Your browser is old and dusty. Try Google Chrome!

Details for slr1599

ORF slr1599
Accession NP_440323.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -245 -231 1.67122 0.183
NP_440557.1_1 Forward -245 -226 -1.7705 0.277
NP_440795.1_7 Forward -245 -238 14.6904 0.0123
NP_440795.1_7 Reverse -238 -245 14.6904 0.0123
NP_442291.1_5 Reverse -236 -252 5.56507 0.0762
NP_442291.1_5 Forward -247 -231 -4.66135 0.281
NP_440897.1_6 Forward -293 -274 -0.787962 0.185
NP_441453.1_4 Reverse -237 -245 16.539 0.00633
NP_441453.1_4 Forward -246 -238 16.539 0.00633
NP_441453.1_4 Forward -123 -115 4.34598 0.257
NP_441623.1_1 Reverse -24 -42 8.86894 0.108
NP_442151.1_1 Forward -305 -286 8.65258 0.27
NP_442151.1_6 Reverse -237 -251 9.73436 0.141
NP_441818.1_1 Reverse -238 -249 10.1862 0.232
NP_441818.1_1 Forward -245 -234 9.69459 0.232
NP_441818.1_9 Reverse -106 -125 -1.47551 0.2
NP_440226.1_1 Forward -246 -227 17.2074 0.0197
NP_440226.1_1 Reverse -237 -256 6.19431 0.135
NP_441630.1_3 Forward -32 -13 4.12936 0.173
NP_442173.1_1 Forward -245 -237 15.4574 0.00633
NP_442173.1_1 Reverse -238 -246 15.4574 0.00633
NP_442752.1_3 Forward -328 -318 14.696 0.288
NP_442752.1_4 Forward -246 -239 13.8055 0.0199
NP_442752.1_4 Reverse -237 -244 13.8055 0.0199
NP_443027.1_4 Reverse -235 -245 14.828 0.0437
NP_443027.1_4 Reverse -112 -122 9.7148 0.153
NP_443027.1_4 Forward -125 -115 5.87989 0.294
NP_441812.1_3 Forward -247 -233 9.04604 0.245
NP_442975.1_10 Reverse -233 -247 13.8636 0.0459
NP_441470.1_4 Reverse -163 -182 13.8641 0.147
NP_440784.1_7 Forward -245 -238 15.9687 0.0123
NP_440784.1_7 Reverse -238 -245 15.9687 0.0123
NP_442062.1_8 Forward -246 -236 19.4496 0.000558
NP_442062.1_8 Reverse -237 -247 17.3846 0.00193
NP_442062.1_8 Forward -225 -215 10.2065 0.0504
NP_441859.1_3 Reverse -243 -262 9.04509 0.131
NP_441859.1_3 Forward -226 -207 4.12856 0.228
NP_440304.1_4 Reverse -235 -245 10.8948 0.051
NP_440304.1_4 Reverse -214 -224 4.20827 0.272
NP_440304.1_4 Forward -248 -238 1.84832 0.299
NP_442242.1_4 Forward -245 -238 14.3954 0.0124
NP_442242.1_4 Reverse -238 -245 14.3954 0.0124
NP_440044.1_8 Reverse -238 -257 13.6675 0.0333
NP_441781.1_7 Forward -246 -227 -1.7705 0.279
NP_440908.1_5 Reverse -24 -41 14.0018 0.161
NP_441200.1_4 Reverse -284 -303 6.09597 0.283
NP_441619.1_8 Forward -252 -238 11.1104 0.185
NP_441208.1_9 Forward -249 -235 11.5043 0.15
NP_442110.1_7 Forward -246 -232 1.57289 0.222
NP_441083.1_5 Reverse -237 -247 20.3345 0.00053
NP_441083.1_5 Forward -246 -236 11.3864 0.0159
NP_441083.1_5 Reverse -15 -25 -1.00328 0.289
NP_442827.1_8 Reverse -7 -26 -1.96793 0.264
NP_441434.1_7 Reverse -239 -253 6.78443 0.225
NP_441434.1_7 Forward -244 -230 5.89945 0.225
NP_441434.1_7 Reverse -17 -31 3.63784 0.23
NP_441738.1_2 Forward -244 -237 15.28 0.0102
NP_441738.1_2 Reverse -239 -246 15.28 0.0102
NP_440209.1_1 Reverse -237 -245 18.1123 0.00295
NP_440209.1_1 Forward -246 -238 18.1123 0.00295
NP_440209.1_1 Reverse -15 -23 2.1827 0.254
NP_442889.1_8 Reverse -234 -248 22.615 0.00144
NP_440407.1_6 Reverse -174 -188 10.1277 0.28
NP_441713.1_1 Reverse -231 -250 -8.752 0.157
NP_441713.1_1 Forward -252 -233 -15.3402 0.261
NP_441770.1_4 Reverse -32 -51 -12.6852 0.296
NP_440178.1_7 Forward -247 -228 -14.1602 0.149
NP_440178.1_7 Forward -25 -6 -21.535 0.229
NP_442570.1_3 Forward -301 -282 -1.7705 0.212
NP_442570.1_3 Forward -233 -214 -1.7705 0.212
NP_442570.1_3 Forward -302 -283 -4.42544 0.23
NP_442445.1_2 Reverse -191 -210 8.06259 0.288
NP_441716.1_1 Reverse -237 -251 6.6861 0.191
NP_441716.1_1 Forward -133 -119 6.09611 0.207
NP_441716.1_1 Forward -94 -80 5.89945 0.211
NP_441327.1_5 Reverse -177 -186 14.356 0.192
NP_442111.1_4 Forward -247 -233 8.94771 0.0661
NP_440906.1_5 Forward -245 -238 15.8704 0.0124
NP_440906.1_5 Reverse -238 -245 15.8704 0.0124
NP_441209.1_6 Reverse -345 -363 21.5589 0.0348
NP_440747.1_10 Forward -249 -237 14.9853 0.00221
NP_440747.1_10 Reverse -234 -246 -2.02597 0.0196
NP_441130.1_10 Reverse -235 -249 10.9143 0.109
NP_441486.1_1 Reverse -234 -248 22.5174 0.00162
NP_441486.1_1 Forward -249 -235 20.0591 0.00312
NP_441486.1_1 Forward -91 -77 10.4227 0.0207
NP_442760.1_5 Reverse -215 -227 15.4764 0.265
NP_440842.1_10 Forward -34 -20 5.50613 0.251
NP_440842.1_10 Reverse -213 -227 5.40779 0.251
NP_440842.1_10 Reverse -21 -35 2.65453 0.274
NP_441014.1_10 Reverse -310 -329 2.55527 0.216
NP_441014.1_10 Forward -247 -228 -3.14789 0.294
NP_442848.1_1 Forward -252 -238 5.80112 0.0803
NP_442848.1_1 Reverse -231 -245 3.93283 0.118
NP_443018.1_3 Forward -245 -238 14.8871 0.0123
NP_443018.1_3 Reverse -238 -245 14.8871 0.0123
NP_443018.1_3 Forward -122 -115 12.5271 0.0523
NP_443018.1_3 Reverse -115 -122 12.5271 0.0523
NP_443018.1_3 Reverse -285 -292 9.38056 0.128
NP_443018.1_3 Forward -224 -217 8.49558 0.141
NP_443018.1_3 Reverse -80 -87 4.26735 0.267
NP_443018.1_3 Forward -87 -80 4.07068 0.299
NP_441634.1_8 Forward -248 -234 5.1128 0.114
NP_440376.1_1 Forward -246 -237 19.4693 0.000692
NP_440376.1_1 Reverse -237 -246 19.4693 0.000692
NP_440376.1_1 Reverse -125 -134 1.1797 0.255
NP_441857.1_5 Forward -253 -235 9.0656 0.185
NP_441588.1_4 Reverse -239 -249 18.1713 0.0143
NP_441588.1_4 Forward -244 -234 6.96153 0.178
NP_441588.1_4 Reverse -26 -36 6.66654 0.185
NP_441588.1_4 Reverse -286 -296 5.09324 0.297
NP_442687.1_7 Reverse -236 -246 15.8113 0.0125
NP_442687.1_7 Forward -247 -237 8.92815 0.0994
