Your browser is old and dusty. Try Google Chrome!

Details for slr1603

ORF slr1603
Accession NP_440329.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -295 -281 1.57289 0.186
NP_440557.1_1 Reverse -157 -176 0.0977854 0.265
NP_442100.1_1 Forward -95 -76 8.83258 0.24
NP_441630.1_3 Forward -312 -293 5.01433 0.152
NP_441721.1_6 Reverse -116 -135 9.14423 0.281
NP_440110.1_8 Forward -152 -133 -1.96717 0.256
NP_441054.1_2 Reverse -115 -134 9.83255 0.284
NP_441900.1_2 Reverse -133 -151 -5.88141 0.288
NP_441859.1_2 Forward -158 -139 12.1917 0.215
NP_439918.1_2 Forward -255 -236 -1.67217 0.24
NP_441208.1_1 Reverse -287 -306 1.67108 0.244
NP_442367.1_1 Reverse -146 -165 -10.3253 0.26
NP_441925.1_2 Forward -34 -15 -0.000545616 0.298
NP_441434.1_3 Reverse -221 -240 -1.18052 0.243
NP_442398.1_3 Reverse -29 -48 17.4449 0.289
NP_441713.1_1 Reverse -307 -326 -15.9302 0.275
NP_441770.1_5 Reverse -175 -194 0.0977854 0.244
NP_441716.1_1 Reverse -153 -167 2.94952 0.284
NP_441598.1_1 Reverse -131 -150 15.2408 0.0859
NP_441265.1_1 Forward -398 -379 -17.4051 0.292
NP_441667.1_10 Forward -278 -259 22.4189 0.0442
NP_440376.1_1 Reverse -287 -296 1.96635 0.236
NP_442687.1_1 Forward -37 -24 10.9334 0.285
NP_441846.1_10 Reverse -206 -225 -14.8485 0.24
NP_440042.1_1 Forward -396 -377 7.7676 0.239
NP_441029.1_4 Forward -308 -289 2.45773 0.23
NP_441950.1_9 Forward -230 -211 21.1505 0.186
NP_442296.1_2 Reverse -284 -303 11.3075 0.274
NP_441855.2_4 Forward -304 -285 9.71588 0.275
NP_442782.1_2 Reverse -340 -354 0.786239 0.284
NP_442782.1_2 Reverse -145 -159 0.491246 0.289
NP_442205.1_9 Forward -243 -227 -1.90808 0.264
NP_441256.1_2 Reverse -104 -123 6.09597 0.245
NP_441317.1_4 Reverse -30 -44 13.4746 0.175
NP_442816.1_7 Reverse -82 -101 8.35512 0.238
NP_443001.1_5 Reverse -274 -293 11.5042 0.248
NP_441162.1_3 Forward -153 -134 17.8957 0.0785
NP_442690.1_1 Reverse -76 -95 -7.86702 0.179
NP_440153.1_5 Reverse -229 -243 0.491246 0.299
NP_443055.1_3 Forward -295 -276 12.364 0.218
NP_443055.1_6 Forward -304 -286 5.91824 0.172
NP_442236.1_7 Reverse -100 -119 10.7175 0.216
NP_440062.1_6 Reverse -137 -156 12.4875 0.235
NP_441654.1_6 Forward -38 -20 13.4663 0.296
NP_441654.1_7 Forward -104 -85 16.3089 0.155
NP_441646.1_1 Reverse -377 -396 -1.57384 0.291
NP_442870.1_4 Forward -284 -270 17.7975 0.168
NP_441916.1_7 Reverse -299 -309 3.02829 0.232
NP_440345.1_5 Reverse -83 -97 15.9573 0.263
NP_441725.1_4 Reverse -379 -393 2.35894 0.287
