Your browser is old and dusty. Try Google Chrome!

Details for slr1600

ORF slr1600
Accession NP_440324.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -309 -295 11.5043 0.051
NP_441061.1_2 Reverse -302 -316 4.62115 0.146
NP_440795.1_7 Forward -309 -302 14.6904 0.0123
NP_440795.1_7 Reverse -302 -309 14.6904 0.0123
NP_440795.1_7 Reverse -131 -138 8.00392 0.218
NP_441418.1_6 Forward -310 -291 -19.9617 0.0997
NP_441418.1_6 Reverse -301 -320 -20.0601 0.103
NP_442291.1_5 Forward -311 -295 2.71347 0.121
NP_442291.1_5 Reverse -300 -316 -1.21977 0.192
NP_440897.1_6 Forward -310 -291 4.03023 0.14
NP_441453.1_1 Forward -369 -351 9.6548 0.153
NP_441453.1_4 Reverse -301 -309 16.539 0.00633
NP_441453.1_4 Forward -310 -302 16.539 0.00633
NP_441453.1_4 Forward -139 -131 3.756 0.288
NP_441453.1_7 Forward -134 -127 11.9372 0.298
NP_442151.1_6 Forward -310 -296 10.816 0.114
NP_442151.1_6 Forward -122 -108 10.816 0.114
NP_442151.1_6 Reverse -113 -127 9.5377 0.145
NP_442151.1_6 Reverse -301 -315 6.6861 0.224
NP_441818.1_1 Reverse -302 -313 10.1862 0.232
NP_441818.1_1 Forward -309 -298 9.69459 0.232
NP_440226.1_1 Reverse -301 -320 16.5191 0.0215
NP_442173.1_1 Forward -309 -301 15.4574 0.00633
NP_442173.1_1 Reverse -302 -310 15.4574 0.00633
NP_442173.1_1 Reverse -225 -233 10.1475 0.0758
NP_442752.1_4 Forward -310 -303 13.8055 0.0199
NP_442752.1_4 Reverse -301 -308 13.8055 0.0199
NP_442752.1_4 Forward -55 -48 9.18389 0.116
NP_442752.1_4 Forward -283 -276 5.25066 0.256
NP_443027.1_4 Reverse -299 -309 14.828 0.0437
NP_443027.1_4 Forward -312 -302 14.0414 0.0452
NP_443027.1_4 Reverse -128 -138 7.74818 0.235
NP_441745.1_3 Forward -158 -139 14.2566 0.266
NP_441812.1_3 Forward -123 -109 11.111 0.215
NP_441812.1_3 Forward -311 -297 9.14437 0.245
NP_442975.1_10 Reverse -297 -311 22.615 0.000219
NP_442975.1_10 Forward -39 -25 3.53891 0.257
NP_440784.1_7 Forward -309 -302 15.9687 0.0123
NP_440784.1_7 Reverse -302 -309 15.9687 0.0123
NP_440784.1_7 Reverse -114 -121 5.84064 0.248
NP_440061.1_9 Reverse -128 -142 12.3887 0.0971
NP_440061.1_9 Reverse -299 -313 9.43874 0.145
NP_440061.1_9 Reverse -44 -58 8.65209 0.167
NP_440061.1_9 Reverse -159 -173 5.99717 0.264
NP_441476.1_5 Reverse -296 -315 -4.6221 0.254
NP_442062.1_8 Forward -310 -300 19.4496 0.000558
NP_442062.1_8 Reverse -301 -311 17.3846 0.00193
NP_442062.1_8 Forward -139 -129 5.97822 0.143
NP_441859.1_3 Reverse -151 -170 4.62021 0.217
NP_440304.1_4 Forward -312 -302 10.8948 0.051
NP_440304.1_4 Reverse -299 -309 10.8948 0.051
NP_440304.1_4 Forward -218 -208 4.20827 0.272
NP_442242.1_4 Forward -309 -302 14.3954 0.0124
NP_442242.1_4 Reverse -302 -309 14.3954 0.0124
NP_440044.1_8 Forward -309 -290 7.86593 0.0803
NP_440044.1_8 Reverse -302 -321 4.916 0.107
NP_441781.1_7 Reverse -301 -320 -3.3438 0.296
NP_440916.1_1 Reverse -59 -73 8.25939 0.273
NP_441208.1_9 Forward -313 -299 5.80112 0.262
NP_441594.1_6 Reverse -292 -311 5.50599 0.209
NP_440370.1_10 Forward -319 -300 7.66927 0.251
NP_440132.1_1 Reverse -299 -317 10.2456 0.223
NP_442110.1_7 Forward -310 -296 11.701 0.0593
NP_442110.1_7 Reverse -301 -315 9.5377 0.0724
NP_441925.1_4 Reverse -128 -147 -11.9976 0.253
NP_440014.1_6 Reverse -292 -311 6.4893 0.288
NP_441083.1_5 Reverse -301 -311 20.3345 0.00053
NP_441083.1_5 Forward -310 -300 11.3864 0.0159
NP_442827.1_8 Forward -130 -111 -1.08295 0.241
NP_442841.1_1 Reverse -179 -198 17.7974 0.192
NP_441738.1_2 Forward -308 -301 15.28 0.0102
NP_441738.1_2 Reverse -303 -310 15.28 0.0102
NP_441738.1_2 Reverse -226 -233 9.57686 0.166
NP_440209.1_1 Reverse -301 -309 18.1123 0.00295
NP_440209.1_1 Forward -310 -302 18.1123 0.00295
NP_442889.1_8 Reverse -298 -312 20.9434 0.00339
NP_441713.1_1 Forward -316 -297 -8.06369 0.143
NP_441770.1_5 Reverse -293 -312 0.0977854 0.244
NP_442570.1_3 Forward -318 -299 -5.01543 0.237
NP_441792.1_5 Reverse -80 -96 8.71166 0.258
NP_441716.1_1 Reverse -301 -315 13.2743 0.0689
NP_441716.1_1 Reverse -113 -127 9.14437 0.124
NP_442111.1_4 Forward -311 -297 10.7177 0.0518
NP_441163.1_1 Reverse -293 -310 8.00291 0.233
NP_440906.1_5 Forward -309 -302 15.8704 0.0124
NP_440906.1_5 Reverse -302 -309 15.8704 0.0124
NP_441209.1_8 Forward -203 -185 8.26975 0.259
NP_440747.1_1 Forward -312 -294 9.55725 0.241
NP_440747.1_10 Forward -313 -301 17.2469 0.000522
NP_440747.1_10 Reverse -298 -310 -2.02597 0.0196
NP_441130.1_10 Forward -312 -298 8.65272 0.133
NP_442973.1_5 Reverse -292 -311 10.1275 0.287
NP_441486.1_1 Reverse -298 -312 19.9608 0.00312
NP_441486.1_1 Forward -313 -299 10.9143 0.018
NP_442634.1_4 Reverse -299 -313 -1.5737 0.149
NP_440403.1_10 Reverse -292 -311 8.75091 0.189
NP_442848.1_1 Forward -316 -302 5.50613 0.0828
NP_442848.1_1 Reverse -295 -309 -2.45868 0.263
NP_443018.1_3 Forward -309 -302 14.8871 0.0123
NP_443018.1_3 Reverse -302 -309 14.8871 0.0123