NP_442958.1_3 Forward -134 -115 -2.55715 0.295
NP_440642.1_10 Reverse -36 -50 8.75042 0.198
NP_440642.1_10 Reverse -274 -288 2.8506 0.277
NP_441013.1_2 Forward -128 -110 7.98396 0.208
NP_440042.1_2 Forward -125 -106 -5.31042 0.296
NP_440533.1_9 Forward -246 -227 10.6192 0.131
NP_440360.1_10 Reverse -17 -31 2.5562 0.262
NP_442658.1_1 Reverse -235 -245 15.9091 0.00966
NP_442658.1_1 Reverse -77 -87 9.71433 0.147
NP_442658.1_1 Reverse -368 -378 8.23937 0.199
NP_442658.1_1 Forward -248 -238 6.76441 0.214
NP_442658.1_1 Forward -125 -115 5.97777 0.242
NP_442658.1_1 Reverse -214 -224 5.58445 0.262
NP_440141.1_8 Reverse -172 -191 8.94757 0.23
NP_440141.1_8 Reverse -207 -226 8.55425 0.23
NP_442782.1_2 Forward -246 -232 3.24451 0.267
NP_440656.1_2 Reverse -263 -282 0.884433 0.258
NP_442544.1_2 Forward -301 -287 8.06273 0.16
NP_441414.1_9 Reverse -237 -256 -1.67217 0.103
NP_441414.1_9 Forward -246 -227 -5.99873 0.185
NP_441487.1_9 Forward -233 -214 5.80098 0.131
NP_442937.1_5 Forward -298 -279 9.63589 0.185
NP_442937.1_5 Forward -251 -232 6.29264 0.282
NP_441958.1_5 Forward -247 -237 12.2714 0.00183
NP_441958.1_5 Reverse -236 -246 12.2714 0.00183
NP_442836.1_5 Forward -252 -233 6.78429 0.171
NP_440950.1_1 Forward -136 -117 4.32602 0.185
NP_439990.1_5 Forward -251 -238 9.95071 0.128
NP_442911.1_2 Reverse -227 -246 -4.03212 0.124
NP_442911.1_2 Reverse -206 -225 -10.1286 0.27
NP_441580.1_6 Reverse -226 -245 -6.58872 0.235
NP_442064.1_1 Forward -251 -232 -10.9153 0.259
NP_442064.1_4 Forward -127 -108 4.42355 0.287
NP_443055.1_6 Reverse -276 -294 -2.73484 0.299
NP_441429.1_4 Reverse -77 -96 10.9134 0.215
NP_440138.1_6 Forward -319 -300 4.12856 0.24
NP_440138.1_6 Reverse -232 -251 3.53858 0.242
NP_442002.1_9 Reverse -3 -10 11.1505 0.185
NP_442002.1_9 Reverse -236 -243 10.7572 0.185
NP_441294.1_7 Reverse -233 -247 18.7535 0.0046
NP_441294.1_7 Forward -250 -236 11.3624 0.147
NP_440106.1_2 Reverse -115 -133 9.45892 0.298
NP_441424.1_6 Forward -307 -288 14.8825 0.263
NP_442438.1_10 Reverse -232 -246 20.4524 0.0124
NP_442438.1_10 Forward -251 -237 1.17956 0.204
NP_442431.1_10 Reverse -103 -121 8.7706 0.143
NP_441000.1_6 Forward -247 -233 5.30946 0.0933
NP_441000.1_6 Reverse -236 -250 3.93283 0.101
NP_442771.1_1 Forward -248 -230 -4.70074 0.166
NP_440147.1_4 Forward -248 -235 10.049 0.0355
NP_440147.1_4 Reverse -235 -248 3.46087 0.187
NP_440147.1_4 Forward -227 -214 -0.37404 0.282
NP_441295.1_4 Reverse -285 -304 0.687771 0.29
NP_441295.1_5 Reverse -226 -245 19.764 0.0675
NP_441550.1_8 Forward -248 -238 14.6309 0.0132
NP_441550.1_8 Reverse -235 -245 6.0761 0.214
NP_441916.1_7 Forward -246 -236 18.4663 0.00144
NP_441916.1_7 Reverse -237 -247 10.3048 0.0261
NP_441916.1_7 Reverse -15 -25 2.33998 0.258
NP_441041.1_4 Forward -246 -227 -1.37718 0.1
NP_441041.1_4 Reverse -237 -256 -10.4236 0.232
NP_441041.1_7 Forward -249 -237 11.8878 0.0689
NP_441041.1_7 Reverse -234 -246 10.916 0.0864
NP_442396.1_5 Forward -250 -237 10.7374 0.106
NP_442396.1_5 Reverse -233 -246 5.91914 0.26
NP_441547.1_2 Forward -298 -280 13.0972 0.107
NP_442004.1_6 Forward -246 -232 2.94952 0.254
NP_440703.1_9 Reverse -158 -171 5.62358 0.292
NP_441725.1_5 Forward -245 -235 11.2881 0.0247
NP_441725.1_5 Forward -224 -214 4.89658 0.115
NP_441725.1_5 Reverse -238 -248 2.04498 0.115
NP_441725.1_5 Reverse -16 -26 -0.314959 0.246
NP_439966.1_7 Reverse -235 -245 18.4657 0.00473
NP_439966.1_7 Forward -248 -238 7.25606 0.15
NP_439966.1_7 Reverse -282 -292 4.7978 0.258
NP_439966.1_7 Reverse -22 -32 4.10949 0.289
NP_439966.1_9 Reverse -235 -244 0.983037 0.253
NP_440202.1_9 Forward -73 -54 15.9291 0.0752
NP_442941.1_3 Forward -245 -235 11.4848 0.0116
NP_442941.1_3 Reverse -238 -248 11.0914 0.0116
NP_440289.1_2 Reverse -234 -247 21.3571 0.00262
NP_440289.1_2 Forward -249 -236 -2.144 0.251
NP_440260.1_8 Forward -302 -284 -2.14413 0.243
NP_442281.1_1 Forward -128 -114 12.5853 0.0358
NP_442281.1_1 Reverse -232 -246 10.422 0.0589
NP_442281.1_1 Reverse -74 -88 6.88214 0.113
NP_440437.1_1 Reverse -9 -28 -5.21209 0.276
NP_442500.1_8 Reverse -146 -160 9.11791 0.285
NP_442049.1_6 Forward -301 -282 6.4893 0.215
NP_440498.1_1 Reverse -228 -246 9.26226 0.0786
NP_441644.1_6 Reverse -237 -247 17.3841 0.00127
NP_441644.1_6 Reverse -284 -294 10.9926 0.058
NP_441644.1_6 Forward -123 -113 10.796 0.0609
NP_441644.1_6 Forward -246 -236 10.1076 0.0628
NP_443049.1_6 Forward -25 -15 13.8856 0.139
NP_440867.1_10 Forward -240 -221 3.34271 0.283
NP_440867.1_10 Forward -294 -275 1.86774 0.291
NP_442215.1_2 Reverse -235 -251 4.68009 0.0831
NP_442215.1_2 Forward -248 -232 4.48343 0.0838
NP_442215.1_2 Forward -90 -74 2.51681 0.114
NP_442215.1_2 Forward -132 -116 0.451859 0.151
NP_442215.1_2 Forward -302 -286 -5.34967 0.249
NP_442029.1_6 Reverse -109 -128 6.09597 0.244
NP_440929.1_8 Forward -246 -237 19.2726 0.000701
NP_440929.1_8 Reverse -237 -246 19.2726 0.000701
NP_440469.1_1 Reverse -59 -78 26.1555 0.00418
NP_440469.1_5 Reverse -86 -105 20.649 0.0309
NP_442933.1_10 Forward -246 -237 17.601 0.00325
NP_442933.1_10 Reverse -237 -246 17.601 0.00325
NP_441751.2_8 Forward -245 -231 5.60446 0.0419
NP_441751.2_8 Reverse -238 -252 4.71948 0.047
NP_441751.2_8 Reverse -16 -30 -0.295402 0.125
NP_442554.1_8 Reverse -238 -248 15.3197 0.00882
NP_442554.1_8 Forward -245 -235 13.8447 0.0145
NP_442554.1_8 Forward -122 -112 11.4848 0.0355
NP_442554.1_8 Reverse -285 -295 3.32329 0.23
NP_442554.1_8 Reverse -115 -125 2.33998 0.274