NP_439966.1_7 Reverse -231 -241 4.89613 0.254
NP_441514.1_6 Forward -137 -130 14.2971 0.248
NP_440437.1_1 Forward -72 -53 -5.40875 0.282
NP_442215.1_2 Reverse -154 -170 -3.57971 0.218
NP_441762.1_7 Forward -297 -285 -6.35254 0.284
NP_443009.1_5 Forward -297 -286 3.79477 0.278
NP_442076.1_5 Forward -277 -258 6.09597 0.276
NP_440286.1_2 Reverse -342 -355 18.8988 0.211
NP_441826.1_5 Reverse -135 -154 6.09597 0.225
NP_440785.1_1 Forward -45 -26 1.57275 0.238
NP_442559.1_3 Forward -126 -107 12.1925 0.209
NP_442227.1_2 Reverse -320 -339 6.78429 0.198
NP_442808.1_1 Reverse -239 -249 4.40448 0.199
NP_442542.1_9 Reverse -134 -148 6.78381 0.223
NP_442050.1_1 Reverse -134 -153 8.75091 0.25
NP_442050.1_5 Forward -79 -69 8.14104 0.241
NP_442050.1_8 Reverse -333 -352 12.5288 0.272
NP_440342.1_2 Reverse -138 -157 20.4523 0.0693
NP_441036.1_8 Forward -309 -299 7.35486 0.201
NP_441557.1_8 Reverse -325 -335 12.0743 0.236
NP_442066.2_4 Forward -327 -308 -8.55534 0.294
NP_442066.2_9 Forward -299 -286 7.00078 0.253
NP_440440.1_1 Forward -154 -135 9.24175 0.211
NP_442135.1_3 Reverse -133 -152 5.89931 0.26
NP_442645.1_2 Reverse -181 -200 -20.4534 0.288
NP_442965.1_2 Forward -140 -121 -6.58872 0.257
NP_442594.1_8 Forward -251 -232 3.73603 0.279
NP_440563.1_4 Forward -286 -273 17.3255 0.226
NP_441179.1_6 Reverse -31 -50 14.9458 0.295
NP_440329.1_3 Forward -59 -40 19.452 0.171
NP_441464.1_2 Forward -125 -115 18.7612 0.221
NP_441199.1_6 Forward -211 -192 -1.47551 0.292
NP_440677.1_6 Forward -145 -126 23.5006 0.0215
NP_440677.1_6 Forward -246 -227 10.5209 0.265
NP_441750.1_1 Forward -149 -130 -11.7019 0.3
NP_442240.1_2 Reverse -300 -319 -14.5535 0.182
NP_441160.1_1 Forward -143 -124 -11.8003 0.295
NP_440439.1_1 Reverse -142 -155 -0.472371 0.221
NP_439943.1_2 Forward -361 -342 8.94757 0.287
NP_440770.1_3 Reverse -27 -41 14.9459 0.257
NP_440770.1_3 Forward -277 -263 13.9626 0.294
NP_441138.1_5 Reverse -32 -45 2.92653 0.297
NP_442663.1_1 Reverse -255 -274 2.06362 0.244
NP_442493.1_2 Reverse -84 -102 19.385 0.249
NP_441018.1_7 Reverse -102 -121 7.37428 0.272
NP_441018.1_7 Forward -280 -261 6.98095 0.278
NP_442262.1_10 Forward -191 -184 8.20058 0.25
NP_442065.1_2 Reverse -98 -111 16.5383 0.224
NP_440888.1_2 Reverse -228 -242 6.39049 0.236
NP_440888.1_2 Forward -165 -151 5.01387 0.298
NP_440888.1_9 Forward -390 -371 16.7157 0.268
NP_442277.1_4 Forward -246 -227 4.91521 0.182
