Your browser is old and dusty. Try Google Chrome!

Details for slr1596

ORF slr1596
Accession NP_440313.1
Symbol pxcA
Category a protein in the cytoplasmic membrane involved in light-induced proton extrusion.
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -215 -208 14.6904 0.0123
NP_440795.1_7 Reverse -208 -215 14.6904 0.0123
NP_441418.1_6 Forward -216 -197 -21.3384 0.147
NP_441418.1_6 Reverse -364 -383 -29.8932 0.245
NP_442291.1_5 Forward -374 -358 -2.89139 0.229
NP_442291.1_5 Forward -217 -201 -4.95634 0.292
NP_440897.1_9 Reverse -135 -153 12.8997 0.222
NP_441453.1_4 Forward -216 -208 16.6374 0.00633
NP_441453.1_4 Reverse -207 -215 16.539 0.00633
NP_441453.1_4 Forward -373 -365 14.7691 0.0119
NP_441453.1_4 Reverse -364 -372 6.80426 0.121
NP_441960.1_3 Forward -98 -79 14.7512 0.237
NP_442151.1_6 Forward -342 -328 10.3243 0.125
NP_442151.1_6 Reverse -207 -221 5.89945 0.256
NP_442151.1_6 Reverse -89 -103 5.21113 0.288
NP_441818.1_1 Forward -215 -204 17.1677 0.00948
NP_441818.1_1 Forward -372 -361 12.7428 0.105
NP_441818.1_6 Reverse -254 -268 11.3077 0.253
NP_440150.1_6 Reverse -361 -380 9.93088 0.178
NP_441519.1_3 Forward -337 -318 10.3242 0.271
NP_442287.1_1 Reverse -325 -335 16.8925 0.122
NP_442287.1_1 Reverse -220 -230 15.3192 0.22
NP_442655.1_2 Reverse -112 -131 4.81767 0.23
NP_442173.1_1 Reverse -208 -216 17.3257 0.00633
NP_442173.1_1 Forward -215 -207 15.4574 0.00633
NP_442173.1_1 Forward -372 -364 12.0158 0.0316
NP_442173.1_1 Reverse -365 -373 12.0158 0.0316
NP_442752.1_4 Reverse -364 -371 13.8055 0.0199
NP_442752.1_4 Reverse -207 -214 13.8055 0.0199
NP_442752.1_4 Reverse -374 -381 7.90559 0.144
NP_443027.1_4 Reverse -205 -215 7.35486 0.24
NP_439997.1_5 Forward -133 -114 13.434 0.249
NP_440784.1_7 Forward -215 -208 15.9687 0.0123
NP_440784.1_7 Reverse -208 -215 15.9687 0.0123
NP_440784.1_7 Reverse -365 -372 6.23397 0.241
NP_440784.1_7 Forward -372 -365 6.13563 0.241
NP_442909.1_7 Forward -372 -358 10.0287 0.14
NP_440061.1_9 Forward -375 -361 21.9267 0.00174
NP_440061.1_9 Forward -331 -317 6.29216 0.251
NP_442062.1_3 Reverse -15 -34 -0.688862 0.249
NP_442062.1_8 Reverse -207 -217 17.3846 0.00193
NP_442062.1_8 Forward -216 -206 15.2213 0.00881
NP_442062.1_8 Reverse -364 -374 10.0098 0.0527
NP_442062.1_8 Forward -373 -363 7.84651 0.0871
NP_442062.1_8 Reverse -100 -110 5.78156 0.152
NP_442062.1_8 Forward -329 -319 3.22496 0.279
NP_442062.1_8 Forward -383 -373 2.92996 0.292
NP_440761.1_4 Forward -347 -328 -20.4534 0.287
NP_441859.1_5 Reverse -246 -265 0.58944 0.3
NP_440304.1_4 Reverse -205 -215 18.9579 0.00406
NP_442242.1_4 Forward -215 -208 14.3954 0.0124
NP_442242.1_4 Reverse -208 -215 14.3954 0.0124
NP_440044.1_8 Forward -215 -196 14.2574 0.0301
NP_441935.1_1 Reverse -310 -329 15.5357 0.126
NP_441935.1_1 Forward -328 -309 5.70265 0.292
NP_440893.1_6 Forward -371 -352 16.1249 0.223
NP_442276.1_2 Forward -354 -335 6.09597 0.291
NP_440132.1_1 Forward -218 -200 12.3105 0.193
NP_442804.1_1 Forward -291 -272 17.7974 0.104
NP_440769.1_8 Forward -195 -176 9.63589 0.204
NP_441083.1_3 Reverse -88 -98 12.7626 0.248
NP_441083.1_5 Forward -373 -363 18.0729 0.00245
NP_441083.1_5 Forward -216 -206 10.1081 0.0208
NP_441083.1_5 Reverse -207 -217 9.51814 0.026
NP_441083.1_5 Reverse -364 -374 8.82982 0.03
NP_441083.1_5 Reverse -320 -330 -0.41329 0.267
NP_441434.1_7 Forward -371 -357 5.99778 0.225
NP_441738.1_2 Forward -371 -364 15.28 0.0102
NP_441738.1_2 Forward -214 -207 15.28 0.0102
NP_441738.1_2 Reverse -209 -216 11.5435 0.084
NP_441738.1_2 Forward -128 -121 6.52862 0.261
NP_441558.1_5 Reverse -362 -381 6.98095 0.198
NP_441558.1_5 Reverse -205 -224 6.4893 0.214
NP_440209.1_1 Reverse -207 -215 18.1123 0.00295
NP_440209.1_1 Reverse -364 -372 8.57422 0.0425
NP_440209.1_1 Forward -216 -208 8.57422 0.0425
NP_440209.1_1 Forward -373 -365 8.47588 0.0457
NP_442889.1_8 Reverse -204 -218 8.25877 0.126
NP_442570.1_3 Forward -337 -318 16.6174 0.0628
NP_442570.1_3 Forward -232 -213 -0.0988766 0.208
NP_442570.1_3 Reverse -301 -320 -4.52377 0.231
NP_441716.1_1 Forward -329 -315 6.29277 0.202
NP_441716.1_1 Reverse -364 -378 4.12949 0.258
NP_441716.1_1 Reverse -374 -388 2.75286 0.294
NP_442111.1_4 Reverse -363 -377 8.06273 0.081
NP_442111.1_4 Forward -217 -203 5.80112 0.15
NP_441163.1_1 Reverse -366 -383 9.5762 0.225
NP_440343.1_3 Forward -108 -90 3.06666 0.285
NP_440906.1_5 Forward -215 -208 15.8704 0.0124
NP_440906.1_5 Reverse -208 -215 15.8704 0.0124
NP_440906.1_5 Reverse -365 -372 6.23397 0.234
NP_440906.1_5 Forward -372 -365 6.13563 0.241
NP_440747.1_1 Reverse -324 -342 7.29564 0.251
NP_440747.1_10 Forward -219 -207 5.54551 0.0128