NP_441762.1_7 Reverse -236 -248 9.57708 0.0142
NP_441762.1_7 Forward -247 -235 2.89058 0.0676
NP_442142.1_4 Reverse -234 -247 15.85 0.0264
NP_442142.1_4 Forward -249 -236 13.49 0.0348
NP_442292.1_1 Reverse -238 -247 18.486 0.00229
NP_442292.1_1 Forward -245 -236 9.63616 0.0183
NP_442292.1_1 Forward -122 -113 4.22796 0.181
NP_442476.1_6 Forward -245 -231 3.63784 0.155
NP_441711.1_4 Reverse -45 -64 7.96426 0.144
NP_443009.1_5 Forward -247 -236 18.3477 0.00265
NP_443009.1_5 Reverse -310 -321 6.44969 0.161
NP_441371.1_3 Reverse -262 -280 6.80398 0.277
NP_441715.1_4 Forward -245 -235 16.303 0.0117
NP_441715.1_4 Reverse -238 -248 7.94484 0.107
NP_440015.1_9 Forward -246 -228 17.3254 0.0329
NP_440777.1_9 Reverse -167 -186 8.16093 0.222
NP_440183.1_9 Reverse -17 -36 -15.7335 0.273
NP_440183.1_9 Reverse -48 -67 -21.24 0.299
NP_440464.1_10 Reverse -238 -248 13.0082 0.169
NP_441468.1_1 Forward -245 -238 15.8704 0.0124
NP_441468.1_1 Reverse -238 -245 15.8704 0.0124
NP_441468.1_1 Reverse -80 -87 4.07068 0.263
NP_441468.1_1 Reverse -115 -122 3.97235 0.277
NP_441468.1_1 Forward -122 -115 3.97235 0.277
NP_441020.2_6 Forward -248 -231 5.54538 0.298
NP_441015.1_8 Reverse -130 -149 7.7676 0.258
NP_441015.1_10 Reverse -109 -128 -0.885524 0.169
NP_441015.1_10 Forward -298 -279 -10.0303 0.282
NP_441673.1_1 Forward -246 -237 20.8459 0.000698
NP_441673.1_1 Reverse -237 -246 20.8459 0.000698
NP_441244.1_8 Forward -290 -271 1.37609 0.288
NP_441876.1_9 Reverse -43 -53 13.3526 0.267
NP_441876.1_9 Forward -131 -121 10.5993 0.287
NP_441826.1_2 Forward -252 -238 3.44117 0.11
NP_441826.1_2 Reverse -231 -245 2.5562 0.125
NP_441826.1_2 Forward -231 -217 -1.37704 0.245
NP_441826.1_2 Forward -30 -16 -3.63866 0.286
NP_441826.1_6 Reverse -81 -95 12.8809 0.266
NP_442745.1_6 Reverse -124 -143 11.6025 0.258
NP_441764.1_8 Forward -44 -34 14.9475 0.284
NP_441764.1_8 Reverse -199 -209 12.0764 0.284
NP_442868.1_6 Forward -248 -238 9.81313 0.038
NP_442868.1_6 Reverse -235 -245 0.963343 0.205
NP_442719.1_2 Forward -196 -178 -9.81463 0.267
NP_441612.1_2 Reverse -237 -247 8.54929 0.21
NP_443058.1_7 Forward -247 -228 4.52268 0.258
NP_442427.1_8 Reverse -171 -190 7.27595 0.216
NP_442808.1_1 Reverse -236 -246 18.4657 0.00201
NP_442808.1_1 Forward -247 -237 8.63269 0.0481
NP_442808.1_1 Reverse -283 -293 7.64939 0.0729
NP_442808.1_1 Reverse -14 -24 6.27276 0.121
NP_442808.1_1 Reverse -229 -239 3.61784 0.234
NP_442808.1_1 Reverse -23 -33 0.864583 0.3
NP_440145.1_3 Forward -256 -237 5.211 0.0695
NP_440145.1_3 Reverse -227 -246 -2.45882 0.17
NP_440145.1_4 Reverse -277 -287 14.4342 0.241
NP_442050.1_1 Forward -60 -41 6.29264 0.292
NP_442050.1_5 Reverse -235 -245 9.12434 0.193
NP_442050.1_5 Forward -248 -238 7.64939 0.243
NP_441114.1_3 Forward -319 -310 15.831 0.193
NP_440558.1_2 Reverse -228 -247 -5.21209 0.254
NP_440558.1_2 Reverse -105 -124 -6.39206 0.274
NP_440923.1_4 Reverse -277 -296 3.83436 0.197
NP_441518.1_3 Reverse -227 -246 -8.35868 0.186
NP_442792.1_5 Forward -145 -128 9.97027 0.285
NP_441878.1_6 Forward -247 -237 10.4031 0.0176
NP_441878.1_6 Reverse -236 -246 10.4031 0.0176
NP_441878.1_6 Reverse -215 -225 2.24165 0.0462
NP_441878.1_6 Reverse -78 -88 -7.98478 0.285
NP_441036.1_8 Reverse -236 -246 17.7779 0.000554
NP_441036.1_8 Forward -247 -237 8.33817 0.174
NP_441557.1_5 Forward -246 -237 19.9609 0.000699
NP_441557.1_5 Reverse -237 -246 19.9609 0.000699
NP_441557.1_8 Reverse -40 -50 10.6976 0.28
NP_441445.1_1 Forward -255 -236 16.6174 0.0359
NP_441445.1_1 Reverse -228 -247 2.26107 0.238
NP_442066.2_4 Reverse -15 -34 -9.34199 0.298
NP_441433.1_8 Forward -299 -280 -1.57384 0.262
NP_441433.1_8 Reverse -132 -151 -2.55715 0.27
NP_442419.1_2 Forward -128 -109 6.98095 0.144
NP_441739.1_2 Forward -364 -348 5.46605 0.228
NP_441308.1_8 Reverse -235 -245 10.1081 0.22
NP_441458.1_10 Forward -255 -236 3.6377 0.244
NP_442183.1_1 Forward -246 -232 11.406 0.0702
NP_442183.1_1 Forward -225 -211 5.1128 0.231
NP_442347.1_2 Reverse -238 -247 12.4878 0.056
NP_442347.1_2 Forward -245 -236 11.1111 0.056
NP_442347.1_2 Forward -132 -123 8.35786 0.0927
NP_442645.1_2 Forward -254 -235 -3.04881 0.0487
NP_442645.1_2 Reverse -229 -248 -13.7669 0.164
NP_441037.1_4 Forward -248 -238 7.9999 0.237
NP_441037.1_4 Reverse -62 -72 7.51261 0.237
NP_441037.1_4 Reverse -235 -245 7.02532 0.237
NP_441633.1_3 Forward -248 -235 8.47575 0.0377
NP_441633.1_3 Reverse -235 -248 -3.71729 0.177
NP_441633.1_3 Reverse -37 -50 -6.07724 0.236
NP_440136.1_2 Forward -245 -238 15.9687 0.0123
NP_440136.1_2 Reverse -238 -245 15.9687 0.0123
NP_442590.1_10 Forward -306 -287 4.22769 0.278
NP_442998.1_5 Reverse -178 -188 12.6647 0.162
NP_442998.1_5 Forward -280 -270 11.6814 0.179
NP_442998.1_10 Forward -244 -237 15.5754 0.0102
NP_442998.1_10 Reverse -239 -246 15.5754 0.0102
NP_442998.1_10 Reverse -17 -24 12.5271 0.0457
NP_442998.1_10 Reverse -26 -33 4.07068 0.276
NP_440899.1_1 Reverse -103 -122 17.0931 0.0659
NP_440299.1_1 Forward -250 -237 10.3434 0.0573
NP_440299.1_1 Reverse -233 -246 8.18017 0.0964
NP_440299.1_1 Reverse -286 -299 5.0336 0.191
NP_440299.1_1 Forward -92 -79 3.7553 0.232
NP_441799.1_1 Forward -250 -236 17.4035 0.011
NP_441799.1_1 Reverse -233 -247 10.0287 0.0797
NP_440640.1_8 Forward -181 -162 16.9124 0.156
NP_440640.1_9 Reverse -216 -235 12.7825 0.281
NP_441007.1_10 Forward -29 -16 1.00259 0.209
NP_442334.1_2 Forward -34 -17 -13.2358 0.297