NP_442277.1_4 Reverse -174 -193 4.22689 0.2
NP_442710.1_7 Reverse -267 -286 -5.97332 0.294
NP_442315.1_1 Forward -251 -233 2.77242 0.294
NP_442637.1_1 Reverse -270 -289 -10.1286 0.258
NP_443064.1_6 Forward -393 -383 10.046 0.181
NP_440071.1_1 Forward -148 -131 10.3628 0.253
NP_442204.1_1 Forward -337 -326 7.1385 0.14
NP_440454.1_2 Forward -95 -81 10.9932 0.291
NP_442872.1_1 Reverse -232 -251 -9.34199 0.241
NP_442080.1_7 Reverse -273 -292 -5.01543 0.296
NP_441867.1_2 Forward -336 -317 -13.3736 0.277
NP_441052.1_2 Reverse -384 -394 3.02829 0.185
NP_441052.1_2 Forward -165 -155 2.14332 0.216
NP_441052.1_2 Reverse -336 -346 1.74999 0.229
NP_442414.1_9 Reverse -126 -145 21.1406 0.0933
NP_442577.1_9 Forward -183 -169 13.2736 0.222
NP_442873.1_5 Forward -154 -135 8.4551 0.259
NP_441851.1_10 Reverse -286 -296 4.89658 0.24
NP_442622.1_8 Reverse -295 -313 -9.32229 0.145
NP_440593.1_3 Reverse -319 -338 0.196116 0.196
NP_440593.1_3 Reverse -127 -146 -1.86883 0.218
NP_440593.1_9 Reverse -135 -149 8.94771 0.255
NP_442689.1_8 Reverse -80 -97 8.39697 0.138
NP_441409.1_8 Forward -90 -71 10.1979 0.229
NP_442843.1_1 Forward -140 -121 -2.95047 0.217
NP_442843.1_1 Reverse -218 -237 -10.522 0.278
NP_442843.1_1 Reverse -39 -58 -10.6203 0.279
NP_439960.1_10 Reverse -131 -149 0.412472 0.212
NP_441477.1_10 Reverse -149 -167 2.96908 0.23
NP_442168.1_5 Reverse -288 -307 -1.08219 0.264
NP_440040.1_8 Reverse -252 -271 5.20389 0.236
NP_442006.1_2 Reverse -132 -149 -15.1041 0.215
NP_442006.1_2 Forward -249 -232 -15.8908 0.23
NP_442038.1_1 Reverse -80 -99 -0.590531 0.278
NP_441432.1_8 Forward -250 -241 4.22796 0.235
NP_441432.1_9 Forward -268 -255 15.6762 0.133
NP_441432.1_9 Reverse -72 -85 11.604 0.221
NP_441333.1_1 Reverse -85 -95 11.9712 0.241
NP_440629.1_1 Forward -91 -73 2.0841 0.245
NP_440760.1_1 Forward -304 -285 -22.3217 0.253
NP_440199.1_10 Forward -195 -185 13.353 0.108
NP_440461.1_3 Forward -135 -116 15.9291 0.212
NP_442400.1_10 Reverse -256 -269 8.36957 0.278
NP_441452.1_1 Forward -293 -274 12.1925 0.3
NP_442913.1_10 Reverse -147 -166 1.67108 0.139
NP_439956.1_2 Reverse -113 -127 19.8624 0.0528
NP_442346.1_1 Reverse -206 -225 17.2074 0.181
NP_442346.1_10 Reverse -121 -140 2.45773 0.195
NP_440831.1_1 Reverse -357 -376 10.9142 0.277
NP_440250.1_4 Reverse -77 -96 12.1917 0.208
NP_442137.1_6 Reverse -365 -384 10.0292 0.174
NP_440847.1_3 Forward -157 -143 13.6669 0.209
NP_442603.1_7 Forward -345 -331 6.58715 0.236
