8643 0.0667
NP_441842.1_10 Forward -95 -81 7.07942 0.267
NP_440275.1_3 Forward -175 -165 8.4365 0.0602
NP_440275.1_3 Reverse -162 -172 8.33817 0.0602
NP_440091.1_1 Forward -177 -165 10.7571 0.0429
NP_440091.1_1 Reverse -55 -67 5.54551 0.114
NP_440091.1_7 Forward -168 -149 12.7816 0.282
NP_443046.1_9 Forward -169 -151 8.86816 0.168
NP_440679.1_10 Forward -333 -314 -21.7317 0.297
NP_442451.1_2 Forward -181 -162 -10.1286 0.265
NP_439962.1_4 Reverse -162 -181 0.982764 0.197
NP_440175.1_7 Forward -256 -238 11.6077 0.23
NP_440216.1_1 Reverse -164 -178 8.25939 0.0061
NP_440216.1_1 Forward -173 -159 -2.36035 0.0494
NP_440216.1_6 Forward -180 -164 5.95839 0.189
NP_440216.1_9 Reverse -128 -137 16.5193 0.128
NP_440172.1_1 Forward -173 -163 8.73149 0.0586
NP_440172.1_1 Reverse -164 -174 8.73149 0.0586
NP_442015.1_10 Forward -177 -164 10.639 0.0391
NP_442015.1_10 Reverse -160 -173 1.69091 0.204
NP_441226.1_7 Forward -172 -165 14.4934 0.0123
NP_441226.1_7 Reverse -165 -172 14.4934 0.0123
NP_441111.1_7 Forward -172 -164 18.7023 0.00294
NP_441111.1_7 Reverse -165 -173 18.7023 0.00294
NP_441766.1_2 Forward -173 -164 17.5026 0.00297
NP_441766.1_2 Reverse -164 -173 17.5026 0.00297
NP_442417.1_5 Reverse -164 -178 11.5043 0.0983
NP_440416.1_9 Forward -180 -161 -16.1268 0.208
NP_443052.1_8 Forward -183 -164 5.99764 0.0336
NP_443052.1_8 Reverse -154 -173 -12.4886 0.256
NP_443052.1_9 Reverse -319 -338 -5.60541 0.271
NP_442154.1_1 Forward -334 -316 -11.7806 0.216
NP_442154.1_1 Forward -319 -301 -19.1554 0.291
NP_442154.1_6 Forward -333 -314 1.27776 0.272
NP_441430.1_6 Forward -337 -318 9.73422 0.299
NP_440261.1_5 Forward -172 -159 -2.73398 0.0924
NP_440261.1_5 Reverse -165 -178 -10.5021 0.201
NP_440988.1_10 Reverse -168 -182 4.99564 0.247
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATTTCCAGGAACGGGCAGATCAGATTAAAAATCAATTGCTAGCCTTTTTGATTGAACAGAAAACAGCGGGGAAGGTGGTGGCCGGTTATGGGGCAGCGGCTAAAGGTAATACTTTGCTCAATTATGCTGGGGTGAAACCGGATTTGTTGCCCTTTGTTTGTGATGCATCTTCATCTAAGCAGGGTAAGTTTTTACCCGGTAGTCATATTGCCATTTTGCCTCCAACGGCGATCGCCGAAAAACACCCGGATTTTGTCCTGATTTTGCCTTGGAATTTACGGACAGAGATCATGACCCAGTTGGGCTATGTGGGAGACTGGGGGGGGCAATTTGTGACCGCAATTCCTAATTTACAGATTTGTTAGAATGTTGAGCAGGTAAAGAAAATAAGCAACTCCT

CDS

ATGGTTGAAGCAACAGCCCTCACCTCACTTTACGAACAAGATTATCCTGCCTGGTTAGATTTGACCCTAACACAACTTAAACAGCAGCAATTTAGCGTCATTGATTGGGCTAATTTGATTGAGGAAATAGAAGAATTGGGCCGAGAACAACGACACAAGGTAGAAAGTTATCTGTTGCGTCTTCTCATCCACCTACTTTTGTACGAGCATTGGCAAGCTGAACGCCCCTGGTCAGGTAAAGGCTGGGAAAAAGAGATTGATAATTTTCGGTTAGAGCTTGATTCCCTGCTGGAGTCCCAAGTTCTTCATAACCATTTTGAGACAGTTCTACCAAAAAACTACGCCAAAGCCCGCAAACTGGCTATCAAAAAATCTCACTTATCACCAACAATATTTCCTGAAGTTTGTCCCTATACCCTGGGTCAAATTCTTGACTTTGGTTGGTTGCCATAA

Protein

MVEATALTSLYEQDYPAWLDLTLTQLKQQQFSVIDWANLIEEIEELGREQRHKVESYLLRLLIHLLLYEHWQAERPWSGKGWEKEIDNFRLELDSLLESQVLHNHFETVLPKNYAKARKLAIKKSHLSPTIFPEVCPYTLGQILDFGWLP