NP_440256.1_1 Forward -249 -230 13.3725 0.0103
NP_440256.1_1 Reverse -308 -327 -1.96717 0.111
NP_440256.1_1 Reverse -287 -306 -6.09707 0.201
NP_440256.1_1 Forward -296 -277 -7.17871 0.231
NP_440256.1_1 Reverse -234 -253 -7.86702 0.247
NP_440256.1_1 Reverse -219 -238 -9.73531 0.287
NP_440915.1_6 Reverse -233 -247 3.63784 0.101
NP_440915.1_6 Forward -250 -236 1.67122 0.132
NP_440915.1_6 Forward -127 -113 -0.197071 0.186
NP_442158.1_4 Forward -207 -197 14.828 0.176
NP_442158.1_4 Forward -351 -341 11.6814 0.265
NP_441179.1_9 Forward -125 -115 13.6475 0.246
NP_441179.1_9 Reverse -282 -292 9.41933 0.28
NP_440717.1_3 Reverse -279 -293 10.2254 0.231
NP_442866.1_1 Forward -178 -159 -0.4922 0.193
NP_440748.1_5 Forward -318 -299 5.01433 0.195
NP_441464.1_8 Reverse -237 -251 3.93283 0.283
NP_441464.1_10 Forward -35 -21 12.586 0.201
NP_442993.1_1 Forward -246 -230 10.1866 0.0169
NP_442386.1_9 Reverse -236 -245 15.7322 0.0144
NP_442386.1_9 Forward -247 -238 13.8639 0.0289
NP_442386.1_9 Forward -124 -115 13.1756 0.0406
NP_442386.1_9 Reverse -283 -292 10.324 0.132
NP_440570.1_5 Forward -127 -108 2.45773 0.234
NP_441750.1_4 Forward -127 -108 5.80098 0.185
NP_441340.1_5 Forward -245 -238 15.6737 0.0124
NP_441340.1_5 Reverse -238 -245 15.6737 0.0124
NP_441340.1_5 Reverse -115 -122 4.07068 0.239
NP_441340.1_5 Forward -122 -115 4.07068 0.239
NP_441340.1_5 Forward -87 -80 3.97235 0.274
NP_441340.1_9 Reverse -199 -209 8.15881 0.256
NP_442186.1_4 Forward -66 -48 13.0972 0.277
NP_442791.1_5 Reverse -229 -248 -11.2103 0.287
NP_442791.1_5 Forward -254 -235 -11.8986 0.29
NP_440168.1_4 Reverse -280 -299 -5.01543 0.255
NP_440194.1_3 Forward -256 -237 1.86774 0.271
NP_442240.1_2 Reverse -115 -134 -10.9153 0.137
NP_440586.1_8 Forward -245 -238 13.2151 0.026
NP_440586.1_8 Reverse -238 -245 13.2151 0.026
NP_440586.1_8 Forward -87 -80 9.57686 0.146
NP_440586.1_8 Forward -122 -115 7.61025 0.227
NP_440586.1_8 Reverse -115 -122 7.61025 0.227
NP_442251.1_6 Forward -245 -238 15.2804 0.0124
NP_442251.1_6 Reverse -238 -245 15.2804 0.0124
NP_441262.1_3 Reverse -237 -244 14.7888 0.0223
NP_441262.1_3 Forward -246 -239 14.7888 0.0223
NP_440027.1_3 Reverse -284 -302 12.5064 0.159
NP_440027.1_3 Forward -133 -115 4.93494 0.249
NP_440027.1_3 Reverse -227 -245 3.8533 0.263
NP_440027.1_3 Reverse -216 -234 3.8533 0.263
NP_440027.1_3 Reverse -237 -255 2.57501 0.289
NP_440027.1_3 Reverse -69 -87 2.18168 0.292
NP_443051.1_1 Reverse -236 -245 10.4228 0.00754
NP_443051.1_1 Forward -247 -238 10.4228 0.00754
NP_439996.1_6 Forward -205 -186 8.88508 0.242
NP_439984.1_1 Forward -366 -347 17.1392 0.0941
NP_439937.1_9 Reverse -236 -253 -16.4814 0.287
NP_439937.1_9 Forward -247 -230 -16.7764 0.287
NP_440408.1_7 Reverse -108 -127 8.16093 0.282
NP_440439.1_1 Reverse -234 -247 1.19926 0.159
NP_440372.1_2 Forward -245 -238 16.3621 0.0124
NP_440372.1_2 Reverse -238 -245 16.3621 0.0124
NP_440271.1_2 Reverse -128 -147 1.37609 0.284
NP_440991.1_9 Forward -125 -106 17.109 0.177
NP_440316.1_10 Forward -294 -284 8.73149 0.239
NP_440316.1_10 Forward -25 -15 5.78156 0.281
NP_442488.1_7 Reverse -146 -165 19.0757 0.0841
NP_439977.1_5 Reverse -326 -345 3.53937 0.159
NP_439977.1_5 Reverse -231 -250 -3.24547 0.298
NP_440139.1_1 Reverse -231 -250 18.2882 0.0402
NP_441572.1_7 Reverse -231 -250 3.24438 0.119
NP_441572.1_7 Reverse -44 -63 -1.47551 0.188
NP_442384.1_10 Reverse -237 -250 9.06573 0.0574
NP_442384.1_10 Forward -246 -233 7.39411 0.0822
NP_442384.1_10 Reverse -79 -92 2.67422 0.216
NP_441018.1_7 Forward -250 -231 7.47261 0.269
NP_442790.1_4 Forward -33 -14 -15.6352 0.295
NP_442262.1_10 Forward -245 -238 14.1988 0.0123
NP_442262.1_10 Reverse -238 -245 14.1988 0.0123
NP_442262.1_10 Forward -122 -115 10.4622 0.145
NP_442262.1_10 Reverse -115 -122 10.4622 0.145
NP_442262.1_10 Reverse -285 -292 9.47889 0.187
NP_442262.1_10 Forward -224 -217 8.59391 0.22
NP_441689.1_5 Reverse -235 -245 8.53436 0.132
NP_441689.1_5 Forward -248 -238 5.78111 0.197
NP_440163.1_10 Reverse -234 -244 15.2213 0.0762
NP_442165.1_2 Forward -391 -378 16.9322 0.277
NP_440344.1_10 Reverse -230 -247 12.6252 0.006
NP_440344.1_10 Forward -253 -236 -2.3211 0.0643
NP_440531.1_6 Reverse -71 -90 6.98095 0.102
NP_440531.1_6 Forward -254 -235 -4.52377 0.282
NP_440531.1_6 Forward -63 -44 -4.81876 0.287
NP_441965.1_10 Reverse -234 -250 2.32015 0.288
NP_442065.1_5 Reverse -40 -59 -1.27885 0.197
NP_442065.1_7 Forward -255 -237 9.75391 0.17
NP_440297.1_9 Forward -122 -112 9.51814 0.0917
NP_440297.1_9 Forward -245 -235 9.32148 0.0917
NP_440297.1_9 Reverse -65 -75 3.81494 0.26
NP_440297.1_9 Reverse -238 -248 -0.118297 0.282
NP_440297.1_9 Forward -145 -135 -0.314959 0.282
NP_440350.1_5 Forward -164 -145 -4.42544 0.273
NP_442280.1_10 Forward -303 -285 9.64264 0.232
NP_441592.1_4 Forward -140 -121 -0.4922 0.244
NP_441103.1_9 Forward -185 -175 12.4895 0.291
NP_441679.1_1 Forward -291 -272 -2.16383 0.212
NP_442067.1_4 Reverse -226 -245 6.78429 0.207
NP_440999.1_9 Reverse -233 -247 4.62115 0.116
NP_440888.1_2 Forward -246 -232 17.3052 0.00418
NP_440888.1_2 Reverse -237 -251 10.5204 0.0919
NP_442147.1_7 Forward -255 -236 10.4225 0.244
NP_439969.1_3 Forward -138 -119 -0.983855 0.271
NP_442948.1_2 Forward -344 -325 2.94938 0.296
NP_441543.1_2 Forward -245 -236 18.486 0.00236
NP_441543.1_2 Reverse -238 -247 16.9127 0.00359
NP_442845.1_2 Forward -299 -285 12.9793 0.1
NP_442845.1_2 Reverse -231 -245 7.27608 0.195