NP_443018.1_3 Reverse -131 -138 4.07068 0.299
NP_441316.1_7 Reverse -299 -314 -3.16669 0.273
NP_441634.1_8 Forward -312 -298 11.8976 0.0529
NP_441634.1_8 Reverse -305 -319 0.196253 0.237
NP_441634.1_8 Forward -57 -43 -2.55701 0.295
NP_440376.1_1 Forward -310 -301 19.4693 0.000692
NP_440376.1_1 Reverse -301 -310 19.4693 0.000692
NP_440376.1_1 Reverse -130 -139 3.93297 0.188
NP_441857.1_6 Reverse -384 -394 14.7297 0.229
NP_441588.1_4 Forward -308 -298 6.96153 0.178
NP_442687.1_7 Reverse -300 -310 15.8113 0.0125
NP_442687.1_7 Forward -311 -301 8.92815 0.0994
NP_442687.1_7 Forward -140 -130 6.17489 0.178
NP_442687.1_7 Forward -171 -161 4.89658 0.23
NP_442485.1_3 Reverse -290 -309 -3.24547 0.272
NP_442583.1_8 Reverse -290 -309 9.63589 0.238
NP_440642.1_10 Reverse -211 -225 4.22722 0.259
NP_440571.1_5 Reverse -18 -37 13.9625 0.221
NP_441422.1_7 Reverse -299 -316 -1.33779 0.186
NP_442296.1_9 Reverse -295 -314 9.0459 0.0958
NP_441763.1_10 Reverse -290 -309 11.7 0.143
NP_442658.1_1 Reverse -299 -309 15.9091 0.00966
NP_442658.1_1 Forward -312 -302 6.76441 0.214
NP_442658.1_1 Reverse -128 -138 5.58445 0.262
NP_442198.1_7 Forward -337 -318 14.3549 0.181
NP_442782.1_2 Reverse -301 -315 4.91614 0.25
NP_442782.1_7 Reverse -293 -312 2.55606 0.193
NP_440656.1_8 Reverse -150 -169 -6.88371 0.249
NP_441414.1_9 Forward -310 -291 -5.50708 0.177
NP_441256.1_1 Reverse -298 -317 -5.01543 0.233
NP_441958.1_5 Forward -311 -301 12.2714 0.00183
NP_441958.1_5 Reverse -300 -310 12.2714 0.00183
NP_441958.1_5 Forward -140 -130 -0.41329 0.205
NP_442486.1_1 Forward -125 -106 20.9509 0.126
NP_442836.1_10 Forward -232 -222 10.7964 0.269
NP_440203.1_5 Reverse -304 -314 12.0743 0.166
NP_440203.1_5 Forward -398 -388 11.091 0.205
NP_439905.1_1 Reverse -162 -175 7.59077 0.255
NP_441097.1_2 Reverse -376 -393 14.9851 0.125
NP_442911.1_2 Forward -320 -301 3.34271 0.0442
NP_442911.1_2 Reverse -291 -310 -3.63879 0.115
NP_442911.1_2 Forward -149 -130 -9.24366 0.252
NP_441580.1_6 Reverse -290 -309 -6.49039 0.235
NP_440153.1_5 Forward -309 -295 10.226 0.0989
NP_440993.1_3 Forward -320 -301 -1.77127 0.292
NP_440993.1_4 Reverse -301 -318 2.79211 0.298
NP_440602.1_8 Forward -310 -296 9.5377 0.298
NP_440138.1_6 Reverse -296 -315 7.27514 0.213
NP_441129.1_3 Forward -186 -167 -17.7001 0.285
NP_442002.1_9 Reverse -334 -341 11.3472 0.185
NP_442002.1_9 Reverse -300 -307 10.7572 0.185
NP_441294.1_7 Reverse -297 -311 15.9698 0.0176
NP_442438.1_10 Forward -315 -301 20.9441 0.0119
NP_442438.1_10 Reverse -296 -310 16.5192 0.0212
NP_441000.1_6 Forward -140 -126 4.42448 0.0953
NP_441000.1_6 Forward -311 -297 -3.44199 0.221
NP_441000.1_6 Reverse -300 -314 -5.01529 0.257
NP_442771.1_1 Reverse -299 -317 -5.19239 0.166
NP_442771.1_1 Forward -312 -294 -10.4039 0.258
NP_440147.1_4 Reverse -299 -312 3.36254 0.188
NP_440147.1_4 Forward -312 -299 0.805932 0.244
NP_441550.1_8 Forward -312 -302 12.3692 0.0336
NP_441550.1_8 Forward -141 -131 6.86274 0.188
NP_441550.1_8 Reverse -111 -121 6.66608 0.198
NP_441550.1_8 Reverse -299 -309 6.0761 0.214
NP_441916.1_7 Forward -310 -300 18.4663 0.00144
NP_441916.1_7 Reverse -301 -311 10.3048 0.0261
NP_441916.1_7 Reverse -130 -140 5.09324 0.146
NP_440465.1_4 Forward -311 -292 13.9625 0.184
NP_441041.1_4 Forward -310 -291 -9.53865 0.218
NP_441041.1_4 Reverse -301 -320 -10.3253 0.231
NP_441041.1_7 Reverse -298 -310 10.916 0.0864
NP_440016.1_9 Forward -316 -297 9.83255 0.278
NP_442396.1_5 Forward -314 -301 8.08242 0.164
NP_442004.1_6 Reverse -301 -315 17.8958 0.0534
NP_442004.1_6 Reverse -130 -144 9.2427 0.14
NP_441725.1_5 Forward -309 -299 11.2881 0.0247
NP_441725.1_5 Reverse -302 -312 11.2881 0.0247
NP_441725.1_5 Reverse -131 -141 -0.216628 0.241
NP_439966.1_7 Reverse -299 -309 18.4657 0.00473
NP_439966.1_7 Forward -312 -302 15.8108 0.0124
NP_439966.1_9 Reverse -299 -308 0.983037 0.253
NP_442941.1_3 Reverse -302 -312 19.9412 0.00262
NP_442941.1_3 Forward -309 -299 11.4848 0.0116
NP_440289.1_2 Reverse -298 -311 21.3571 0.00262
NP_440289.1_2 Forward -313 -300 -2.93064 0.262
NP_440289.1_2 Reverse -127 -140 -4.50394 0.288
NP_440260.1_8 Forward -319 -301 -0.570838 0.216
NP_442281.1_1 Reverse -296 -310 19.6651 0.00247
NP_442281.1_1 Reverse -125 -139 7.66879 0.0949
NP_442281.1_1 Forward -315 -301 7.66879 0.0949
NP_441079.1_7 Forward -36 -17 -0.591301 0.2
NP_440437.1_1 Reverse -295 -314 6.78429 0.0724
NP_440647.1_9 Reverse -222 -240 7.78729 0.219
NP_441644.1_6 Reverse -301 -311 17.3841 0.00127
NP_441644.1_6 Forward -310 -300 10.1076 0.0628
NP_441644.1_6 Forward -122 -112 4.30615 0.242
NP_441644.1_6 Reverse -161 -171 4.10949 0.249
NP_441644.1_6 Forward -303 -293 3.61784 0.272
NP_440867.1_10 Forward -231 -212 1.47442 0.295
NP_442215.1_2 Forward -312 -296 8.02334 0.0666
NP_442215.1_2 Reverse -299 -315 1.63183 0.13
NP_442215.1_2 Reverse -292 -308 -1.51476 0.186