NP_440747.1_10 Reverse -361 -373 -2.32097 0.0331
NP_440747.1_10 Forward -376 -364 -2.51763 0.0509
NP_440747.1_10 Reverse -204 -216 -11.7607 0.142
NP_440747.1_10 Forward -386 -374 -12.2524 0.254
NP_441130.1_10 Forward -375 -361 16.2242 0.0257
NP_441130.1_10 Reverse -362 -376 7.07942 0.171
NP_441486.1_1 Reverse -204 -218 15.8309 0.00583
NP_441486.1_1 Forward -219 -205 2.65453 0.079
NP_441486.1_1 Forward -376 -362 -4.7203 0.205
NP_442634.1_4 Reverse -205 -219 -2.16369 0.149
NP_441265.1_3 Forward -222 -208 4.81781 0.181
NP_440403.1_4 Forward -382 -363 -0.787193 0.17
NP_440403.1_4 Reverse -365 -384 -7.86702 0.248
NP_441014.1_2 Reverse -94 -113 13.5691 0.245
NP_441014.1_5 Reverse -322 -340 15.4571 0.2
NP_441014.1_8 Forward -376 -357 -2.16383 0.231
NP_441014.1_8 Forward -223 -204 -3.24547 0.242
NP_441014.1_8 Forward -355 -336 -3.73712 0.242
NP_442848.1_1 Reverse -201 -215 4.71948 0.0968
NP_443018.1_3 Forward -215 -208 14.8871 0.0123
NP_443018.1_3 Reverse -208 -215 14.8871 0.0123
NP_443018.1_3 Forward -372 -365 11.7405 0.0655
NP_443018.1_3 Reverse -334 -341 10.6589 0.0967
NP_443018.1_3 Reverse -228 -235 8.20058 0.153
NP_443018.1_3 Reverse -365 -372 5.44732 0.193
NP_443018.1_3 Forward -341 -334 4.16902 0.278
NP_441316.1_7 Reverse -205 -220 -3.56002 0.282
NP_441634.1_8 Forward -385 -371 2.16287 0.17
NP_441634.1_8 Reverse -362 -376 -3.44199 0.295
NP_440376.1_1 Reverse -364 -373 15.7327 0.00625
NP_440376.1_1 Forward -216 -207 9.73449 0.0365
NP_440376.1_1 Forward -373 -364 9.63616 0.0385
NP_440376.1_1 Reverse -207 -216 9.63616 0.0385
NP_440376.1_1 Forward -329 -320 2.458 0.221
NP_440376.1_1 Forward -335 -326 1.96635 0.236
NP_440376.1_1 Forward -230 -221 1.76968 0.242
NP_441588.1_4 Reverse -322 -332 5.19158 0.282
NP_442687.1_7 Reverse -206 -216 17.5813 0.0089
NP_442687.1_7 Reverse -363 -373 16.303 0.0125
NP_442687.1_7 Forward -217 -207 9.02648 0.0994
NP_442687.1_7 Forward -374 -364 5.97822 0.179
NP_442687.1_7 Forward -99 -89 4.10993 0.266
NP_442191.1_4 Reverse -365 -379 14.8714 0.073
NP_441077.1_6 Reverse -19 -35 4.6336 0.255
NP_441077.1_6 Forward -74 -58 2.60905 0.276
NP_442485.1_3 Reverse -196 -215 13.4708 0.101
NP_442485.1_3 Reverse -314 -333 -1.57384 0.26
NP_442485.1_3 Forward -324 -305 -2.45882 0.262
NP_442485.1_3 Reverse -362 -381 -6.1954 0.299
NP_442958.1_3 Forward -384 -365 -2.16383 0.293
NP_440642.1_10 Forward -164 -150 6.0955 0.238
NP_441013.1_2 Forward -265 -247 -4.30741 0.298
NP_441422.1_7 Forward -375 -358 4.46374 0.107
NP_442720.1_1 Forward -190 -171 18.4848 0.202
NP_442658.1_1 Reverse -205 -215 14.8275 0.0188
NP_442658.1_1 Forward -218 -208 13.9425 0.0293
NP_442658.1_1 Forward -375 -365 7.45273 0.214
NP_442658.1_1 Reverse -362 -372 6.27276 0.234
NP_442782.1_2 Reverse -207 -221 0.687908 0.286
NP_442782.1_7 Reverse -199 -218 18.1907 0.0355
NP_440656.1_8 Reverse -196 -215 7.7676 0.0791
NP_440607.1_5 Reverse -362 -381 0.196116 0.279
NP_442300.1_1 Reverse -249 -268 8.94757 0.204
NP_442937.1_5 Reverse -305 -324 9.14423 0.202
NP_441958.1_5 Reverse -206 -216 19.2529 0.00183
NP_441958.1_5 Reverse -363 -373 18.2696 0.00183
NP_441958.1_5 Forward -217 -207 10.7964 0.0099
NP_441958.1_5 Forward -374 -364 2.43831 0.0422
NP_440318.1_1 Forward -400 -381 8.45592 0.185
NP_442486.1_6 Forward -348 -329 -4.03212 0.266
NP_442486.1_6 Forward -354 -335 -4.6221 0.27
NP_442836.1_10 Reverse -115 -125 13.5497 0.22
NP_439905.1_1 Forward -372 -359 9.36073 0.221
NP_440984.1_7 Forward -221 -207 5.30946 0.259
NP_442376.1_2 Reverse -359 -378 -12.9802 0.286
NP_442690.1_1 Reverse -55 -74 -14.0619 0.268
NP_441580.1_6 Reverse -196 -215 -8.26035 0.254
NP_440153.1_5 Reverse -365 -379 11.8976 0.0721
NP_440153.1_8 Forward -104 -91 -2.83231 0.266
NP_443055.1_6 Reverse -319 -337 -0.6699 0.265
NP_443055.1_6 Reverse -333 -351 -2.63651 0.298
NP_440602.1_8 Forward -216 -202 17.8958 0.0898
NP_440138.1_6 Forward -372 -353 2.35861 0.267
NP_441099.1_5 Forward -393 -374 -0.4922 0.0937
NP_441099.1_5 Forward -383 -364 -10.4236 0.253
NP_442002.1_9 Reverse -363 -370 14.1004 0.074
NP_442002.1_9 Reverse -206 -213 14.1004 0.074
NP_442002.1_9 Forward -217 -210 11.6422 0.185
NP_441294.1_7 Forward -377 -363 12.6102 0.0916
NP_441294.1_7 Forward -322 -308 10.0185 0.213
NP_441646.1_1 Reverse -357 -376 2.94938 0.211
NP_441646.1_1 Forward -335 -316 0.58944 0.247
NP_442431.1_7 Reverse -253 -272 8.25926 0.248
NP_441000.1_6 Forward -374 -360 10.3243 0.0744
NP_441000.1_6 Reverse -363 -377 5.21113 0.0933
NP_441000.1_6 Forward -217 -203 -2.45868 0.216
NP_441000.1_6 Reverse -206 -220 -4.62196 0.248
NP_442771.1_1 Reverse -205 -223 -4.01242 0.166
NP_440147.1_4 Reverse -362 -375 15.1623 0.0194
NP_440147.1_4 Forward -218 -205 11.4257 0.0326