NP_442845.1_2 Forward -252 -238 4.22782 0.264
NP_441319.1_8 Reverse -284 -302 4.44404 0.297
NP_442710.1_4 Reverse -132 -151 17.2346 0.232
NP_441469.1_4 Reverse -121 -140 11.1109 0.249
NP_441469.1_8 Reverse -236 -245 16.126 0.00797
NP_441469.1_8 Forward -247 -238 6.48957 0.227
NP_441469.1_8 Forward -124 -115 5.60459 0.258
NP_443064.1_6 Reverse -237 -247 12.5669 0.0796
NP_443064.1_6 Forward -74 -64 10.5308 0.148
NP_442337.1_8 Forward -151 -132 -0.0988766 0.263
NP_442578.1_7 Forward -245 -238 14.5921 0.026
NP_442578.1_7 Reverse -238 -245 14.5921 0.026
NP_440710.1_1 Reverse -229 -247 -2.63579 0.195
NP_440710.1_1 Forward -233 -215 -8.83064 0.282
NP_441462.1_1 Reverse -128 -147 19.5673 0.209
NP_441462.1_2 Forward -246 -236 11.5831 0.00406
NP_441462.1_2 Reverse -237 -247 11.5831 0.00406
NP_441462.1_2 Forward -24 -14 -1.19994 0.291
NP_441929.1_6 Reverse -188 -207 5.89931 0.294
NP_443062.1_1 Forward -246 -228 9.42349 0.134
NP_443062.1_6 Forward -254 -235 18.879 0.0448
NP_442204.1_5 Reverse -227 -246 6.09597 0.147
NP_442204.1_9 Forward -127 -109 17.8136 0.231
NP_441560.1_10 Reverse -117 -136 10.4225 0.195
NP_441560.1_10 Reverse -229 -248 5.01433 0.298
NP_440255.1_3 Reverse -204 -214 13.9631 0.298
NP_440516.1_6 Forward -146 -132 18.1901 0.186
NP_440516.1_8 Forward -246 -237 16.9127 0.00442
NP_440516.1_8 Reverse -237 -246 16.9127 0.00442
NP_440516.1_8 Forward -24 -15 0.688044 0.136
NP_440516.1_8 Forward -33 -24 -0.295266 0.232
NP_440516.1_8 Forward -293 -284 -0.590259 0.283
NP_442428.1_4 Forward -300 -281 3.53937 0.24
NP_442428.1_5 Forward -245 -238 15.8704 0.0124
NP_442428.1_5 Reverse -238 -245 15.8704 0.0124
NP_442428.1_5 Reverse -80 -87 4.46401 0.267
NP_442428.1_5 Forward -122 -115 4.36568 0.271
NP_442428.1_5 Reverse -115 -122 4.36568 0.271
NP_441443.1_2 Reverse -323 -342 -6.1954 0.29
NP_441443.1_2 Reverse -276 -295 -6.29373 0.29
NP_440673.1_2 Forward -256 -237 14.0966 0.103
NP_440673.1_2 Forward -303 -284 8.24345 0.275
NP_440673.1_3 Forward -244 -237 12.4288 0.0426
NP_440673.1_3 Reverse -239 -246 12.4288 0.0426
NP_440673.1_7 Forward -59 -40 13.4708 0.097
NP_441052.1_2 Reverse -237 -247 19.9412 0.00106
NP_441052.1_2 Forward -246 -236 10.5014 0.0285
NP_441052.1_2 Reverse -284 -294 4.50326 0.157
NP_442219.1_9 Reverse -238 -247 17.7976 0.00718
NP_442219.1_9 Forward -245 -236 8.35786 0.0681
NP_440436.1_4 Forward -245 -236 18.1905 0.00233
NP_440436.1_4 Reverse -238 -247 17.2072 0.00233
NP_440436.1_4 Forward -87 -78 8.45576 0.105
NP_440436.1_4 Reverse -115 -124 4.42421 0.265
NP_440436.1_4 Reverse -387 -396 4.22755 0.277
NP_441884.1_9 Reverse -234 -253 -22.3217 0.277
NP_441719.1_4 Forward -245 -238 16.3621 0.0124
NP_441719.1_4 Reverse -238 -245 16.3621 0.0124
NP_441733.1_10 Forward -249 -236 9.85238 0.106
NP_441004.1_4 Reverse -213 -223 10.4031 0.254
NP_441004.1_5 Reverse -212 -226 10.226 0.248
NP_442366.1_3 Reverse -236 -254 -1.84914 0.219
NP_442366.1_5 Forward -249 -239 14.8275 0.0375
NP_440323.1_10 Forward -63 -44 20.944 0.0143
NP_441115.1_4 Reverse -113 -131 9.94979 0.194
NP_443054.1_2 Reverse -235 -249 11.3077 0.0761
NP_443054.1_2 Forward -248 -234 3.24451 0.24
NP_441851.1_10 Reverse -236 -246 16.008 0.00552
NP_441851.1_10 Forward -247 -237 15.8113 0.00552
NP_441851.1_10 Forward -49 -39 4.50326 0.266
NP_441668.1_4 Reverse -206 -225 -2.95047 0.299
NP_442515.1_1 Reverse -84 -98 -1.5737 0.257
NP_442515.1_1 Forward -226 -212 -2.95034 0.284
NP_442515.1_1 Forward -247 -233 -5.01529 0.298
NP_442515.1_1 Reverse -105 -119 -5.01529 0.298
NP_441396.1_5 Forward -348 -339 7.47288 0.252
NP_440940.1_7 Reverse -227 -245 3.36165 0.274
NP_441349.1_10 Reverse -227 -246 7.7676 0.0292
NP_441349.1_10 Forward -256 -237 5.50599 0.0432
NP_439960.1_10 Reverse -283 -301 1.19912 0.201
NP_440474.1_8 Forward -245 -231 15.9285 0.0537
NP_440474.1_8 Forward -122 -108 6.58715 0.222
NP_440396.1_1 Forward -133 -114 10.1275 0.141
NP_442450.1_5 Reverse -235 -245 9.32148 0.115
NP_442450.1_5 Forward -248 -238 7.55152 0.13
NP_442168.1_5 Forward -122 -103 4.22769 0.218
NP_440588.1_2 Reverse -228 -247 -0.885524 0.154
NP_440588.1_3 Forward -89 -70 12.4875 0.248
NP_442006.1_2 Forward -293 -276 -6.84433 0.169
NP_442006.1_2 Forward -33 -16 -16.1858 0.243
NP_442006.1_2 Reverse -137 -154 -17.5624 0.279
NP_441570.1_1 Forward -246 -228 2.57575 0.0243
NP_441570.1_1 Reverse -237 -255 1.39578 0.0312
NP_441570.1_1 Reverse -216 -234 -16.8938 0.257
NP_441078.1_4 Forward -246 -237 19.6659 0.0007
NP_441078.1_4 Reverse -237 -246 19.6659 0.0007
NP_441078.1_4 Forward -24 -15 -1.37691 0.254
NP_441078.1_4 Reverse -216 -225 -1.6719 0.266
NP_442729.1_5 Forward -294 -284 15.0247 0.199
NP_442729.1_5 Reverse -136 -146 8.63316 0.248
NP_442729.1_8 Forward -52 -39 4.73917 0.282
NP_440793.1_1 Reverse -35 -49 8.94708 0.295
NP_441094.1_6 Reverse -230 -247 21.8675 0.0416
NP_440526.1_3 Reverse -238 -249 10.2846 0.0646
NP_440526.1_3 Forward -245 -234 1.92649 0.267
NP_440526.1_3 Reverse -16 -27 1.3365 0.267
NP_441432.1_8 Forward -247 -238 16.8143 0.00595
NP_441432.1_8 Reverse -236 -245 8.25953 0.0755
NP_441432.1_8 Forward -294 -285 3.44131 0.245
NP_442320.1_8 Reverse -231 -245 16.2242 0.00981
NP_441732.1_2 Reverse -233 -249 -16.5594 0.174
NP_442003.1_4 Reverse -238 -257 10.8159 0.288
NP_440760.1_1 Reverse -39 -58 -15.4385 0.147
NP_440760.1_1 Reverse -237 -256 -17.0118 0.191
NP_440199.1_10 Reverse -234 -244 14.533 0.0861
NP_440199.1_10 Forward -249 -239 7.25653 0.231