NP_442215.1_2 Reverse -369 -385 -6.92296 0.281
NP_442029.1_6 Forward -315 -296 5.01433 0.258
NP_440929.1_8 Forward -310 -301 19.2726 0.000701
NP_440929.1_8 Reverse -301 -310 19.2726 0.000701
NP_441346.1_7 Forward -286 -267 11.1109 0.238
NP_442933.1_10 Forward -310 -301 17.601 0.00325
NP_442933.1_10 Reverse -301 -310 17.601 0.00325
NP_442933.1_10 Reverse -130 -139 4.62128 0.227
NP_441751.2_8 Reverse -302 -316 16.0275 0.0103
NP_441751.2_8 Forward -309 -295 -1.47537 0.129
NP_442554.1_8 Reverse -302 -312 15.9097 0.00747
NP_442554.1_8 Forward -309 -299 13.8447 0.0145
NP_442554.1_8 Reverse -131 -141 6.46988 0.117
NP_441762.1_7 Forward -311 -299 2.89058 0.0676
NP_441762.1_7 Reverse -300 -312 2.30059 0.0676
NP_441762.1_7 Forward -234 -222 -5.46756 0.212
NP_441762.1_7 Reverse -129 -141 -5.95921 0.258
NP_442142.1_4 Forward -313 -300 18.0132 0.0255
NP_442142.1_4 Reverse -298 -311 15.85 0.0264
NP_442142.1_4 Forward -337 -324 4.24695 0.227
NP_442142.1_4 Reverse -116 -129 3.46031 0.255
NP_442292.1_1 Reverse -302 -311 18.486 0.00229
NP_442292.1_1 Forward -309 -300 9.63616 0.0183
NP_442292.1_5 Forward -314 -295 1.37609 0.257
NP_442476.1_6 Reverse -302 -316 8.94771 0.0978
NP_442476.1_6 Reverse -131 -145 7.07942 0.116
NP_442476.1_6 Reverse -214 -228 2.45787 0.183
NP_442476.1_6 Reverse -370 -384 0.982901 0.233
NP_443009.1_5 Forward -311 -300 18.3477 0.00265
NP_443009.1_5 Forward -140 -129 16.1844 0.0107
NP_440405.1_3 Reverse -185 -204 11.3938 0.293
NP_441715.1_4 Forward -309 -299 16.303 0.0117
NP_441715.1_4 Reverse -302 -312 14.828 0.0268
NP_441715.1_4 Reverse -225 -235 4.40493 0.281
NP_441448.1_1 Forward -364 -345 3.44104 0.297
NP_441198.1_8 Forward -141 -131 14.4433 0.0797
NP_441468.1_1 Forward -309 -302 15.8704 0.0124
NP_441468.1_1 Reverse -302 -309 15.8704 0.0124
NP_441468.1_1 Reverse -131 -138 10.2655 0.0906
NP_441618.1_3 Reverse -224 -243 7.96426 0.15
NP_441015.1_10 Forward -315 -296 -3.93378 0.195
NP_441673.1_1 Forward -310 -301 20.8459 0.000698
NP_441673.1_1 Reverse -301 -310 20.8459 0.000698
NP_441826.1_2 Reverse -295 -309 23.1074 0.00229
NP_441826.1_2 Forward -316 -302 4.42448 0.103
NP_441330.1_1 Forward -238 -219 -15.6352 0.289
NP_442490.1_9 Reverse -289 -308 -5.60541 0.273
NP_442868.1_6 Forward -312 -302 9.91146 0.038
NP_442868.1_6 Forward -141 -131 4.20827 0.183
NP_442868.1_6 Reverse -299 -309 0.963343 0.205
NP_441612.1_2 Reverse -301 -311 8.54929 0.21
NP_442361.1_3 Reverse -295 -308 9.85238 0.272
NP_442808.1_1 Reverse -300 -310 18.4657 0.00201
NP_442808.1_1 Forward -311 -301 8.63269 0.0481
NP_440145.1_3 Forward -320 -301 1.76941 0.124
NP_442542.1_2 Reverse -299 -312 11.4257 0.114
NP_442542.1_9 Reverse -294 -308 9.73373 0.13
NP_442050.1_5 Forward -312 -302 16.4991 0.00812
NP_442050.1_5 Reverse -299 -309 9.12434 0.193
NP_442903.1_2 Reverse -2 -21 9.7875 0.165
NP_441114.1_3 Forward -399 -390 17.1093 0.113
NP_440558.1_2 Forward -319 -300 10.1275 0.0976
NP_442593.1_1 Forward -377 -358 14.3558 0.285
NP_441518.1_3 Forward -320 -301 -15.2418 0.288
NP_441878.1_6 Forward -311 -301 10.4031 0.0176
NP_441878.1_6 Reverse -300 -310 10.4031 0.0176
NP_441878.1_6 Forward -140 -130 -0.41329 0.177
NP_441036.1_8 Reverse -300 -310 17.7779 0.000554
NP_441036.1_8 Forward -311 -301 8.33817 0.174
NP_441036.1_8 Reverse -129 -139 6.96153 0.213
NP_442650.1_2 Reverse -301 -315 6.58777 0.13
NP_441557.1_5 Forward -310 -301 19.9609 0.000699
NP_441557.1_5 Reverse -301 -310 19.9609 0.000699
NP_441557.1_5 Forward -139 -130 -0.983583 0.272
NP_441445.1_1 Forward -319 -300 19.3707 0.0276
NP_441445.1_1 Reverse -292 -311 1.67108 0.248
NP_442066.2_4 Forward -310 -291 7.7676 0.0828
NP_441308.1_8 Reverse -299 -309 10.1081 0.22
NP_440101.1_3 Forward -315 -296 4.03102 0.224
NP_441458.1_10 Forward -319 -300 5.99764 0.208
NP_441458.1_10 Reverse -292 -311 4.916 0.225
NP_442183.1_1 Forward -310 -296 11.996 0.0648
NP_442183.1_1 Reverse -301 -315 6.48943 0.171
NP_441549.1_9 Reverse -297 -315 -4.8974 0.198
NP_441549.1_9 Forward -126 -108 -10.5023 0.279
NP_442347.1_2 Reverse -302 -311 12.4878 0.056
NP_442347.1_2 Forward -309 -300 11.1111 0.056
NP_442347.1_2 Reverse -340 -349 5.70292 0.226
NP_442645.1_2 Forward -318 -299 -4.81876 0.0622
NP_442645.1_2 Reverse -111 -130 -20.2567 0.288
NP_440547.1_5 Forward -309 -290 7.86593 0.225
NP_442888.1_6 Reverse -119 -138 6.98095 0.216
NP_441037.1_4 Reverse -299 -309 7.02532 0.237
NP_441037.1_4 Forward -141 -131 6.92787 0.237
NP_441633.1_3 Forward -40 -27 1.69091 0.109
NP_441633.1_3 Forward -312 -299 1.29759 0.109
NP_441633.1_3 Reverse -128 -141 -1.65234 0.16
NP_441633.1_3 Reverse -299 -312 -3.81562 0.177
NP_440136.1_1 Forward -287 -271 12.1525 0.238
NP_440136.1_2 Forward -309 -302 15.9687 0.0123
NP_440136.1_2 Reverse -302 -309 15.9687 0.0123
NP_440136.1_2 Reverse -131 -138 4.26735 0.218
NP_442590.1_10 Forward -310 -291 4.916 0.27