NP_440147.1_4 Forward -375 -362 8.08242 0.0561
NP_440147.1_4 Forward -331 -318 5.42749 0.125
NP_440147.1_4 Reverse -205 -218 2.2809 0.209
NP_441550.1_8 Reverse -362 -372 16.8925 0.00906
NP_441550.1_8 Reverse -205 -215 15.4175 0.0132
NP_441550.1_8 Forward -218 -208 12.8609 0.0296
NP_441550.1_8 Forward -375 -365 7.84605 0.144
NP_441550.1_8 Forward -344 -334 7.35439 0.164
NP_441916.1_7 Forward -216 -206 17.5813 0.00295
NP_441916.1_7 Reverse -207 -217 14.828 0.0115
NP_441916.1_7 Reverse -364 -374 8.73149 0.042
NP_441916.1_7 Forward -373 -363 7.25653 0.0718
NP_441916.1_7 Forward -236 -226 1.84832 0.272
NP_441916.1_7 Forward -369 -359 1.25834 0.289
NP_441041.1_4 Reverse -89 -108 -10.227 0.228
NP_441041.1_7 Forward -219 -207 17.1354 0.0109
NP_441041.1_7 Reverse -204 -216 9.94422 0.104
NP_441041.1_7 Reverse -361 -373 7.32042 0.169
NP_442642.1_9 Reverse -146 -163 1.31714 0.218
NP_442996.1_1 Forward -75 -56 5.87233 0.246
NP_442004.1_6 Forward -216 -202 3.73617 0.232
NP_440703.1_9 Forward -104 -91 10.9334 0.192
NP_441725.1_5 Forward -215 -205 21.0229 0.00533
NP_441725.1_5 Reverse -208 -218 2.7333 0.115
NP_441725.1_5 Forward -372 -362 1.94665 0.115
NP_441725.1_5 Reverse -334 -344 -0.0199663 0.223
NP_439966.1_7 Forward -375 -365 16.9908 0.0074
NP_439966.1_7 Reverse -205 -215 9.12434 0.119
NP_439966.1_7 Reverse -331 -341 4.7978 0.258
NP_442941.1_3 Forward -215 -205 11.3864 0.0116
NP_442941.1_3 Reverse -365 -375 1.06167 0.153
NP_442941.1_3 Forward -372 -362 0.865012 0.163
NP_442941.1_3 Reverse -208 -218 -0.0199663 0.244
NP_440289.1_2 Reverse -204 -217 16.1456 0.00946
NP_440289.1_2 Forward -376 -363 4.24752 0.0688
NP_440289.1_2 Forward -219 -206 -1.75067 0.246
NP_440289.1_2 Reverse -361 -374 -3.91395 0.273
NP_440289.1_2 Reverse -330 -343 -4.79893 0.294
NP_440260.1_8 Forward -338 -320 1.29745 0.189
NP_442281.1_1 Forward -221 -207 22.025 0.00192
NP_442281.1_1 Reverse -202 -216 9.14375 0.0736
NP_442281.1_1 Reverse -222 -236 3.73557 0.221
NP_441079.1_7 Forward -40 -21 -2.45958 0.219
NP_442256.1_2 Forward -350 -332 0.21581 0.126
NP_440437.1_1 Forward -222 -203 -4.91709 0.271
NP_440437.1_1 Forward -379 -360 -5.70374 0.292
NP_442012.1_1 Reverse -201 -220 6.88262 0.118
NP_441556.1_7 Forward -329 -310 8.06178 0.171
NP_441644.1_6 Forward -373 -363 15.4175 0.00595
NP_441644.1_6 Forward -216 -206 13.3526 0.0203
NP_441644.1_6 Reverse -333 -343 7.35439 0.129
NP_441644.1_6 Reverse -207 -217 6.27276 0.163
NP_441644.1_6 Reverse -320 -330 6.0761 0.167
NP_442215.1_2 Forward -218 -202 -4.07137 0.227
NP_442029.1_1 Reverse -362 -381 -19.8634 0.297
NP_442029.1_6 Forward -334 -315 8.75091 0.204
NP_442029.1_6 Reverse -359 -378 2.65439 0.291
NP_440253.1_2 Reverse -364 -382 3.3624 0.118
NP_440929.1_8 Forward -373 -364 16.5193 0.00413
NP_440929.1_8 Forward -216 -207 9.93116 0.0249
NP_440929.1_8 Reverse -207 -216 9.83282 0.0254
NP_440929.1_8 Reverse -364 -373 9.53783 0.0296
NP_440780.1_1 Forward -54 -35 7.49569 0.274
NP_442933.1_10 Forward -216 -207 17.601 0.00325
NP_442933.1_10 Reverse -207 -216 17.601 0.00325
NP_442933.1_10 Forward -373 -364 8.06287 0.0885
NP_442933.1_10 Reverse -364 -373 7.96454 0.0937
NP_442933.1_10 Forward -369 -360 3.7363 0.284
NP_441266.1_8 Reverse -150 -169 19.6665 0.108
NP_441751.2_8 Forward -215 -201 14.3559 0.0131
NP_442554.1_8 Forward -215 -205 14.828 0.0108
NP_442554.1_8 Reverse -365 -375 11.7798 0.0325
NP_442554.1_8 Forward -372 -362 5.28991 0.153
NP_442554.1_8 Reverse -208 -218 4.60159 0.18
NP_442554.1_8 Forward -341 -331 4.0116 0.2
NP_442554.1_8 Forward -328 -318 2.43831 0.272
NP_442554.1_9 Forward -165 -146 17.9355 0.178
NP_441762.1_7 Forward -217 -205 3.38223 0.0676
NP_441762.1_7 Reverse -363 -375 1.80894 0.0735
NP_441762.1_7 Reverse -206 -218 1.41561 0.0747
NP_441762.1_7 Forward -374 -362 -7.53251 0.293
NP_442142.1_4 Reverse -204 -217 5.62358 0.187
NP_442142.1_4 Forward -345 -332 4.05029 0.234
NP_442142.1_4 Forward -267 -254 2.47701 0.29
NP_442292.1_1 Forward -215 -206 9.53783 0.0183
NP_442292.1_1 Reverse -208 -217 0.589713 0.23
NP_442292.1_1 Reverse -365 -374 -0.0986038 0.239
NP_442292.1_1 Forward -372 -363 -0.295266 0.24
NP_441525.1_1 Reverse -316 -329 16.4406 0.203
NP_440039.1_9 Forward -384 -365 11.2092 0.284
NP_442476.1_6 Forward -215 -201 0.0979218 0.274
NP_442381.1_8 Reverse -204 -223 -11.2103 0.263
NP_442381.1_8 Forward -376 -357 -15.0452 0.292
NP_441523.1_6 Reverse -370 -389 3.24438 0.276
NP_443009.1_5 Reverse -206 -217 16.971 0.00677
NP_443009.1_5 Forward -217 -206 14.0211 0.0249
NP_443009.1_5 Reverse -363 -374 10.8746 0.0717
NP_443009.1_5 Forward -384 -373 7.138 0.137
NP_441715.1_4 Reverse -365 -375 9.12481 0.103