NP_441072.1_2 Forward -257 -238 5.89931 0.296
NP_442010.1_9 Reverse -37 -51 11.4053 0.254
NP_440713.1_4 Reverse -114 -133 10.0292 0.133
NP_440713.1_4 Forward -256 -237 6.78429 0.185
NP_440713.1_4 Forward -64 -45 1.86774 0.277
NP_442489.1_7 Forward -246 -237 20.1576 0.000695
NP_442489.1_7 Reverse -237 -246 20.1576 0.000695
NP_442489.1_7 Reverse -216 -225 5.3096 0.0708
NP_442489.1_7 Reverse -15 -24 -1.77023 0.247
NP_442489.1_7 Forward -225 -216 -1.96689 0.28
NP_440386.1_3 Reverse -346 -365 -11.3086 0.285
NP_442079.1_7 Forward -23 -4 -0.197208 0.29
NP_440559.1_1 Reverse -238 -247 17.4043 0.00658
NP_440559.1_1 Forward -245 -236 8.75118 0.0586
NP_441659.2_8 Reverse -237 -247 18.1713 0.00133
NP_441659.2_8 Forward -246 -236 11.9764 0.0147
NP_441659.2_8 Forward -123 -113 3.51995 0.157
NP_442749.1_5 Forward -363 -346 8.60932 0.231
NP_441022.1_1 Forward -213 -204 10.8747 0.284
NP_442913.1_10 Forward -255 -236 -4.72043 0.244
NP_441040.1_2 Forward -248 -229 -15.4385 0.286
NP_440708.1_6 Forward -144 -125 8.25926 0.124
NP_440442.1_9 Forward -124 -105 22.8122 0.0284
NP_442776.1_1 Reverse -334 -353 10.2259 0.175
NP_441185.1_6 Forward -92 -73 -0.000545616 0.271
NP_442346.1_5 Forward -247 -237 16.6963 0.00248
NP_442346.1_5 Reverse -236 -246 9.02648 0.118
NP_442346.1_5 Reverse -215 -225 4.60159 0.281
NP_442346.1_5 Reverse -113 -123 4.40493 0.29
NP_442346.1_5 Forward -89 -79 4.20827 0.296
NP_440352.1_5 Reverse -190 -209 9.93029 0.289
NP_440545.1_3 Forward -250 -233 1.12048 0.125
NP_440545.1_3 Forward -229 -212 -6.64766 0.285
NP_440545.1_5 Forward -250 -233 7.11867 0.21
NP_441629.1_1 Reverse -229 -248 7.17762 0.253
NP_441786.1_10 Reverse -228 -247 12.5858 0.145
NP_440486.1_6 Forward -300 -281 13.0775 0.207
NP_440486.1_6 Reverse -124 -143 7.07928 0.278
NP_440459.1_2 Reverse -228 -245 9.28195 0.23
NP_440459.1_2 Reverse -13 -30 8.20031 0.267
NP_440010.1_10 Forward -36 -17 2.45773 0.277
NP_442311.1_8 Forward -127 -108 9.83255 0.278
NP_440847.1_3 Forward -189 -175 13.6669 0.209
NP_440847.1_3 Forward -188 -174 11.012 0.275
NP_441888.1_7 Forward -128 -114 2.2612 0.225
NP_441948.1_4 Forward -253 -235 10.4422 0.0544
NP_441948.1_4 Forward -66 -48 -4.40575 0.228
NP_441833.1_4 Forward -245 -238 15.9687 0.0124
NP_441833.1_4 Reverse -238 -245 15.9687 0.0124
NP_442162.1_9 Forward -245 -238 16.2637 0.0124
NP_442162.1_9 Reverse -238 -245 16.2637 0.0124
NP_440671.1_4 Reverse -231 -245 16.7159 0.0263
NP_440224.1_1 Forward -236 -217 -3.73712 0.272
NP_441973.1_1 Forward -184 -169 0.963207 0.235
NP_442199.1_5 Reverse -106 -125 -1.67217 0.181
NP_442199.1_5 Reverse -229 -248 -5.9004 0.255
NP_442140.1_3 Reverse -238 -248 12.2714 0.0632
NP_442140.1_3 Reverse -115 -125 9.12481 0.111
NP_442140.1_3 Forward -245 -235 8.33817 0.119
NP_442140.1_3 Forward -87 -77 7.94484 0.124
NP_442140.1_3 Reverse -285 -295 5.38824 0.211
NP_440875.1_9 Reverse -116 -126 9.83208 0.233
NP_440875.1_9 Forward -244 -234 8.37203 0.233
NP_441813.1_5 Reverse -235 -245 17.188 0.00979
NP_441813.1_5 Forward -248 -238 8.63316 0.0367
NP_440590.1_4 Reverse -238 -251 11.3273 0.0209
NP_440590.1_4 Forward -245 -232 3.26421 0.0749
NP_440567.1_1 Forward -245 -231 19.7641 0.0136
NP_440567.1_1 Reverse -16 -30 1.96621 0.188
NP_440567.1_1 Reverse -238 -252 0.392915 0.246
NP_442497.1_10 Forward -245 -236 10.4228 0.0087
NP_442497.1_10 Reverse -238 -247 10.4228 0.0087
NP_442497.1_10 Reverse -16 -25 0.29472 0.199
NP_440821.1_4 Reverse -235 -245 19.0562 0.00399
NP_440821.1_4 Forward -248 -238 9.41981 0.0286
NP_440821.1_4 Forward -26 -16 -0.0199663 0.217
NP_441239.1_9 Reverse -235 -247 13.3137 0.037
NP_441239.1_9 Reverse -282 -294 11.8387 0.0547
NP_441239.1_9 Reverse -112 -124 10.6587 0.0742
NP_441239.1_9 Forward -125 -113 8.59377 0.128
NP_441239.1_9 Forward -248 -236 5.93884 0.202
NP_441009.1_7 Forward -247 -228 12.4875 0.198
NP_441892.1_1 Reverse -70 -87 2.20212 0.143
NP_441892.1_1 Reverse -128 -145 -2.51776 0.223
NP_441892.1_1 Forward -33 -16 -3.00942 0.231
NP_441892.1_1 Forward -302 -285 -3.69774 0.247
NP_441892.1_1 Forward -255 -238 -4.68105 0.266
NP_442399.1_3 Reverse -286 -305 14.2087 0.142
NP_442270.1_9 Forward -257 -238 0.294447 0.14
NP_442643.1_1 Reverse -231 -250 -11.4069 0.231
NP_441874.1_1 Forward -297 -283 9.14437 0.277
NP_440900.1_3 Forward -299 -280 15.4374 0.259
NP_442052.1_8 Reverse -77 -87 13.5497 0.253
NP_442809.1_6 Reverse -125 -144 0.687771 0.285
NP_440546.1_4 Forward -246 -236 11.8882 0.0679
NP_440546.1_4 Forward -293 -283 11.7912 0.0712
NP_440546.1_4 Reverse -237 -247 10.046 0.109
NP_440546.1_4 Forward -33 -23 7.13728 0.257
NP_442041.1_5 Reverse -103 -122 9.14423 0.166
NP_441230.1_6 Reverse -283 -302 11.7008 0.263
NP_440462.1_6 Reverse -235 -245 15.418 0.0142
NP_440462.1_6 Forward -248 -238 1.35667 0.294
NP_442340.1_3 Forward -71 -52 -8.55534 0.249
NP_442611.1_1 Forward -246 -227 -1.08219 0.274
NP_440868.1_4 Reverse -233 -245 8.79043 0.0582
NP_440868.1_4 Forward -250 -238 6.23383 0.0878
NP_440868.1_7 Reverse -239 -258 21.4347 0.0491
NP_441497.1_3 Reverse -283 -302 -11.3086 0.294
NP_442402.1_4 Forward -142 -123 -1.27961 0.189
NP_441848.1_7 Reverse -32 -51 -3.63955 0.284
NP_441084.1_6 Reverse -384 -398 9.15021 0.292
NP_442460.1_7 Forward -258 -239 -0.000545616 0.283
NP_440696.1_3 Forward -303 -285 1.59244 0.217
NP_440696.1_3 Forward -235 -217 0.609134 0.229
NP_440843.1_3 Forward -310 -291 8.75091 0.29
NP_442039.1_4 Forward -245 -238 15.1821 0.0124