NP_442998.1_10 Forward -308 -301 15.5754 0.0102
NP_442998.1_10 Reverse -303 -310 15.5754 0.0102
NP_440299.1_1 Forward -314 -301 18.6032 0.00369
NP_440299.1_1 Reverse -297 -310 11.9167 0.0427
NP_440299.1_1 Forward -143 -130 4.44361 0.207
NP_441799.1_1 Forward -314 -300 15.7319 0.0167
NP_441799.1_1 Forward -143 -129 4.8172 0.236
NP_441799.1_1 Reverse -109 -123 4.03056 0.269
NP_441007.1_10 Forward -315 -302 1.49425 0.203
NP_442201.1_10 Reverse -290 -309 -2.26216 0.141
NP_442333.2_5 Reverse -290 -309 -13.8652 0.27
NP_440256.1_1 Forward -313 -294 17.2074 0.00544
NP_440256.1_1 Reverse -298 -317 -2.0655 0.112
NP_441559.1_8 Reverse -126 -140 -6.09693 0.274
NP_441559.1_8 Reverse -296 -310 -6.29359 0.276
NP_441559.1_8 Forward -202 -188 -6.78525 0.279
NP_442860.1_7 Forward -269 -251 6.77397 0.294
NP_440915.1_6 Reverse -297 -311 6.3911 0.0826
NP_440915.1_6 Reverse -126 -140 6.09611 0.0862
NP_440915.1_6 Forward -314 -300 1.08123 0.147
NP_441179.1_9 Forward -336 -326 8.63269 0.284
NP_441866.1_4 Forward -22 -9 13.5367 0.273
NP_442967.1_10 Reverse -294 -308 16.2915 0.222
NP_442866.1_1 Forward -315 -296 -9.83364 0.3
NP_440748.1_5 Reverse -297 -316 1.47442 0.232
NP_441464.1_10 Forward -91 -77 9.5377 0.262
NP_440787.1_5 Reverse -18 -32 9.63603 0.269
NP_440306.1_8 Reverse -185 -204 0.785326 0.204
NP_442993.1_1 Forward -310 -294 2.51681 0.0502
NP_442993.1_1 Forward -377 -361 -13.4128 0.291
NP_440677.1_6 Forward -131 -112 11.3075 0.234
NP_442386.1_9 Reverse -300 -309 15.7322 0.0144
NP_442386.1_9 Forward -311 -302 13.8639 0.0289
NP_442386.1_9 Reverse -129 -138 13.0773 0.0437
NP_442386.1_9 Reverse -306 -315 9.5374 0.159
NP_442386.1_9 Forward -317 -308 9.34074 0.166
NP_442386.1_9 Reverse -223 -232 4.52254 0.297
NP_441340.1_5 Forward -309 -302 15.6737 0.0124
NP_441340.1_5 Reverse -302 -309 15.6737 0.0124
NP_441271.1_1 Forward -316 -298 11.7197 0.239
NP_441947.1_10 Reverse -299 -317 9.16393 0.182
NP_440168.1_9 Forward -172 -153 -5.60541 0.296
NP_441027.1_1 Forward -347 -333 19.7634 0.169
NP_440586.1_1 Forward -326 -307 -0.688862 0.237
NP_440586.1_8 Forward -309 -302 13.2151 0.026
NP_440586.1_8 Reverse -302 -309 13.2151 0.026
NP_442251.1_6 Forward -309 -302 15.2804 0.0124
NP_442251.1_6 Reverse -302 -309 15.2804 0.0124
NP_440192.1_5 Forward -100 -81 14.1591 0.116
NP_440684.1_9 Reverse -295 -309 8.65272 0.225
NP_441262.1_3 Reverse -301 -308 14.7888 0.0223
NP_441262.1_3 Forward -310 -303 14.7888 0.0223
NP_440027.1_8 Forward -313 -294 7.66846 0.26
NP_443051.1_1 Reverse -300 -309 10.4228 0.00754
NP_443051.1_1 Forward -311 -302 10.4228 0.00754
NP_440451.1_10 Reverse -302 -321 19.5664 0.0916
NP_439937.1_4 Forward -94 -75 8.84924 0.278
NP_439937.1_9 Reverse -300 -317 -16.4814 0.287
NP_439937.1_9 Forward -304 -287 -17.268 0.296
NP_440408.1_3 Reverse -295 -314 19.9606 0.0137
NP_440439.1_1 Forward -313 -300 7.29578 0.0664
NP_440439.1_1 Reverse -298 -311 1.19926 0.159
NP_440372.1_2 Forward -309 -302 16.3621 0.0124
NP_440372.1_2 Reverse -302 -309 16.3621 0.0124
NP_441789.1_7 Reverse -121 -140 12.0933 0.193
NP_441803.1_2 Forward -315 -296 12.6841 0.0582
NP_441803.1_2 Reverse -114 -133 0.58944 0.249
NP_439977.1_5 Forward -316 -297 5.11266 0.15
NP_440139.1_1 Reverse -295 -314 11.7 0.0797
NP_440139.1_1 Forward -316 -297 9.7334 0.095
NP_440210.1_10 Forward -251 -232 9.04509 0.26
NP_441572.1_7 Reverse -295 -314 21.4356 0.015
NP_442384.1_10 Reverse -301 -314 16.4406 0.00838
NP_442384.1_10 Forward -310 -297 8.37742 0.0656
NP_442384.1_10 Forward -122 -109 3.95252 0.172
NP_442384.1_10 Reverse -113 -126 2.96921 0.206
NP_442384.1_10 Reverse -130 -143 0.904263 0.275
NP_440364.1_6 Reverse -300 -313 14.375 0.275
NP_441877.1_5 Reverse -335 -354 -1.57384 0.287
NP_440530.1_5 Forward -98 -79 11.7992 0.25
NP_442790.1_4 Reverse -292 -311 -6.78538 0.146
NP_442790.1_4 Forward -368 -349 -14.6519 0.278
NP_442262.1_10 Forward -309 -302 14.1988 0.0123
NP_442262.1_10 Reverse -302 -309 14.1988 0.0123
NP_442262.1_10 Reverse -225 -232 9.67555 0.173
NP_441689.1_5 Forward -312 -302 15.3192 0.0403
NP_441689.1_5 Reverse -299 -309 8.53436 0.132
NP_440163.1_10 Reverse -298 -308 15.2213 0.0762
NP_440163.1_10 Forward -313 -303 12.4681 0.159
NP_440344.1_10 Reverse -294 -311 13.8052 0.00599
NP_440344.1_10 Forward -317 -300 -0.846137 0.0466
NP_440531.1_6 Forward -241 -222 -3.04881 0.26
NP_441965.1_10 Reverse -298 -314 9.10498 0.123
NP_441965.1_10 Reverse -110 -126 3.30346 0.266
NP_441965.1_10 Forward -58 -42 2.61514 0.285
NP_440297.1_9 Forward -309 -299 9.32148 0.0917
NP_440297.1_9 Reverse -302 -312 9.32148 0.0917
NP_440297.1_9 Reverse -131 -141 -0.511621 0.289
NP_441896.1_5 Forward -88 -81 12.2322 0.273
NP_440894.1_10 Reverse -296 -315 6.29264 0.217
NP_440999.1_9 Reverse -297 -311 14.1593 0.0277
NP_440999.1_9 Reverse -109 -123 -1.5737 0.242