NP_441715.1_4 Forward -215 -205 7.25653 0.108
NP_441448.1_1 Reverse -253 -272 6.98095 0.236
NP_440183.1_1 Forward -215 -196 14.4541 0.239
NP_441198.1_4 Reverse -258 -277 11.2092 0.241
NP_441198.1_8 Reverse -205 -215 13.076 0.108
NP_441198.1_8 Forward -218 -208 12.0994 0.159
NP_440379.1_5 Reverse -316 -335 -0.4922 0.184
NP_440379.1_5 Forward -322 -303 -5.80207 0.227
NP_441468.1_1 Forward -215 -208 15.8704 0.0124
NP_441468.1_1 Reverse -208 -215 15.8704 0.0124
NP_441468.1_1 Reverse -365 -372 6.13563 0.209
NP_441468.1_1 Forward -372 -365 6.0373 0.223
NP_441468.1_1 Reverse -334 -341 3.97235 0.277
NP_439939.1_5 Forward -378 -359 13.3725 0.282
NP_441020.2_6 Reverse -205 -222 14.4935 0.0528
NP_441020.2_6 Forward -218 -201 7.11867 0.241
NP_441015.1_10 Reverse -359 -378 -4.81876 0.212
NP_441673.1_1 Reverse -364 -373 11.1111 0.0121
NP_441673.1_1 Forward -216 -207 11.1111 0.0121
NP_441673.1_1 Reverse -207 -216 11.0128 0.018
NP_441673.1_1 Forward -373 -364 11.0128 0.018
NP_441826.1_2 Reverse -201 -215 10.0294 0.0523
NP_441826.1_2 Reverse -320 -334 -3.73699 0.286
NP_441826.1_2 Reverse -327 -341 -4.62196 0.298
NP_442868.1_6 Reverse -205 -215 9.22315 0.0527
NP_442868.1_6 Reverse -362 -372 8.82982 0.0555
NP_442868.1_6 Forward -375 -365 0.471689 0.226
NP_442868.1_6 Forward -218 -208 0.275027 0.243
NP_442719.1_2 Forward -335 -317 -11.5846 0.292
NP_442227.1_4 Forward -293 -274 20.6481 0.0547
NP_442808.1_1 Forward -374 -364 19.0557 0.00201
NP_442808.1_1 Forward -384 -374 2.33954 0.27
NP_440031.1_10 Reverse -110 -129 0.982764 0.274
NP_442692.1_1 Forward -393 -374 -6.29373 0.291
NP_442718.1_1 Reverse -252 -271 1.0811 0.299
NP_442542.1_2 Forward -375 -362 12.2123 0.114
NP_442542.1_2 Reverse -362 -375 7.59077 0.176
NP_442542.1_9 Reverse -82 -96 12.9786 0.108
NP_442050.1_5 Reverse -205 -215 15.8108 0.0091
NP_440038.1_4 Forward -133 -114 11.9958 0.176
NP_442903.1_2 Forward -80 -61 8.83258 0.165
NP_441114.1_3 Reverse -321 -330 7.66954 0.231
NP_440558.1_2 Forward -322 -303 5.80098 0.137
NP_440558.1_2 Reverse -198 -217 -3.83545 0.239
NP_441518.1_3 Reverse -197 -216 -14.1602 0.269
NP_442792.1_5 Reverse -173 -190 9.67528 0.289
NP_441878.1_6 Reverse -363 -373 10.5014 0.0176
NP_441878.1_6 Forward -217 -207 10.5014 0.0176
NP_441878.1_6 Reverse -206 -216 10.4031 0.0176
NP_441878.1_6 Reverse -319 -329 2.24165 0.0462
NP_441878.1_6 Forward -374 -364 0.57002 0.14
NP_441878.1_6 Forward -384 -374 -0.314959 0.174
NP_441878.1_6 Forward -329 -319 -6.70647 0.194
NP_441036.1_8 Forward -374 -364 8.4365 0.174
NP_441036.1_8 Reverse -99 -109 8.4365 0.174
NP_441036.1_8 Forward -217 -207 8.1415 0.176
NP_441036.1_8 Reverse -363 -373 7.15819 0.208
NP_441557.1_5 Reverse -207 -216 18.6826 0.0015
NP_441557.1_5 Forward -216 -207 10.5211 0.00695
NP_441557.1_5 Reverse -364 -373 10.2261 0.0144
NP_441557.1_5 Forward -373 -364 10.1278 0.0188
NP_441445.1_1 Reverse -198 -217 7.66927 0.129
NP_441445.1_1 Reverse -310 -329 0.392778 0.275
NP_441590.1_4 Reverse -223 -242 2.35861 0.296
NP_441224.1_1 Forward -16 -3 19.9805 0.114
NP_440738.1_5 Forward -369 -350 -0.000545616 0.297
NP_442183.1_1 Forward -216 -202 11.0127 0.0775
NP_442166.1_3 Reverse -168 -187 -4.22878 0.264
NP_441574.1_1 Forward -236 -217 -6.58872 0.277
NP_441549.1_9 Forward -377 -359 -7.94566 0.216
NP_442347.1_2 Forward -295 -286 5.70292 0.226
NP_442347.1_2 Forward -129 -120 3.44131 0.284
NP_442347.1_2 Forward -215 -206 3.34298 0.284
NP_442645.1_2 Reverse -199 -218 -15.3402 0.197
NP_442645.1_2 Forward -337 -318 -19.0768 0.283
NP_442645.1_2 Reverse -356 -375 -21.4367 0.29
NP_441037.1_4 Reverse -205 -215 9.65667 0.21
NP_441037.1_4 Forward -218 -208 8.29227 0.237
NP_442594.1_8 Reverse -308 -327 2.16274 0.295
NP_442047.1_2 Reverse -240 -254 16.0275 0.161
NP_441633.1_3 Forward -375 -362 5.32916 0.0545
NP_441633.1_3 Forward -218 -205 -4.01229 0.179
NP_441633.1_3 Reverse -362 -375 -6.07724 0.236
NP_440136.1_2 Forward -215 -208 15.9687 0.0123
NP_440136.1_2 Reverse -208 -215 15.9687 0.0123
NP_440136.1_2 Reverse -365 -372 6.23397 0.171
NP_440136.1_2 Forward -372 -365 6.13563 0.193
NP_442590.1_9 Forward -217 -198 12.0942 0.223
NP_442590.1_10 Forward -236 -217 4.62101 0.273
NP_442998.1_5 Reverse -390 -400 14.6313 0.149
NP_442998.1_10 Forward -371 -364 15.5754 0.0102
NP_442998.1_10 Forward -214 -207 15.5754 0.0102
NP_442998.1_10 Reverse -366 -373 5.84064 0.235
NP_442998.1_10 Reverse -209 -216 5.74231 0.255
NP_440299.1_1 Reverse -203 -216 7.19687 0.119
NP_440299.1_1 Forward -377 -364 6.11523 0.152
NP_440299.1_1 Forward -220 -207 6.0169 0.155
NP_441799.1_1 Forward -220 -206 8.94708 0.103
NP_441799.1_1 Reverse -360 -374 8.84875 0.105
NP_441799.1_1 Reverse -203 -217 4.91554 0.232