NP_442039.1_4 Reverse -238 -245 15.1821 0.0124
NP_442039.1_4 Forward -32 -25 6.43063 0.285
NP_442039.1_7 Reverse -81 -91 14.3364 0.211
NP_441811.1_8 Forward -201 -187 5.70279 0.293
NP_440753.1_5 Forward -198 -179 15.6341 0.122
NP_442679.1_1 Reverse -135 -154 -3.24547 0.25
NP_442679.1_1 Reverse -83 -102 -3.73712 0.262
NP_442679.1_1 Reverse -166 -185 -5.99873 0.298
NP_442679.1_1 Reverse -148 -167 -5.99873 0.298
NP_442829.1_2 Reverse -147 -163 8.33436 0.287
NP_441926.1_3 Forward -246 -230 4.58176 0.184
NP_441926.1_3 Forward -24 -8 2.71347 0.257
NP_440825.1_7 Reverse -238 -248 12.9096 0.152
NP_442837.1_3 Forward -245 -238 15.7721 0.0124
NP_442837.1_3 Reverse -238 -245 15.7721 0.0124
NP_440160.1_2 Reverse -125 -144 8.25926 0.147
NP_440160.1_2 Reverse -63 -82 -8.65367 0.286
NP_440160.1_3 Reverse -125 -144 7.4718 0.284
NP_439994.1_3 Reverse -236 -255 14.1941 0.113
NP_439994.1_3 Reverse -369 -388 8.5361 0.287
NP_442053.1_1 Forward -246 -237 18.3876 0.0007
NP_442053.1_1 Reverse -237 -246 18.3876 0.0007
NP_442053.1_1 Reverse -15 -24 4.42462 0.249
NP_440505.1_3 Reverse -235 -245 13.8447 0.0247
NP_440505.1_3 Forward -248 -238 9.22315 0.122
NP_440505.1_7 Forward -140 -121 10.2259 0.153
NP_441203.1_1 Reverse -115 -134 -12.4886 0.143
NP_441203.1_1 Forward -145 -126 -15.3402 0.225
NP_440914.1_1 Reverse -237 -247 17.5935 0.000537
NP_440914.1_1 Reverse -79 -89 11.3477 0.097
NP_440914.1_1 Forward -246 -236 8.6151 0.186
NP_442470.1_3 Reverse -17 -36 15.3382 0.121
NP_441011.1_8 Forward -245 -236 16.9127 0.00602
NP_441011.1_8 Reverse -238 -247 8.25953 0.144
NP_441011.1_8 Reverse -115 -124 5.01461 0.289
NP_442533.1_1 Reverse -121 -140 -12.3902 0.236
NP_442533.1_6 Forward -246 -237 17.2076 0.00137
NP_442533.1_6 Reverse -237 -246 17.2076 0.00137
NP_442533.1_6 Reverse -114 -123 4.62128 0.179
NP_442533.1_6 Reverse -284 -293 3.7363 0.204
NP_442541.1_10 Forward -190 -176 2.35894 0.262
NP_440263.1_6 Reverse -226 -245 27.2371 0.00129
NP_442232.1_4 Reverse -134 -153 13.5691 0.17
NP_442322.1_4 Reverse -276 -293 -6.255 0.275
NP_442229.1_1 Forward -90 -76 8.94708 0.184
NP_442229.1_1 Forward -248 -234 8.25877 0.184
NP_441219.1_6 Reverse -289 -307 19.587 0.0611
NP_441482.1_7 Reverse -231 -245 -9.04686 0.193
NP_441482.1_7 Reverse -131 -145 -11.6035 0.275
NP_439944.1_9 Reverse -238 -248 10.5014 0.0887
NP_439944.1_9 Forward -245 -235 10.3048 0.0887
NP_441028.1_6 Reverse -42 -52 15.5158 0.137
NP_441028.1_6 Forward -132 -122 13.2542 0.159
NP_441028.1_6 Reverse -279 -289 5.78111 0.243
NP_441028.1_6 Forward -185 -175 5.38779 0.255
NP_440116.1_8 Reverse -238 -257 0.884433 0.094
NP_441527.1_4 Reverse -132 -151 -13.1306 0.298
NP_440007.1_9 Reverse -233 -247 0.982901 0.29
NP_439965.1_1 Forward -255 -236 3.34271 0.0999
NP_439965.1_7 Forward -131 -112 11.293 0.294
NP_441680.1_4 Reverse -330 -349 8.35759 0.158
NP_441106.1_1 Reverse -236 -245 18.191 0.0028
NP_441106.1_1 Forward -247 -238 9.63616 0.0311
NP_441106.1_1 Forward -124 -115 4.32629 0.227
NP_441106.1_1 Reverse -78 -87 2.35967 0.287
NP_442588.1_5 Reverse -91 -110 10.7175 0.238
NP_442306.1_10 Forward -251 -232 -20.8467 0.231
NP_441286.1_1 Forward -247 -235 14.4936 0.00418
NP_441286.1_1 Reverse -236 -248 3.38223 0.0467
NP_441286.1_1 Forward -226 -214 -4.87757 0.18
NP_441286.1_1 Reverse -38 -50 -6.2542 0.254
NP_442674.1_3 Forward -32 -13 6.88182 0.224
NP_442674.1_3 Reverse -71 -90 6.1935 0.246
NP_442674.1_3 Reverse -129 -148 2.26028 0.3
NP_440670.1_8 Forward -246 -237 18.3876 0.000699
NP_440670.1_8 Reverse -237 -246 18.3876 0.000699
NP_440886.1_7 Reverse -236 -246 17.7774 0.0011
NP_440886.1_7 Forward -106 -96 9.12434 0.0805
NP_440886.1_7 Reverse -243 -253 8.14104 0.0805
NP_440886.1_7 Forward -247 -237 7.94438 0.0805
NP_440886.1_7 Reverse -23 -33 6.96107 0.112
NP_440886.1_7 Reverse -283 -293 6.46942 0.123
NP_442614.1_2 Reverse -237 -251 12.291 0.165
NP_442614.1_2 Reverse -103 -117 6.09611 0.293
NP_439995.1_5 Reverse -227 -246 5.40766 0.276
NP_442072.1_9 Forward -247 -229 -22.302 0.229
NP_442072.1_9 Reverse -236 -254 -22.302 0.229
NP_441753.1_10 Reverse -228 -247 3.24438 0.219
NP_440823.1_4 Reverse -360 -379 10.1275 0.0595
NP_440907.2_8 Forward -245 -235 7.84605 0.117
NP_440907.2_8 Reverse -238 -248 7.64939 0.117
NP_440907.2_8 Reverse -40 -50 5.68278 0.191
NP_442264.1_2 Forward -98 -81 7.70866 0.231
NP_441021.1_4 Forward -216 -197 9.73422 0.269
NP_441463.1_3 Reverse -227 -246 4.52268 0.0881
NP_442056.1_1 Reverse -94 -112 16.0471 0.264
NP_442056.1_1 Reverse -225 -243 13.1955 0.295
NP_441626.1_2 Forward -245 -238 15.7721 0.0124
NP_441626.1_2 Reverse -238 -245 15.7721 0.0124
NP_442794.1_1 Forward -250 -238 2.69391 0.286
NP_442615.1_1 Forward -255 -237 14.9655 0.00922
NP_442615.1_1 Reverse -228 -246 -2.43913 0.144
NP_441962.1_4 Forward -230 -211 -10.817 0.232
NP_440387.1_1 Forward -246 -230 7.53169 0.0282
NP_440387.1_1 Reverse -237 -253 -3.97304 0.171
NP_441431.1_2 Reverse -234 -248 9.24208 0.19
NP_441431.1_2 Forward -126 -112 6.19383 0.279
NP_441488.1_8 Forward -298 -284 8.25877 0.199
NP_441836.1_2 Reverse -125 -144 -1.18052 0.217
NP_441193.1_6 Forward -87 -68 1.0811 0.285
NP_441993.1_1 Forward -299 -280 0.484826 0.298
NP_440814.1_4 Forward -255 -236 -13.6686 0.296
NP_440114.1_10 Forward -246 -232 16.6175 0.0165
NP_440114.1_10 Forward -123 -109 11.0127 0.127
NP_440114.1_10 Reverse -237 -251 6.6861 0.26
NP_440287.1_6 Forward -117 -98 10.6192 0.129
NP_440287.1_6 Forward -255 -236 8.75091 0.151