NP_440999.1_9 Forward -123 -109 -2.36035 0.268
NP_440888.1_2 Forward -310 -296 19.8618 0.000937
NP_440888.1_2 Reverse -301 -315 15.9285 0.00837
NP_440888.1_2 Forward -139 -125 9.93039 0.11
NP_440491.1_1 Forward -313 -294 16.078 0.0697
NP_440052.1_8 Forward -130 -111 8.35759 0.288
NP_442277.1_4 Reverse -292 -311 1.47364 0.276
NP_442077.1_9 Forward -340 -321 0.982764 0.218
NP_441543.1_2 Forward -309 -300 18.486 0.00236
NP_441543.1_2 Reverse -302 -311 16.9127 0.00359
NP_442845.1_2 Forward -316 -302 17.1092 0.0608
NP_442845.1_2 Reverse -301 -315 13.8643 0.0893
NP_442845.1_2 Reverse -295 -309 6.6861 0.205
NP_442845.1_2 Forward -145 -131 3.63784 0.282
NP_441551.1_5 Forward -314 -298 6.2527 0.275
NP_441829.1_4 Forward -144 -130 18.6825 0.122
NP_441469.1_8 Reverse -300 -309 16.126 0.00797
NP_441469.1_8 Forward -140 -131 11.8978 0.141
NP_441469.1_8 Forward -311 -302 6.48957 0.227
NP_443064.1_6 Reverse -301 -311 12.5669 0.0796
NP_442337.1_8 Forward -388 -369 0.294447 0.255
NP_441306.1_10 Reverse -326 -340 13.5686 0.25
NP_442578.1_7 Forward -309 -302 14.5921 0.026
NP_442578.1_7 Reverse -302 -309 14.5921 0.026
NP_440148.1_1 Reverse -18 -37 5.01433 0.186
NP_441462.1_2 Forward -310 -300 11.5831 0.00406
NP_441462.1_2 Reverse -301 -311 11.5831 0.00406
NP_441621.1_7 Reverse -299 -313 -3.24533 0.188
NP_443062.1_1 Forward -310 -292 16.639 0.0304
NP_443062.1_1 Forward -139 -121 11.7637 0.0936
NP_443062.1_6 Forward -318 -299 7.07928 0.176
NP_442204.1_1 Forward -132 -121 5.8602 0.186
NP_442204.1_1 Reverse -297 -308 0.353664 0.281
NP_442204.1_1 Forward -314 -303 -0.0396598 0.285
NP_442204.1_5 Reverse -291 -310 20.059 0.0241
NP_441560.1_8 Forward -315 -296 11.5127 0.294
NP_440516.1_8 Forward -310 -301 16.9127 0.00442
NP_440516.1_8 Reverse -301 -310 16.9127 0.00442
NP_440516.1_8 Forward -233 -224 -0.590259 0.283
NP_442428.1_5 Forward -309 -302 15.8704 0.0124
NP_442428.1_5 Reverse -302 -309 15.8704 0.0124
NP_442428.1_5 Reverse -131 -138 4.66067 0.244
NP_442120.1_10 Reverse -295 -314 -5.99873 0.203
NP_440673.1_3 Forward -308 -301 12.4288 0.0426
NP_440673.1_3 Reverse -303 -310 12.4288 0.0426
NP_440673.1_3 Forward -332 -325 10.5605 0.123
NP_440673.1_3 Forward -159 -152 6.72562 0.277
NP_441052.1_2 Reverse -301 -311 19.9412 0.00106
NP_441052.1_2 Reverse -113 -123 11.5831 0.0285
NP_441052.1_2 Forward -310 -300 10.5014 0.0285
NP_441052.1_2 Forward -122 -112 1.94665 0.221
NP_442219.1_9 Reverse -302 -311 17.7976 0.00718
NP_442219.1_9 Forward -309 -300 8.35786 0.0681
NP_440436.1_4 Forward -309 -300 18.1905 0.00233
NP_440436.1_4 Reverse -302 -311 17.2072 0.00233
NP_440436.1_4 Forward -138 -129 11.0124 0.0655
NP_441884.1_9 Reverse -298 -317 -22.3217 0.277
NP_441719.1_4 Forward -309 -302 16.3621 0.0124
NP_441719.1_4 Reverse -302 -309 16.3621 0.0124
NP_441733.1_10 Forward -313 -300 7.49244 0.153
NP_441733.1_10 Forward -142 -129 6.80412 0.171
NP_441004.1_1 Forward -86 -67 -16.4218 0.284
NP_441004.1_4 Forward -173 -163 9.12481 0.259
NP_442813.1_2 Reverse -244 -263 -2.95047 0.273
NP_442366.1_3 Forward -311 -293 17.8171 0.0186
NP_442366.1_3 Reverse -300 -318 -3.52077 0.251
NP_440129.1_10 Reverse -294 -308 3.73617 0.189
NP_441115.1_4 Forward -311 -293 10.2448 0.183
NP_442694.1_4 Forward -95 -86 12.9794 0.225
NP_440094.1_9 Forward -311 -292 -0.39387 0.199
NP_443054.1_2 Forward -312 -298 12.4876 0.0722
NP_441851.1_10 Reverse -300 -310 16.008 0.00552
NP_441851.1_10 Forward -311 -301 15.8113 0.00552
NP_441851.1_10 Forward -56 -46 7.25653 0.144
NP_441851.1_10 Forward -140 -130 6.96153 0.151
NP_441851.1_10 Forward -379 -369 4.60159 0.259
NP_441851.1_10 Reverse -129 -139 4.0116 0.291
NP_442208.1_8 Forward -172 -154 16.7354 0.235
NP_442622.1_5 Reverse -299 -318 5.211 0.0643
NP_441542.1_4 Reverse -23 -37 4.03116 0.264
NP_442856.1_7 Reverse -292 -311 7.27595 0.113
NP_442856.1_7 Forward -131 -112 -3.93378 0.254
NP_442515.1_1 Reverse -151 -165 -0.688726 0.231
NP_442515.1_1 Forward -311 -297 -4.91696 0.298
NP_441396.1_5 Forward -178 -169 7.86621 0.235
NP_441349.1_10 Forward -320 -301 9.73422 0.0238
NP_441349.1_10 Reverse -291 -310 -0.688862 0.0958
NP_441409.1_6 Forward -316 -297 -6.98204 0.14
NP_440432.1_9 Forward -138 -123 -1.98672 0.167
NP_442843.1_1 Forward -73 -54 -11.7019 0.291
NP_439960.1_4 Reverse -300 -319 15.2399 0.153
NP_440474.1_8 Forward -309 -295 9.34041 0.162
NP_441477.1_10 Forward -129 -111 6.50899 0.181
NP_440431.1_2 Forward -354 -335 4.03102 0.235
NP_442450.1_5 Reverse -299 -309 9.32148 0.115
NP_442450.1_5 Forward -312 -302 9.32148 0.115
NP_442450.1_5 Forward -141 -131 5.38824 0.245
NP_440588.1_2 Forward -319 -300 6.58763 0.0543
NP_440588.1_2 Forward -131 -112 1.0811 0.139
NP_440588.1_2 Reverse -292 -311 -0.590531 0.151
NP_443047.1_6 Forward -152 -133 22.9106 0.0411
NP_441570.1_1 Reverse -301 -319 9.85225 0.00993
NP_441570.1_1 Forward -310 -292 -9.71562 0.146