NP_441007.1_10 Reverse -202 -215 0.805932 0.216
NP_440256.1_1 Forward -219 -200 4.22769 0.0459
NP_440256.1_1 Reverse -361 -380 3.14605 0.056
NP_440256.1_1 Reverse -248 -267 -8.85033 0.268
NP_440087.1_1 Reverse -198 -217 0.0977854 0.167
NP_441512.1_4 Reverse -203 -222 11.7992 0.237
NP_441559.1_8 Forward -378 -364 11.8976 0.0574
NP_441559.1_8 Reverse -369 -383 2.94952 0.143
NP_441559.1_8 Reverse -315 -329 -0.393733 0.175
NP_441559.1_8 Forward -323 -309 -5.90027 0.271
NP_441559.1_8 Forward -235 -221 -5.9986 0.271
NP_441559.1_8 Forward -265 -251 -6.68692 0.279
NP_440915.1_6 Reverse -370 -384 3.04785 0.109
NP_440915.1_6 Forward -377 -363 2.65453 0.113
NP_440915.1_6 Forward -220 -206 1.96621 0.128
NP_440915.1_6 Reverse -203 -217 1.96621 0.128
NP_442785.1_7 Reverse -362 -376 17.6992 0.0996
NP_442785.1_7 Forward -375 -361 12.1926 0.228
NP_441464.1_1 Forward -377 -358 6.19431 0.299
NP_441464.1_10 Reverse -113 -127 8.75105 0.27
NP_441939.1_3 Forward -372 -353 9.83255 0.133
NP_442993.1_1 Forward -236 -220 -13.0195 0.283
NP_442386.1_9 Forward -374 -365 11.8973 0.0799
NP_442386.1_9 Forward -217 -208 7.37413 0.219
NP_442386.1_9 Reverse -206 -215 6.39082 0.219
NP_440570.1_5 Forward -360 -341 1.0811 0.247
NP_440570.1_5 Reverse -300 -319 -1.86883 0.277
NP_441340.1_5 Forward -215 -208 15.6737 0.0124
NP_441340.1_5 Reverse -208 -215 15.6737 0.0124
NP_441340.1_5 Reverse -365 -372 13.5105 0.0314
NP_441340.1_5 Forward -341 -334 11.3472 0.0526
NP_441340.1_5 Forward -372 -365 5.84064 0.208
NP_440622.1_7 Reverse -359 -378 20.7473 0.039
NP_441947.1_4 Reverse -196 -215 12.1925 0.236
NP_440327.1_6 Reverse -298 -317 11.7992 0.176
NP_442240.1_2 Reverse -365 -384 -14.3569 0.178
NP_440586.1_8 Forward -215 -208 13.2151 0.026
NP_440586.1_8 Reverse -208 -215 13.2151 0.026
NP_440586.1_8 Forward -372 -365 9.47853 0.146
NP_440586.1_8 Reverse -228 -235 9.08521 0.178
NP_440586.1_8 Reverse -365 -372 5.74197 0.283
NP_440586.1_8 Reverse -334 -341 5.74197 0.283
NP_442251.1_6 Forward -215 -208 15.2804 0.0124
NP_442251.1_6 Reverse -208 -215 15.2804 0.0124
NP_440192.1_4 Reverse -362 -381 9.39761 0.276
NP_442959.1_4 Forward -334 -315 5.30933 0.25
NP_441262.1_3 Reverse -364 -371 14.7888 0.0223
NP_441262.1_3 Reverse -207 -214 14.7888 0.0223
NP_441262.1_3 Forward -216 -209 13.9038 0.0336
NP_440027.1_3 Forward -383 -365 15.358 0.0996
NP_440027.1_3 Reverse -364 -382 4.44329 0.26
NP_440027.1_3 Forward -329 -311 3.36165 0.273
NP_440027.1_8 Forward -376 -357 5.01354 0.285
NP_443051.1_1 Reverse -206 -215 18.0926 0.00402
NP_443051.1_1 Reverse -363 -372 15.1427 0.00754
NP_443051.1_1 Forward -217 -208 8.75118 0.027
NP_443051.1_1 Forward -374 -365 0.589713 0.143
NP_439984.1_3 Reverse -357 -371 13.2736 0.225
NP_439937.1_9 Forward -384 -367 -1.24015 0.122
NP_439937.1_9 Forward -374 -357 -7.82829 0.168
NP_439937.1_9 Reverse -363 -380 -8.61494 0.176
NP_439937.1_9 Forward -330 -313 -8.90993 0.177
NP_439937.1_9 Forward -217 -200 -15.0064 0.287
NP_439937.1_9 Forward -329 -312 -16.678 0.287
NP_441657.1_5 Forward -387 -368 3.53937 0.142
NP_441595.1_5 Forward -223 -205 7.68896 0.222
NP_441595.1_10 Forward -194 -175 13.7027 0.283
NP_440926.1_8 Reverse -361 -380 19.0757 0.0607
NP_440408.1_7 Reverse -358 -377 11.5042 0.224
NP_440439.1_1 Forward -376 -363 19.3905 0.0105
NP_440439.1_1 Reverse -361 -374 9.2624 0.0465
NP_440439.1_1 Reverse -204 -217 2.87088 0.124
NP_442239.1_8 Reverse -251 -270 5.70265 0.266
NP_440372.1_2 Forward -215 -208 16.3621 0.0124
NP_440372.1_2 Reverse -208 -215 16.3621 0.0124
NP_440372.1_2 Reverse -365 -372 13.8055 0.0214
NP_440372.1_2 Forward -372 -365 6.52896 0.188
NP_440574.1_3 Forward -347 -328 2.55606 0.173
NP_440139.1_1 Reverse -201 -220 10.9134 0.0874
NP_440139.1_1 Forward -222 -203 5.40686 0.159
NP_441572.1_7 Reverse -201 -220 -4.03212 0.224
NP_440267.1_2 Forward -221 -207 10.6187 0.134
NP_440267.1_2 Reverse -226 -240 7.57046 0.196
NP_440267.1_2 Reverse -202 -216 5.70218 0.259
NP_442384.1_10 Reverse -364 -377 11.0324 0.039
NP_442384.1_10 Forward -373 -360 10.934 0.0399
NP_442384.1_10 Forward -216 -203 9.16406 0.0571
NP_442384.1_10 Reverse -320 -333 3.06754 0.203
NP_441877.1_7 Reverse -380 -399 1.17865 0.242
NP_441018.1_3 Forward -163 -144 9.04509 0.294
NP_441018.1_7 Reverse -300 -319 9.73422 0.218
NP_441018.1_7 Forward -339 -320 7.47261 0.269
NP_442262.1_10 Forward -215 -208 14.1988 0.0123
NP_442262.1_10 Reverse -208 -215 14.1988 0.0123
NP_442262.1_10 Forward -372 -365 13.2155 0.0213
NP_442262.1_10 Reverse -334 -341 12.0355 0.062
NP_442262.1_10 Reverse -228 -235 9.38056 0.202
NP_441689.1_5 Reverse -205 -215 8.63269 0.132
NP_440344.1_10 Reverse -200 -217 -2.41943 0.0661