NP_439988.1_3 Forward -36 -22 4.91614 0.292
NP_440422.1_10 Forward -166 -147 4.69232 0.281
NP_441237.1_9 Reverse -238 -248 14.828 0.0242
NP_441237.1_9 Forward -224 -214 12.0747 0.139
NP_442743.1_4 Reverse -115 -134 -0.295539 0.174
NP_442930.1_1 Forward -211 -201 10.501 0.276
NP_442930.1_1 Reverse -269 -279 9.71433 0.28
NP_439910.1_2 Reverse -229 -246 -12.2525 0.0788
NP_439910.1_2 Reverse -7 -24 -14.3175 0.183
NP_442867.1_8 Reverse -277 -296 5.80098 0.275
NP_440457.1_1 Reverse -233 -245 9.57708 0.092
NP_440457.1_1 Forward -250 -238 0.825626 0.25
NP_440801.1_8 Reverse -283 -302 -0.4922 0.265
NP_441332.1_6 Reverse -283 -293 11.5499 0.254
NP_441332.1_6 Reverse -332 -342 10.6786 0.294
NP_441436.1_8 Forward -343 -324 7.47261 0.293
NP_442509.1_9 Forward -246 -236 16.2041 0.00739
NP_442509.1_9 Reverse -237 -247 8.14104 0.192
NP_442439.1_8 Reverse -130 -149 14.5524 0.153
NP_440554.1_4 Forward -245 -235 14.6313 0.02
NP_440554.1_4 Reverse -115 -125 5.87989 0.129
NP_440554.1_4 Forward -122 -112 4.69992 0.181
NP_442862.1_3 Reverse -109 -126 4.26707 0.29
NP_441885.1_5 Reverse -237 -247 20.9245 0.000538
NP_441885.1_5 Forward -246 -236 11.4848 0.00668
NP_442341.1_7 Forward -247 -233 10.0294 0.0682
NP_442341.1_7 Reverse -236 -250 8.35772 0.0881
NP_442341.1_9 Reverse -235 -249 14.4536 0.068
NP_441756.1_5 Forward -65 -46 17.2074 0.0566
NP_441173.1_9 Reverse -43 -51 10.1471 0.261
NP_442395.2_4 Forward -247 -228 7.86512 0.136
NP_440191.1_4 Forward -236 -226 12.9542 0.282
NP_440423.1_6 Forward -32 -13 -11.3086 0.169
NP_440423.1_6 Forward -41 -22 -19.7651 0.244
NP_443000.1_3 Forward -56 -37 11.3286 0.255
NP_443000.1_7 Forward -248 -238 10.3048 0.0345
NP_443000.1_7 Reverse -235 -245 8.73149 0.0437
NP_440507.2_3 Reverse -105 -124 10.2251 0.208
NP_441561.1_7 Reverse -273 -292 6.78348 0.274
NP_441842.1_1 Reverse -81 -94 13.2934 0.157
NP_441842.1_10 Reverse -230 -244 12.586 0.0982
NP_440275.1_3 Reverse -235 -245 8.4365 0.0602
NP_440275.1_3 Forward -248 -238 8.04317 0.0602
NP_440091.1_1 Reverse -233 -245 20.1968 0.00953
NP_440091.1_1 Forward -250 -238 10.7571 0.0429
NP_443060.1_5 Forward -254 -235 6.88182 0.235
NP_441397.1_8 Reverse -1 -14 13.2397 0.245
NP_443010.1_10 Reverse -234 -251 16.2029 0.0512
NP_441122.1_1 Forward -229 -214 13.5496 0.126
NP_441122.1_1 Forward -92 -77 3.81481 0.28
NP_439962.1_4 Forward -131 -112 -5.40875 0.28
NP_442495.1_4 Forward -350 -340 14.7297 0.16
NP_440149.1_8 Reverse -108 -127 6.29264 0.0684
NP_441105.1_3 Reverse -226 -245 -1.7705 0.151
NP_441105.1_3 Forward -304 -285 -8.94866 0.281
NP_440216.1_1 Forward -246 -232 7.57108 0.00935
NP_440216.1_1 Reverse -237 -251 -0.393733 0.0284
NP_440216.1_1 Forward -239 -225 -5.40861 0.129
NP_440216.1_9 Forward -369 -360 13.9627 0.184
NP_440216.1_9 Reverse -286 -295 7.37455 0.286
NP_440216.1_9 Reverse -197 -206 7.17789 0.286
NP_440216.1_9 Reverse -81 -90 7.17789 0.286
NP_440216.1_9 Reverse -139 -148 6.09625 0.289
NP_440172.1_1 Reverse -237 -247 15.0247 0.00945
NP_440172.1_1 Forward -246 -236 8.73149 0.0586
NP_442371.1_1 Reverse -198 -208 11.8776 0.273
NP_442015.1_10 Forward -250 -237 1.59258 0.204
NP_442015.1_10 Reverse -233 -246 0.904263 0.216
NP_441226.1_7 Forward -245 -238 14.4934 0.0123
NP_441226.1_7 Reverse -238 -245 14.4934 0.0123
NP_441226.1_7 Reverse -223 -230 6.52862 0.253
NP_440198.1_3 Forward -138 -119 17.0099 0.231
NP_441111.1_7 Forward -245 -237 18.7023 0.00294
NP_441111.1_7 Reverse -238 -246 18.7023 0.00294
NP_441766.1_2 Forward -246 -237 17.5026 0.00297
NP_441766.1_2 Reverse -237 -246 17.5026 0.00297
NP_441766.1_9 Forward -32 -13 12.6841 0.144
NP_440416.1_1 Forward -246 -227 -4.72043 0.132
NP_440416.1_9 Reverse -283 -302 -9.44032 0.131
NP_440416.1_9 Forward -66 -47 -9.73531 0.134
NP_440416.1_9 Reverse -107 -126 -17.7985 0.247
NP_440416.1_9 Forward -147 -128 -20.5517 0.286
NP_443052.1_8 Reverse -227 -246 -7.08038 0.152
NP_443052.1_9 Reverse -330 -349 -6.09707 0.276
NP_442116.1_2 Reverse -156 -175 14.8466 0.272
NP_442403.1_10 Forward -141 -122 13.1758 0.222
NP_442154.1_1 Forward -41 -23 -15.6155 0.222
NP_442154.1_1 Forward -302 -284 -19.0571 0.289
NP_440261.1_5 Reverse -16 -29 -1.06236 0.0655
NP_440261.1_5 Reverse -238 -251 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACTTCAACAATGGTATTTAATCGGGTGCGCTGCATGGCAAATTACCTTAAATTTCCTGGGGGGCGGGACGGTACAGAAACAGCAATGCTCAATTCTAGGCCGTCTTTGGCCATGGGGGTATGGGAAAATGTATTGTTGGTTAACTGTCATGATTGGCGATCGCCGTTCCACGGTTGGCCATTGACCCAATAAATTTTTCCGTGGTTGTTATCCCATTTTCCCCTTGAATTGCTTGGCTTTGTTTGATATTTCTTCTCCTTGGCCCTGGTTGACCCCCAGCCATGGCATTATCGCCGCCTACCTTCTGTTGTTTGCCATCGTTCATAGTGGCTTAGCCGCCCTGCGAGCCTGGGGGGAAAGCAAAATTGGCGCTAGGGGCTATCGAGTTATATTTGCCCTG

CDS

GTGAGTATTCCCCTGGCTACGGGATTAATTATTTATTTTTTCAACCATCGCTATGATGGTCTGCAACTCTGGCAAGTACAGGGAGTAACGGGAGTTAAACCCCTGGTGTGGATTTTGTCTGCCCTATCTTTTTTCTTCCTTTTTCCCGCCACTTTTAACCTGTTGGAAATTGCCGCTATCCAAAAACCGGAAATCCATCTTTATGAAACGGGCATTATCCGTATTTGTCGCCATCCTCAAATGGTCGGTCAAGTAATTTGGTGCATTGCCCACACCCTCTGGTTGGGAACCACTTTTACTCTGGTTACCAGCTTGGGATTAATTGCCCACCATTGCTTTGCAGTCTGGCATGGCGATCGCCGTTGGCAACACAAATATGGCGAGGCTTTTCTAGCAGTGAAACAAAGAACTTCCATCATTCCCTTTCAAGCGATCTGGGAGGGAAGGCAAATTCTAGTGTGGCAGGAATTTATCAAACCAGCCTATGTGGGGGTAATGGGTTTCATTGCCCTACTATGGTGGGGCCATCCCTGGTTGATGGTGATGACCTCCAGAGTTAATTGGTAG

Protein

MSIPLATGLIIYFFNHRYDGLQLWQVQGVTGVKPLVWILSALSFFFLFPATFNLLEIAAIQKPEIHLYETGIIRICRHPQMVGQVIWCIAHTLWLGTTFTLVTSLGLIAHHCFAVWHGDRRWQHKYGEAFLAVKQRTSIIPFQAIWEGRQILVWQEFIKPAYVGVMGFIALLWWGHPWLMVMTSRVNW