NP_440078.1_10 Forward -310 -291 6.29264 0.224
NP_441078.1_4 Forward -310 -301 19.6659 0.0007
NP_441078.1_4 Reverse -301 -310 19.6659 0.0007
NP_441078.1_4 Forward -122 -113 -1.96689 0.282
NP_441078.1_4 Reverse -130 -139 -2.06522 0.295
NP_441078.1_4 Forward -139 -130 -2.06522 0.295
NP_442729.1_8 Reverse -297 -310 8.18076 0.125
NP_442729.1_8 Forward -145 -132 5.52582 0.242
NP_441663.1_7 Forward -313 -294 5.70265 0.236
NP_441663.1_8 Reverse -295 -314 -1.86883 0.253
NP_442348.1_2 Reverse -26 -35 7.96454 0.28
NP_440526.1_3 Reverse -302 -313 7.92465 0.126
NP_440526.1_3 Forward -309 -298 1.92649 0.267
NP_441432.1_8 Forward -311 -302 16.8143 0.00595
NP_441432.1_8 Reverse -300 -309 8.25953 0.0755
NP_442320.1_8 Reverse -295 -309 13.5693 0.0144
NP_442320.1_8 Forward -316 -302 6.3911 0.029
NP_442320.1_8 Reverse -124 -138 -5.01529 0.2
NP_442344.1_7 Forward -309 -290 -6.49039 0.171
NP_441732.1_2 Reverse -297 -313 -6.82463 0.0533
NP_441732.1_2 Reverse -128 -144 -17.2477 0.247
NP_441732.1_2 Forward -314 -298 -17.346 0.253
NP_440760.1_1 Reverse -130 -149 -12.8819 0.0954
NP_440760.1_1 Reverse -301 -320 -14.7502 0.135
NP_442797.1_7 Forward -317 -299 5.32902 0.216
NP_440199.1_10 Reverse -298 -308 14.533 0.0861
NP_440199.1_10 Forward -125 -115 8.63316 0.231
NP_440199.1_10 Forward -313 -303 7.64985 0.231
NP_442353.1_4 Reverse -295 -314 11.0117 0.101
NP_441072.1_2 Forward -314 -295 5.99764 0.295
NP_440713.1_4 Forward -320 -301 23.5989 0.00429
NP_442489.1_7 Forward -310 -301 20.1576 0.000695
NP_442489.1_7 Reverse -301 -310 20.1576 0.000695
NP_442489.1_7 Reverse -130 -139 -1.57357 0.213
NP_442489.1_7 Forward -122 -113 -1.6719 0.235
NP_442079.1_7 Reverse -302 -321 2.16274 0.234
NP_440559.1_1 Reverse -302 -311 17.4043 0.00658
NP_440559.1_1 Forward -309 -300 8.75118 0.0586
NP_441659.2_8 Reverse -301 -311 18.1713 0.00133
NP_441659.2_8 Forward -310 -300 11.9764 0.0147
NP_442913.1_10 Reverse -292 -311 -1.18052 0.167
NP_441040.1_2 Forward -312 -293 -12.1936 0.255
NP_440708.1_6 Reverse -121 -140 -10.3253 0.278
NP_441800.1_7 Reverse -82 -100 -3.6191 0.279
NP_442346.1_5 Forward -311 -301 16.6963 0.00248
NP_442346.1_5 Reverse -300 -310 9.02648 0.118
NP_442346.1_5 Forward -123 -113 8.1415 0.146
NP_442346.1_5 Reverse -112 -122 7.35486 0.172
NP_442346.1_5 Forward -140 -130 6.66654 0.195
NP_440545.1_3 Forward -314 -297 4.95539 0.0658
NP_441856.1_3 Forward -362 -343 -0.787193 0.228
NP_441856.1_3 Forward -125 -106 -3.04881 0.275
NP_440459.1_2 Forward -235 -218 14.4935 0.119
NP_440459.1_2 Forward -312 -295 11.3469 0.177
NP_440459.1_2 Reverse -121 -138 8.59364 0.254
NP_442603.1_7 Reverse -113 -127 11.602 0.114
NP_441888.1_7 Reverse -296 -310 2.5562 0.225
NP_440449.1_6 Reverse -293 -311 6.60236 0.244
NP_440170.1_5 Reverse -291 -310 10.2259 0.134
NP_441833.1_4 Forward -309 -302 15.9687 0.0124
NP_441833.1_4 Reverse -302 -309 15.9687 0.0124
NP_441895.1_2 Reverse -374 -393 -17.3068 0.217
NP_442162.1_9 Forward -309 -302 16.2637 0.0124
NP_442162.1_9 Reverse -302 -309 16.2637 0.0124
NP_440671.1_4 Reverse -295 -309 19.3708 0.00937
NP_440671.1_4 Forward -316 -302 17.8958 0.0164
NP_440224.1_1 Forward -321 -302 2.26107 0.132
NP_442140.1_3 Forward -309 -299 8.33817 0.119
NP_442140.1_3 Reverse -302 -312 4.40493 0.243
NP_442140.1_3 Reverse -131 -141 4.10993 0.261
NP_442140.1_3 Reverse -326 -336 3.91327 0.271
NP_440875.1_9 Forward -308 -298 8.37203 0.233
NP_441813.1_5 Reverse -299 -309 17.188 0.00979
NP_441813.1_5 Forward -312 -302 15.9097 0.01
NP_441813.1_5 Reverse -128 -138 -0.806614 0.285
NP_440073.1_2 Reverse -332 -351 5.40766 0.234
NP_440590.1_4 Forward -309 -296 13.0973 0.013
NP_440590.1_4 Reverse -302 -315 -5.68391 0.286
NP_440567.1_1 Reverse -302 -316 18.6825 0.0136
NP_440567.1_1 Forward -309 -295 13.0776 0.0213
NP_440567.1_1 Reverse -131 -145 1.47456 0.204
NP_442497.1_10 Forward -309 -300 10.4228 0.0087
NP_442497.1_10 Reverse -302 -311 10.4228 0.0087
NP_442497.1_10 Reverse -131 -140 0.393051 0.175
NP_440821.1_4 Reverse -299 -309 19.0562 0.00399
NP_440821.1_4 Forward -312 -302 18.2696 0.00448
NP_440821.1_4 Forward -141 -131 -0.118297 0.229
NP_440227.1_2 Reverse -190 -206 11.2683 0.274
NP_441239.1_9 Reverse -299 -311 13.3137 0.037
NP_441239.1_9 Reverse -128 -140 11.8387 0.0547
NP_441239.1_9 Forward -312 -300 6.92215 0.173
NP_441239.1_9 Forward -141 -129 3.67722 0.279
NP_441892.1_1 Reverse -292 -309 0.92382 0.159
NP_440665.1_1 Reverse -164 -183 -16.8151 0.293
NP_442044.1_1 Reverse -108 -127 -5.40875 0.187
NP_442044.1_9 Forward -310 -291 5.211 0.218
NP_442270.1_9 Forward -133 -114 -9.53865 0.235
NP_442643.1_1 Forward -316 -297 -10.1286 0.231
NP_441017.1_6 Reverse -297 -311 16.4202 0.0651
NP_440354.1_5 Forward -313 -294 1.57275 0.272
NP_441782.1_5 Forward -241 -222 9.63589 0.256
NP_440546.1_4 Forward -310 -300 11.8882 0.0679
NP_440546.1_4 Forward -233 -223 11.2095 0.0923