NP_440531.1_6 Reverse -199 -218 1.67108 0.17
NP_440531.1_6 Forward -381 -362 -3.73712 0.27
NP_442910.1_1 Reverse -200 -219 12.6841 0.0484
NP_440189.1_2 Reverse -356 -375 3.04771 0.268
NP_440189.1_10 Forward -227 -208 13.7658 0.13
NP_440189.1_10 Forward -141 -122 3.24438 0.282
NP_441640.1_8 Forward -259 -240 -3.14714 0.249
NP_440297.1_9 Forward -215 -205 19.0562 0.0359
NP_440297.1_9 Reverse -208 -218 1.06167 0.282
NP_440297.1_9 Reverse -334 -344 0.471689 0.282
NP_440297.1_9 Forward -372 -362 -0.216628 0.282
NP_442280.1_10 Forward -264 -246 10.3244 0.223
NP_441592.1_4 Reverse -207 -226 -3.14714 0.275
NP_441896.1_3 Forward -382 -363 18.4857 0.0308
NP_441896.1_3 Reverse -355 -374 -2.0655 0.275
NP_440894.1_4 Reverse -240 -259 4.42435 0.219
NP_440999.1_9 Forward -377 -363 6.88276 0.0932
NP_440999.1_9 Reverse -381 -395 1.17956 0.169
NP_440888.1_2 Reverse -364 -378 7.47213 0.194
NP_440888.1_2 Forward -216 -202 6.68548 0.223
NP_440888.1_2 Forward -383 -369 6.29216 0.241
NP_440888.1_2 Forward -230 -216 5.01387 0.298
NP_439969.1_3 Reverse -369 -388 15.1424 0.0661
NP_439969.1_3 Forward -378 -359 -0.885524 0.271
NP_439969.1_3 Forward -221 -202 -1.08219 0.271
NP_442277.1_4 Forward -382 -363 4.81688 0.184
NP_442033.1_10 Forward -385 -366 0.491109 0.106
NP_442033.1_10 Reverse -362 -381 -0.39387 0.119
NP_442033.1_10 Reverse -372 -391 -11.2103 0.251
NP_441123.1_6 Forward -224 -206 22.0453 0.0278
NP_441759.1_2 Reverse -199 -218 -0.4922 0.265
NP_441543.1_2 Forward -215 -206 9.34117 0.0818
NP_441543.1_2 Reverse -365 -374 9.14451 0.0856
NP_441543.1_2 Reverse -208 -217 6.29291 0.153
NP_442845.1_2 Forward -335 -321 8.55439 0.193
NP_442845.1_2 Forward -242 -228 8.25939 0.195
NP_442845.1_2 Reverse -201 -215 3.93283 0.272
NP_442845.1_2 Reverse -327 -341 3.63784 0.282
NP_441551.1_5 Forward -377 -361 6.54769 0.264
NP_440722.1_3 Reverse -175 -189 8.06273 0.293
NP_441469.1_8 Reverse -206 -215 13.3727 0.073
NP_441469.1_8 Forward -374 -365 6.29291 0.227
NP_441469.1_8 Forward -217 -208 5.3096 0.277
NP_441469.1_8 Reverse -373 -382 5.01461 0.297
NP_443064.1_6 Forward -373 -363 11.6943 0.124
NP_443064.1_6 Forward -216 -206 11.0156 0.13
NP_443064.1_6 Reverse -207 -217 10.2399 0.166
NP_443064.1_8 Forward -208 -198 14.4342 0.299
NP_442337.1_2 Forward -213 -194 18.289 0.0799
NP_441306.1_10 Reverse -253 -267 13.077 0.25
NP_442578.1_7 Forward -215 -208 14.5921 0.026
NP_442578.1_7 Reverse -208 -215 14.5921 0.026
NP_442578.1_7 Reverse -365 -372 6.0373 0.18
NP_440148.1_1 Reverse -175 -194 -7.37537 0.285
NP_441462.1_2 Reverse -207 -217 19.1546 0.00206
NP_441462.1_2 Forward -216 -206 10.4031 0.011
NP_441462.1_2 Forward -373 -363 10.3048 0.0123
NP_441462.1_2 Reverse -364 -374 9.81313 0.0143
NP_441462.1_2 Forward -329 -319 -1.29827 0.299
NP_443062.1_1 Reverse -104 -122 5.81572 0.218
NP_443062.1_1 Forward -216 -198 4.84065 0.247
NP_443062.1_6 Reverse -199 -218 6.4893 0.181
NP_443062.1_6 Forward -381 -362 0.58944 0.292
NP_441601.1_4 Forward -367 -348 -6.09707 0.296
NP_442204.1_1 Forward -377 -366 0.353664 0.281
NP_442204.1_1 Reverse -360 -371 0.157002 0.283
NP_442204.1_5 Reverse -364 -383 7.17762 0.134
NP_442204.1_5 Reverse -316 -335 0.491109 0.261
NP_442204.1_6 Reverse -365 -384 9.24257 0.223
NP_440516.1_2 Forward -379 -361 16.3421 0.046
NP_440516.1_8 Reverse -364 -373 16.9127 0.00442
NP_440516.1_8 Forward -373 -364 14.8477 0.00685
NP_440516.1_8 Reverse -207 -216 9.4395 0.0183
NP_440516.1_8 Forward -216 -207 7.17789 0.0754
NP_440516.1_8 Forward -342 -333 -0.68859 0.297
NP_442428.1_5 Forward -215 -208 15.8704 0.0124
NP_442428.1_5 Reverse -208 -215 15.8704 0.0124
NP_442428.1_5 Reverse -365 -372 6.13563 0.209
NP_442428.1_5 Forward -372 -365 6.0373 0.212
NP_442428.1_5 Reverse -334 -341 4.36568 0.271
NP_442120.1_10 Forward -236 -217 -14.7502 0.289
NP_440673.1_2 Reverse -197 -216 12.9259 0.131
NP_440673.1_3 Reverse -209 -216 14.0021 0.0426
NP_440673.1_3 Forward -371 -364 12.4288 0.0426
NP_440673.1_3 Forward -214 -207 12.4288 0.0426
NP_440865.1_9 Reverse -358 -377 -0.197208 0.153
NP_441052.1_2 Reverse -374 -384 2.04498 0.22
NP_441052.1_2 Forward -216 -206 1.94665 0.221
NP_441052.1_2 Reverse -364 -374 0.963343 0.255
NP_441052.1_2 Forward -373 -363 0.57002 0.256
NP_441052.1_2 Reverse -207 -217 0.57002 0.256
NP_441052.1_2 Forward -400 -390 -0.118297 0.266
NP_442219.1_8 Forward -323 -304 8.16711 0.253
NP_442219.1_9 Reverse -208 -217 8.94785 0.0681
NP_442219.1_9 Forward -215 -206 8.25953 0.0681
NP_440436.1_4 Forward -215 -206 15.9289 0.00508
NP_440436.1_4 Reverse -208 -217 14.6506 0.0111
NP_440436.1_4 Reverse -365 -374 8.65242 0.0997
NP_440436.1_4 Forward -372 -363 6.29249 0.164