NP_440449.1_6 Reverse -113 -131 5.62973 0.273
NP_441047.1_1 Forward -157 -138 0.392778 0.269
NP_441227.1_3 Reverse -292 -311 5.80098 0.266
NP_442472.1_2 Reverse -130 -149 16.5182 0.164
NP_441892.1_4 Forward -166 -147 -0.983855 0.28
NP_442270.1_6 Reverse -137 -155 15.0638 0.283
NP_441874.1_1 Forward -247 -233 8.75105 0.294
NP_440833.1_6 Forward -235 -221 12.782 0.18
NP_441526.1_8 Reverse -106 -125 4.42435 0.277
NP_442052.1_8 Forward -298 -288 12.3697 0.271
NP_441497.1_3 Forward -199 -180 -3.3438 0.253
NP_442696.1_6 Reverse -261 -280 -4.42544 0.165
NP_440520.1_1 Forward -251 -232 -2.95047 0.208
NP_441203.1_2 Reverse -141 -160 -5.40875 0.265
NP_440013.1_5 Forward -41 -27 17.8871 0.198
NP_442533.1_6 Forward -165 -156 2.458 0.255
NP_439981.1_2 Forward -85 -66 17.0107 0.246
NP_440263.1_3 Reverse -139 -158 10.0292 0.22
NP_441028.1_6 Forward -30 -20 7.84605 0.218
NP_441527.1_4 Forward -87 -68 -8.83343 0.251
NP_441527.1_4 Reverse -255 -274 -11.0297 0.278
NP_441527.1_4 Reverse -256 -275 -12.6531 0.292
NP_441527.1_7 Reverse -74 -93 7.37347 0.29
NP_440103.1_3 Forward -272 -262 15.4857 0.286
NP_440886.1_7 Forward -208 -198 5.09279 0.201
NP_442072.1_9 Reverse -67 -85 -22.9903 0.271
NP_441962.1_4 Forward -301 -282 -10.4236 0.228
NP_441962.1_4 Forward -146 -127 -13.9635 0.28
NP_441836.1_2 Forward -147 -128 -4.22878 0.255
NP_441193.1_6 Forward -263 -244 2.75272 0.256
NP_441993.1_1 Reverse -318 -337 1.75177 0.27
NP_440293.1_3 Forward -143 -124 -1.86883 0.239
NP_441421.1_9 Forward -94 -75 3.6377 0.226
NP_440422.1_10 Forward -274 -255 8.66165 0.212
NP_442743.1_1 Reverse -230 -249 7.4718 0.264
NP_439998.1_6 Reverse -327 -346 13.7649 0.29
NP_442867.1_8 Forward -149 -130 11.0125 0.206
NP_442867.1_8 Reverse -129 -148 8.35759 0.236
NP_442940.1_2 Forward -133 -114 3.6377 0.258
NP_442509.1_9 Forward -77 -67 7.35439 0.225
NP_440524.1_2 Reverse -185 -204 -4.6221 0.277
NP_440524.1_8 Reverse -139 -153 19.9608 0.248
NP_440478.1_10 Forward -149 -135 11.406 0.187
NP_440423.1_10 Forward -199 -180 12.2908 0.203
NP_440552.1_5 Reverse -74 -93 17.242 0.174
NP_443046.1_9 Reverse -259 -277 1.49337 0.295
NP_441122.1_1 Forward -268 -253 3.32315 0.281
NP_439962.1_4 Forward -149 -130 6.88262 0.155
NP_440216.1_9 Forward -358 -349 5.50626 0.292
NP_440167.1_6 Forward -128 -114 18.5841 0.15
NP_441226.1_7 Forward -295 -288 8.29857 0.205
NP_443052.1_9 Reverse -130 -149 2.75272 0.168
NP_443052.1_9 Forward -160 -141 -1.37718 0.227