NP_440546.1_4 Reverse -301 -311 10.046 0.109
NP_440546.1_4 Reverse -130 -140 9.75513 0.121
NP_440654.1_7 Reverse -320 -339 10.0292 0.206
NP_441230.1_5 Reverse -296 -315 4.03102 0.188
NP_440462.1_6 Reverse -299 -309 15.418 0.0142
NP_440462.1_6 Forward -312 -302 7.74818 0.0699
NP_440462.1_6 Reverse -128 -138 5.09324 0.168
NP_442611.1_1 Reverse -301 -320 -1.67217 0.282
NP_440868.1_4 Forward -314 -302 13.2153 0.022
NP_440868.1_4 Reverse -297 -309 1.7106 0.174
NP_441868.1_4 Forward -317 -303 14.4542 0.282
NP_442460.1_7 Forward -322 -303 26.5488 0.00304
NP_442039.1_4 Forward -309 -302 15.1821 0.0124
NP_442039.1_4 Reverse -302 -309 15.1821 0.0124
NP_442039.1_7 Forward -301 -291 16.1063 0.211
NP_441811.1_8 Forward -128 -114 7.86607 0.241
NP_442837.1_3 Forward -309 -302 15.7721 0.0124
NP_442837.1_3 Reverse -302 -309 15.7721 0.0124
NP_439994.1_3 Reverse -300 -319 9.31652 0.253
NP_439994.1_3 Reverse -112 -131 7.75569 0.3
NP_442053.1_1 Forward -310 -301 18.3876 0.0007
NP_442053.1_1 Reverse -301 -310 18.3876 0.0007
NP_440505.1_3 Forward -312 -302 16.303 0.00696
NP_440505.1_3 Reverse -299 -309 13.8447 0.0247
NP_440505.1_7 Forward -87 -68 3.83436 0.207
NP_441701.1_3 Forward -179 -162 11.3469 0.213
NP_441701.1_3 Forward -231 -214 10.3636 0.242
NP_441701.1_3 Reverse -382 -399 10.0686 0.245
NP_441203.1_1 Forward -309 -290 -2.65548 0.0655
NP_440914.1_1 Reverse -301 -311 17.5935 0.000537
NP_440914.1_1 Forward -310 -300 8.6151 0.186
NP_441011.1_8 Forward -309 -300 16.9127 0.00602
NP_441011.1_8 Reverse -302 -311 8.25953 0.144
NP_441011.1_8 Forward -138 -129 5.01461 0.289
NP_442101.1_10 Forward -136 -117 -9.34199 0.247
NP_442533.1_6 Forward -310 -301 17.2076 0.00137
NP_442533.1_6 Reverse -301 -310 17.2076 0.00137
NP_442533.1_6 Forward -139 -130 14.7494 0.00935
NP_442533.1_6 Reverse -113 -122 5.11294 0.155
NP_442533.1_6 Forward -122 -113 3.83464 0.202
NP_442232.1_3 Forward -147 -128 -12.0953 0.282
NP_442232.1_3 Forward -318 -299 -13.1769 0.282
NP_441482.1_7 Forward -316 -302 0.294584 0.0586
NP_441482.1_7 Reverse -295 -309 -8.65353 0.193
NP_439944.1_9 Reverse -302 -312 19.0562 0.00329
NP_439944.1_9 Forward -309 -299 10.3048 0.0887
NP_439944.1_9 Reverse -131 -141 5.28991 0.262
NP_441028.1_6 Forward -339 -329 6.0761 0.232
NP_440115.1_6 Forward -313 -303 9.41981 0.115
NP_440007.1_9 Reverse -297 -311 4.03116 0.267
NP_439965.1_1 Forward -319 -300 35.3986 0.00000522
NP_439965.1_1 Reverse -292 -311 -6.78538 0.218
NP_439965.1_2 Forward -394 -375 33.0387 0.0000169
NP_439965.1_5 Forward -147 -128 31.7594 0.0000394
NP_439965.1_7 Forward -246 -227 21.5134 0.0554
NP_441347.1_5 Forward -316 -302 11.7987 0.246
NP_441972.1_5 Reverse -302 -321 -5.11376 0.215
NP_441106.1_1 Reverse -300 -309 18.191 0.0028
NP_441106.1_1 Forward -311 -302 9.63616 0.0311
NP_441106.1_1 Reverse -129 -138 4.42462 0.226
NP_440429.1_2 Forward -315 -296 14.5524 0.176
NP_439903.1_6 Forward -313 -294 -0.787962 0.285
NP_441286.1_1 Forward -311 -299 14.4936 0.00418
NP_441286.1_1 Reverse -300 -312 11.8387 0.0114
NP_440670.1_8 Forward -310 -301 18.3876 0.000699
NP_440670.1_8 Reverse -301 -310 18.3876 0.000699
NP_441705.1_3 Forward -297 -278 -6.58872 0.291
NP_440886.1_7 Reverse -300 -310 17.7774 0.0011
NP_440886.1_7 Forward -311 -301 7.94438 0.0805
NP_440828.1_1 Reverse -163 -182 3.63691 0.219
NP_442614.1_2 Reverse -301 -315 15.4376 0.0773
NP_442072.1_9 Forward -311 -293 -4.20908 0.0413
NP_442213.1_6 Reverse -122 -141 8.16093 0.246
NP_440028.1_6 Forward -181 -163 12.5072 0.24
NP_441808.1_2 Reverse -227 -246 7.57094 0.261
NP_440907.2_4 Forward -279 -260 18.8735 0.15
NP_440907.2_8 Forward -309 -299 7.84605 0.117
NP_440907.2_8 Reverse -131 -141 6.76441 0.15
NP_442264.1_2 Reverse -382 -399 5.44704 0.276
NP_441463.1_3 Forward -320 -301 -4.03212 0.191
NP_441463.1_3 Reverse -291 -310 -8.26035 0.267
NP_441463.1_6 Reverse -299 -313 8.44524 0.25
NP_441463.1_6 Forward -312 -298 5.64286 0.287
NP_441626.1_2 Forward -309 -302 15.7721 0.0124
NP_441626.1_2 Reverse -302 -309 15.7721 0.0124
NP_441626.1_6 Reverse -297 -315 9.55647 0.222
NP_440107.1_5 Reverse -300 -319 -2.85214 0.178
NP_442794.1_1 Reverse -220 -232 10.1671 0.0721
NP_442794.1_1 Forward -314 -302 9.97041 0.0742
NP_442615.1_1 Forward -319 -301 9.95058 0.0228
NP_442615.1_1 Reverse -292 -310 6.70565 0.034
NP_441962.1_4 Forward -315 -296 -3.54046 0.149
NP_440387.1_1 Reverse -301 -317 4.3851 0.0426
NP_440387.1_1 Forward -310 -294 -0.43312 0.138
NP_441431.1_7 Forward -137 -118 20.4633 0.0491
NP_441993.1_1 Forward -145 -126 2.1416 0.262
NP_440358.1_8 Forward -202 -183 7.17762 0.174
NP_440114.1_10 Reverse -130 -144 9.73436 0.164
NP_440114.1_10 Forward -310 -296 7.57108 0.231
NP_440311.1_5 Forward -200 -186 18.7801 0.284
NP_441510.2_7 Reverse -295 -309 12.3887 0.28
NP_441552.1_3 Forward -317 -298 17.7965 0.123