NP_441884.1_8 Reverse -363 -382 -6.1954 0.217
NP_440314.1_9 Forward -215 -196 -5.99873 0.225
NP_439982.1_5 Reverse -362 -381 16.1257 0.141
NP_441719.1_4 Forward -215 -208 16.3621 0.0124
NP_441719.1_4 Reverse -208 -215 16.3621 0.0124
NP_441719.1_4 Reverse -365 -372 6.82395 0.0855
NP_441719.1_4 Forward -372 -365 6.52896 0.188
NP_441733.1_10 Reverse -204 -217 9.16406 0.124
NP_441733.1_10 Forward -219 -206 3.46087 0.3
NP_441004.1_1 Forward -334 -315 -11.4069 0.238
NP_441004.1_1 Reverse -304 -323 -14.1602 0.265
NP_441004.1_4 Forward -331 -321 10.8948 0.254
NP_441004.1_5 Forward -332 -318 7.07942 0.292
NP_441004.1_5 Reverse -306 -320 6.58777 0.298
NP_442366.1_3 Reverse -206 -224 5.91901 0.0829
NP_442366.1_3 Forward -343 -325 -1.84914 0.219
NP_442366.1_5 Forward -101 -91 10.3043 0.276
NP_442366.1_5 Forward -219 -209 10.0093 0.292
NP_440296.1_6 Reverse -56 -74 11.7475 0.295
NP_440328.1_4 Forward -379 -360 9.43923 0.0991
NP_443054.1_2 Reverse -324 -338 6.6861 0.185
NP_443054.1_2 Reverse -318 -332 1.17956 0.251
NP_443054.1_2 Reverse -205 -219 0.786239 0.254
NP_442430.1_7 Forward -76 -57 16.1736 0.273
NP_441851.1_10 Reverse -206 -216 18.6629 0.0027
NP_441851.1_10 Reverse -373 -383 8.73149 0.114
NP_441851.1_10 Forward -217 -207 8.23984 0.12
NP_441851.1_10 Reverse -363 -373 7.84651 0.13
NP_441851.1_10 Forward -374 -364 6.17489 0.182
NP_442515.1_1 Forward -374 -360 1.08123 0.172
NP_442515.1_1 Reverse -206 -220 -3.73699 0.297
NP_441683.1_7 Reverse -161 -180 -7.27704 0.272
NP_441982.1_6 Reverse -12 -21 11.6259 0.288
NP_442689.1_8 Forward -155 -138 -2.71443 0.235
NP_441349.1_10 Reverse -354 -373 7.47261 0.0313
NP_440432.1_9 Forward -215 -200 6.9614 0.0441
NP_440432.1_9 Reverse -208 -223 -2.08505 0.167
NP_440474.1_8 Forward -215 -201 4.62054 0.271
NP_442450.1_5 Reverse -205 -215 19.1546 0.0103
NP_442450.1_5 Forward -218 -208 8.82982 0.124
NP_442450.1_5 Forward -298 -288 8.23984 0.13
NP_442450.1_5 Forward -344 -334 6.96153 0.146
NP_440588.1_2 Forward -225 -206 1.86774 0.127
NP_440588.1_2 Reverse -355 -374 -0.39387 0.15
NP_440943.1_5 Forward -239 -225 17.0108 0.22
NP_442006.1_2 Reverse -95 -112 -16.8741 0.265
NP_443047.1_7 Forward -215 -196 7.47261 0.22
NP_441570.1_1 Forward -216 -198 -8.14232 0.104
NP_441078.1_4 Reverse -364 -373 9.93116 0.0203
NP_441078.1_4 Forward -216 -207 9.93116 0.0203
NP_441078.1_4 Reverse -207 -216 9.83282 0.0226
NP_441078.1_4 Forward -373 -364 9.83282 0.0226
NP_441078.1_4 Reverse -374 -383 5.11294 0.118
NP_441078.1_4 Reverse -320 -329 -1.6719 0.266
NP_442443.1_1 Reverse -334 -353 -5.40875 0.282
NP_441094.1_6 Reverse -200 -217 15.2794 0.158
NP_440526.1_3 Forward -215 -204 10.8746 0.0646
NP_441432.1_8 Reverse -206 -215 8.35786 0.0755
NP_441432.1_8 Reverse -363 -372 5.60459 0.147
NP_442320.1_8 Reverse -201 -215 4.81781 0.0459
NP_442344.1_7 Reverse -208 -227 -6.78538 0.172
NP_441732.1_2 Forward -377 -361 -16.1661 0.165
NP_440313.1_1 Forward -330 -311 22.0256 0.0364
NP_440313.1_6 Forward -307 -288 18.1907 0.167
NP_440313.1_8 Forward -153 -134 19.2723 0.124
NP_440629.1_4 Forward -318 -299 7.66927 0.287
NP_440760.1_1 Forward -373 -354 -21.9284 0.246
NP_440760.1_1 Reverse -364 -383 -22.8133 0.271
NP_440760.1_1 Reverse -89 -108 -23.4033 0.297
NP_442797.1_9 Reverse -187 -205 12.9988 0.136
NP_440199.1_10 Reverse -204 -214 7.74818 0.231
NP_442489.1_7 Forward -373 -364 10.5211 0.0102
NP_442489.1_7 Reverse -364 -373 10.4228 0.0151
NP_442489.1_7 Forward -216 -207 10.4228 0.0151
NP_442489.1_7 Reverse -207 -216 10.3245 0.0193
NP_442489.1_7 Reverse -320 -329 -1.47524 0.203
NP_442489.1_7 Reverse -374 -383 -1.6719 0.235
NP_442489.1_7 Forward -329 -320 -1.96689 0.28
NP_440386.1_3 Reverse -139 -158 -11.8003 0.287
NP_442079.1_6 Reverse -212 -231 14.5524 0.273
NP_442079.1_7 Forward -215 -196 8.75091 0.119
NP_440559.1_1 Reverse -208 -217 17.4043 0.00658
NP_440559.1_1 Forward -215 -206 17.306 0.00658
NP_440559.1_1 Forward -372 -363 7.66954 0.0999
NP_440559.1_1 Reverse -365 -374 5.99792 0.135
NP_441659.2_8 Forward -216 -206 17.0896 0.00284
NP_441659.2_8 Forward -373 -363 16.2046 0.0035
NP_441659.2_8 Reverse -207 -217 9.7148 0.0271
NP_441659.2_8 Reverse -364 -374 2.43831 0.2
NP_441659.2_8 Forward -98 -88 0.275027 0.27
NP_440860.1_8 Forward -350 -331 14.3558 0.296
NP_440284.1_8 Forward -339 -320 11.7 0.266
NP_441022.1_1 Forward -66 -57 11.1625 0.284
NP_442913.1_1 Reverse -215 -234 14.7491 0.0573
NP_439912.1_3 Forward -95 -77 18.7012 0.0791
NP_441040.1_2 Forward -225 -206 -11.7019 0.255
NP_439956.1_7 Reverse -368 -387 4.52268 0.257
NP_442008.1_2 Reverse -334 -353 5.89931 0.223
NP_441800.1_7 Forward -269 -251 18.112 0.0382
NP_440779.1_5 Forward -216 -199 -6.05768 0.159