NP_443052.1_9 Forward -157 -138 -3.44213 0.25
NP_442154.1_1 Reverse -285 -303 -16.2055 0.236
NP_442564.1_10 Reverse -232 -246 8.65272 0.296
NP_440261.1_1 Forward -150 -137 18.5055 0.186
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGGGGTGTGGATTACCTGACCCACCTGATTGAGCACATATTCCCCGGCAAAACTGTTGAGCACCCGGGAGAGGGTAACTGGATCTGCCTGAAACGGTCGATTGAGCCAACCCCGCAATTCTTCAGGGTTTTTATTGGCCATTTTTAAATAGGCTTTGAGGGAGGGGGACACTTTCCCAGTGCGGCTCAACTCCCCTAACTCCTCAATGGAGATGGATTCTCGCAAAACACTATAGGTCAGCACCACCCGTTCCGCTGCAGCCAGGGGAAGAGTTCCAGCACCAGCCAACAGGCTAGCAAACATTAAACTTAAACAAAAGTGAGGAAAACGCACATTCATAACCACTAAATCCACATATCGACAAAAAATCTTCTCTCTATACTAGAAGAATAATTTTTA

CDS

ATGATTGTCGCCTCCGAGGGCAGTGGAATGAGTGTCGCCTTTAATCCCCAAATTATGACCGCTGTGGAGCAGTTGGACTATGTAGTCACGGTGGGGGACGTGGCCAGCCAGGCTGGATTAGAAATTAACCAAACCCAACAGGGGTTGCTGACTTTGGCGTCGGAGGTGGAGGGCCATCTCCAGGTGGCGGAGTCGGGGGAAATTGTGTTTGCTTTTCCCAAGCAGTTCCGGACAATTCTCCGCAATAAGTATTGGCGTTTACGGTTCCAGAGTTGGCTCCAAAGCATTTGGCAGGTGTTGTTTTACCTGATCCGCATTTCCTTTGGCATTATCCTTATCCTTTCTATCCTGTTGATGTTAGTGGCCATCATTGCCATTATCATCGCGGTCAATTCCAAGTCCGATAACGATAACGATGGGGGTTTTAAATTTTCCGGTGACGGTAACCGTGGTGGGGGTGGGGGAATATTTTTCTGGCCGGGGGACATTTTCTGGCTCCTTAGCCCCGATGGTGGCCGGCAAAAACGGGATAAGAAAAGGTCTGATAAAAATAAAAACGAGCTTAATTTCCTCGAAGCCATTTTCTCGTTTCTATTTGGAGACGGTAACCCCAATGAGGATTTGGAAGAAAAACGCTGGCAAACCCTGGGTAGTTTAATTCGCCATAACGGTGGGGCGATCGCCGCTGAACAGGCGGCCCCCTATTTGGATAATGTGACCAAATTCAATCGGGACAATGAGGACTACATAATTCCTGTGCTAGCCCGCTTTAATGGTTATCCCCAAGTTTCCCCCAGCGGCGAATTAATTTACACTTTCCCCAACCTACAAGTCAGTGCCCAGGAGCGCCAATCAACCACTTTGAGTGCTTACCTGCGGGAAAAACCCTGGAAATTTAGCCAAGCTTCCTCCGGCCAAAAAATAGCGGCGATCGCCTTGGGGGGAGTTAACCTAATTTTGGCCTTAAGTTTGGGGGTAATGCTGAAAACCTACGGCGCTGAGTTGGATTTGGGGACACTGGTTTATTTCGTCCAGAGCATTTACGGCGTTCTGGTGACCTATGCAATCGGTTTCTTGGCTATTCCCCTAGTGAGATATTTCTGGCTGCAAGAACGCAATCAAAAACTAGAACAACGCAACGGCGATCGGCAACAGCGGGCCAAACTTCTGCAACCGCCCTCCCCTCCCCTCAAAGCTAAACTAGAATTTGCCCAGGAGTGGGCCACTAGCACCGTCATTACTCCGGCGGACATCACCTACCGCACCGACCAAGACTCCCTGGAGCAGGAGTTTAAACGCTTTACCCCAACCCAGGGGGACTAA

Protein

MIVASEGSGMSVAFNPQIMTAVEQLDYVVTVGDVASQAGLEINQTQQGLLTLASEVEGHLQVAESGEIVFAFPKQFRTILRNKYWRLRFQSWLQSIWQVLFYLIRISFGIILILSILLMLVAIIAIIIAVNSKSDNDNDGGFKFSGDGNRGGGGGIFFWPGDIFWLLSPDGGRQKRDKKRSDKNKNELNFLEAIFSFLFGDGNPNEDLEEKRWQTLGSLIRHNGGAIAAEQAAPYLDNVTKFNRDNEDYIIPVLARFNGYPQVSPSGELIYTFPNLQVSAQERQSTTLSAYLREKPWKFSQASSGQKIAAIALGGVNLILALSLGVMLKTYGAELDLGTLVYFVQSIYGVLVTYAIGFLAIPLVRYFWLQERNQKLEQRNGDRQQRAKLLQPPSPPLKAKLEFAQEWATSTVITPADITYRTDQDSLEQEFKRFTPTQGD