NP_440766.1_4 Reverse -297 -311 8.55439 0.0871
NP_440766.1_4 Forward -314 -300 7.76774 0.0871
NP_440766.1_5 Forward -204 -192 9.27915 0.275
NP_439988.1_3 Forward -99 -85 8.94771 0.249
NP_441237.1_9 Forward -400 -390 10.5998 0.224
NP_441979.1_5 Reverse -295 -314 -11.8003 0.228
NP_442743.1_4 Forward -309 -290 -8.55534 0.296
NP_442743.1_5 Reverse -302 -321 17.994 0.0604
NP_442743.1_5 Forward -315 -296 9.0459 0.148
NP_442743.1_5 Forward -309 -290 6.88262 0.173
NP_439910.1_2 Reverse -122 -139 -13.0392 0.127
NP_439910.1_2 Reverse -293 -310 -21.3973 0.183
NP_440457.1_1 Forward -314 -302 10.8554 0.092
NP_440457.1_1 Reverse -297 -309 7.02048 0.105
NP_442509.1_9 Forward -310 -300 16.2041 0.00739
NP_442509.1_9 Reverse -301 -311 8.14104 0.192
NP_440554.1_4 Forward -309 -299 14.6313 0.02
NP_440554.1_4 Reverse -225 -235 13.8447 0.023
NP_440554.1_4 Reverse -302 -312 7.05986 0.106
NP_440554.1_4 Forward -138 -128 5.78156 0.132
NP_441885.1_5 Reverse -301 -311 20.9245 0.000538
NP_441885.1_5 Forward -310 -300 11.4848 0.00668
NP_441885.1_5 Forward -139 -129 -1.29827 0.259
NP_442341.1_7 Forward -311 -297 19.7641 0.00702
NP_442341.1_7 Reverse -300 -314 6.3911 0.127
NP_442341.1_9 Reverse -299 -313 16.1252 0.0386
NP_442395.2_4 Reverse -300 -319 7.4718 0.139
NP_443000.1_3 Forward -230 -211 11.7164 0.255
NP_443000.1_7 Forward -312 -302 17.0896 0.00865
NP_443000.1_7 Reverse -299 -309 8.73149 0.0437
NP_443000.1_7 Forward -124 -114 1.65166 0.235
NP_440727.1_2 Forward -130 -111 1.27776 0.288
NP_441842.1_10 Reverse -294 -308 9.73436 0.182
NP_440275.1_3 Reverse -299 -309 8.4365 0.0602
NP_440275.1_3 Forward -312 -302 8.1415 0.0602
NP_440091.1_1 Reverse -297 -309 10.7571 0.0429
NP_440091.1_1 Forward -314 -302 8.9871 0.0567
NP_443060.1_5 Forward -318 -299 13.47 0.109
NP_443010.1_10 Reverse -298 -315 6.53951 0.182
NP_441359.1_5 Forward -313 -294 9.14423 0.159
NP_442451.1_2 Reverse -262 -281 -3.54046 0.195
NP_442451.1_2 Reverse -293 -312 -5.80207 0.226
NP_440804.1_7 Forward -22 -5 5.93797 0.291
NP_440149.1_8 Reverse -301 -320 -7.17871 0.275
NP_441105.1_3 Forward -321 -302 2.26107 0.106
NP_441105.1_3 Reverse -290 -309 1.57275 0.113
NP_440216.1_1 Forward -310 -296 8.25939 0.0061
NP_440216.1_1 Reverse -301 -315 -1.27871 0.0303
NP_440216.1_1 Forward -139 -125 -3.54032 0.0833
NP_440216.1_6 Reverse -294 -310 15.7915 0.0619
NP_440172.1_1 Reverse -301 -311 15.0247 0.00945
NP_440172.1_1 Forward -310 -300 8.73149 0.0586
NP_440172.1_1 Forward -122 -112 2.14332 0.283
NP_442015.1_10 Reverse -297 -310 10.639 0.0391
NP_442015.1_10 Forward -314 -301 9.16406 0.053
NP_442015.1_10 Forward -126 -113 1.49425 0.204
NP_441226.1_7 Forward -309 -302 14.4934 0.0123
NP_441226.1_7 Reverse -302 -309 14.4934 0.0123
NP_441226.1_7 Forward -138 -131 11.2485 0.0971
NP_441226.1_7 Reverse -295 -302 9.47853 0.147
NP_441111.1_7 Forward -309 -301 18.7023 0.00294
NP_441111.1_7 Reverse -302 -310 18.7023 0.00294
NP_442379.1_10 Forward -317 -300 -1.14113 0.223
NP_441766.1_2 Forward -310 -301 17.5026 0.00297
NP_441766.1_2 Reverse -301 -310 17.5026 0.00297
NP_441766.1_2 Reverse -224 -233 5.40793 0.122
NP_442417.1_5 Forward -310 -296 11.5043 0.0983
NP_440416.1_9 Reverse -294 -313 -6.58872 0.0913
NP_440416.1_9 Forward -317 -298 -8.45701 0.117
NP_440416.1_9 Reverse -206 -225 -19.5684 0.276
NP_443052.1_8 Reverse -291 -310 0.196116 0.0669
NP_440072.1_5 Forward -231 -213 -0.275845 0.238
NP_441940.1_4 Reverse -299 -318 6.98095 0.286
NP_442154.1_1 Forward -181 -163 -17.4838 0.257
NP_440261.1_5 Forward -121 -108 -4.9956 0.183
NP_440261.1_5 Forward -309 -296 -10.5021 0.201
NP_440261.1_5 Reverse -302 -315 -10.6005 0.201
NP_440261.1_5 Reverse -131 -144 -12.0754 0.27
NP_440988.1_10 Forward -306 -292 15.2578 0.125
NP_440988.1_10 Reverse -305 -319 8.67452 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCATTGCCCACACCCTCTGGTTGGGAACCACTTTTACTCTGGTTACCAGCTTGGGATTAATTGCCCACCATTGCTTTGCAGTCTGGCATGGCGATCGCCGTTGGCAACACAAATATGGCGAGGCTTTTCTAGCAGTGAAACAAAGAACTTCCATCATTCCCTTTCAAGCGATCTGGGAGGGAAGGCAAATTCTAGTGTGGCAGGAATTTATCAAACCAGCCTATGTGGGGGTAATGGGTTTCATTGCCCTACTATGGTGGGGCCATCCCTGGTTGATGGTGATGACCTCCAGAGTTAATTGGTAGGGCTTGTGGCTTGGTTTAACCGCACGGGGAAGATATTCTGGGGATGCACTGTAATCTGCAATAATCCCCTAATTTTTAGGCTTAATTCAATTTT

CDS

ATGGACGATACTAACACCACATTACTGCTCAAGCGTCCCGTGGCCCTGAAGGTGATTGTCACTCCCCGCTGGAAAGAGGAGATGCAACAACAACTCCAAGCCCAGGTGGGCCAGATGGATAATCAGGTGCAACAGCTTGATGCCCAAAGTCAACGAGCGATCGCCGAAATTAAAAAACAAAGCTTGGTGCCCCTCCCCCCCAGTGTCAGCCAGCAAATTGAAAACATTCAAATGCAGGTCAACCAACAAAAGAGCGAAATTCTGGAGCAGAAAAACCAAGCCCTGCAACAAATGCAACAGGTGCAGTTATTAGAACTGAACCAAGAAGTCATCCAAGGACAGATGGAGAGCTTTTTCCGTATCCAAAAGGGGGACAACCTCGTGCAGAAAATGGGAGTGGAATTGGTACTGCGGGATGGGGTAGTGGAGGAAATCCGGGGTGAACTCTAG

Protein

MDDTNTTLLLKRPVALKVIVTPRWKEEMQQQLQAQVGQMDNQVQQLDAQSQRAIAEIKKQSLVPLPPSVSQQIENIQMQVNQQKSEILEQKNQALQQMQQVQLLELNQEVIQGQMESFFRIQKGDNLVQKMGVELVLRDGVVEEIRGEL