NP_440779.1_5 Reverse -207 -224 -13.4325 0.212
NP_442346.1_5 Reverse -206 -216 17.4829 0.00248
NP_442346.1_5 Forward -217 -207 15.8113 0.0045
NP_442346.1_5 Forward -99 -89 10.3048 0.101
NP_442346.1_5 Reverse -363 -373 8.82982 0.124
NP_442346.1_5 Reverse -319 -329 4.60159 0.281
NP_440545.1_3 Reverse -360 -377 4.46374 0.0703
NP_440545.1_3 Forward -220 -203 1.31714 0.121
NP_440545.1_3 Forward -387 -370 -6.05768 0.268
NP_441856.1_3 Reverse -204 -223 -3.83545 0.3
NP_441786.1_10 Reverse -355 -374 7.66927 0.257
NP_441653.1_1 Reverse -36 -50 18.8791 0.155
NP_442603.1_7 Reverse -364 -378 11.012 0.125
NP_441585.1_5 Forward -287 -268 0.195343 0.291
NP_441888.1_7 Forward -378 -364 4.03116 0.225
NP_440449.1_6 Reverse -325 -343 6.11605 0.259
NP_441948.1_4 Reverse -357 -375 6.50899 0.0633
NP_441948.1_4 Forward -380 -362 -0.7675 0.139
NP_439970.1_4 Reverse -295 -314 5.50599 0.155
NP_441833.1_4 Forward -215 -208 15.9687 0.0124
NP_441833.1_4 Reverse -208 -215 15.9687 0.0124
NP_441833.1_4 Forward -372 -365 6.52896 0.0924
NP_441833.1_4 Reverse -365 -372 6.23397 0.163
NP_441329.1_6 Reverse -174 -193 3.19856 0.217
NP_441112.1_8 Reverse -140 -159 1.67108 0.257
NP_442162.1_9 Forward -215 -208 16.2637 0.0124
NP_442162.1_9 Reverse -208 -215 16.2637 0.0124
NP_442162.1_9 Forward -372 -365 12.9205 0.0282
NP_442162.1_9 Reverse -365 -372 12.9205 0.0282
NP_440671.1_4 Reverse -201 -215 14.3559 0.0632
NP_440671.1_4 Reverse -327 -341 11.996 0.12
NP_441973.1_1 Forward -177 -162 -7.88658 0.293
NP_442140.1_3 Reverse -208 -218 13.2547 0.0609
NP_442140.1_3 Forward -372 -362 9.51814 0.107
NP_442140.1_3 Forward -215 -205 5.68323 0.198
NP_442140.1_3 Reverse -365 -375 4.99491 0.232
NP_442140.1_3 Reverse -334 -344 4.40493 0.243
NP_441609.1_1 Reverse -272 -291 6.68596 0.178
NP_440875.1_9 Forward -326 -316 7.30133 0.269
NP_441813.1_5 Forward -375 -365 16.303 0.01
NP_441813.1_5 Reverse -205 -215 16.1063 0.01
NP_441813.1_5 Reverse -362 -372 8.63316 0.0367
NP_441813.1_5 Forward -218 -208 8.04317 0.0491
NP_441813.1_5 Reverse -331 -341 3.02829 0.178
NP_442028.1_1 Reverse -30 -43 10.5659 0.251
NP_442028.1_1 Reverse -59 -72 7.89211 0.289
NP_441227.1_7 Forward -328 -309 15.0057 0.212
NP_442254.1_7 Reverse -67 -86 12.9791 0.284
NP_440590.1_4 Reverse -365 -378 23.6187 0.00256
NP_440590.1_4 Forward -382 -369 3.26421 0.0749
NP_440567.1_1 Forward -215 -201 15.8309 0.0166
NP_440567.1_1 Reverse -208 -222 6.98109 0.0795
NP_442497.1_10 Forward -215 -206 19.8626 0.00532
NP_442497.1_10 Reverse -208 -217 17.9943 0.00813
NP_442497.1_10 Forward -372 -363 10.0295 0.0222
NP_442497.1_10 Reverse -365 -374 0.688044 0.141
NP_440821.1_4 Reverse -205 -215 19.8429 0.00399
NP_440821.1_4 Forward -218 -208 2.24165 0.131
NP_440821.1_4 Reverse -362 -372 1.25834 0.139
NP_440821.1_4 Forward -375 -365 0.373358 0.18
NP_441239.1_9 Forward -375 -363 16.4603 0.0175
NP_441239.1_9 Forward -218 -206 12.7237 0.0433
NP_441239.1_9 Reverse -205 -217 11.1504 0.0648
NP_441239.1_9 Reverse -318 -330 8.9871 0.117
NP_441239.1_9 Forward -262 -250 8.00379 0.145
NP_441239.1_9 Reverse -362 -374 5.44718 0.221
NP_441239.1_9 Reverse -331 -343 4.07055 0.264
NP_441951.1_4 Forward -348 -329 0.294447 0.297
NP_441892.1_1 Reverse -218 -235 -1.73112 0.212
NP_441892.1_1 Reverse -198 -215 -5.36936 0.279
NP_442669.1_1 Reverse -28 -47 0.196116 0.291
NP_440604.1_6 Reverse -207 -226 -2.55715 0.221
NP_441508.1_4 Reverse -220 -234 14.7174 0.277
NP_440863.1_1 Reverse -197 -211 15.9355 0.203
NP_440354.1_7 Reverse -358 -376 9.65558 0.224
NP_441617.1_6 Reverse -178 -197 -1.18052 0.256
NP_442052.1_8 Forward -218 -208 14.1397 0.253
NP_440546.1_4 Reverse -207 -217 14.5061 0.0459
NP_440546.1_4 Forward -216 -206 13.6334 0.0459
NP_440546.1_4 Reverse -364 -374 12.8578 0.0572
NP_440546.1_4 Forward -342 -332 11.3065 0.0872
NP_440546.1_4 Forward -373 -363 10.2399 0.109
NP_440546.1_4 Reverse -333 -343 8.10685 0.203
NP_440546.1_4 Forward -236 -226 6.74945 0.282
NP_441230.1_3 Reverse -362 -381 2.26107 0.289
NP_441230.1_5 Reverse -359 -378 2.85105 0.209
NP_440462.1_6 Forward -375 -365 14.3364 0.0215
NP_440462.1_6 Reverse -205 -215 7.84651 0.0699
NP_440462.1_6 Reverse -331 -341 3.22496 0.255
NP_440462.1_6 Reverse -98 -108 2.04498 0.294
NP_442899.1_4 Reverse -176 -192 5.56438 0.29
NP_440868.1_4 Reverse -360 -372 8.10212 0.0602
NP_440868.1_4 Forward -377 -365 3.77555 0.133
NP_440868.1_4 Reverse -203 -215 -0.452677 0.269
NP_442479.1_9 Forward -158 -139 -11.8986 0.275
NP_441582.1_5 Forward -331 -312 5.2102 0.216
NP_442402.1_4 Forward -30 -11 6.78348 0.131
NP_441848.1_7 Forward -185 -166 6.39016 0.196
NP_440696.1_3 Reverse -364 -382 0.0191479 0.237
NP_442039.1_4 Forward -215 -208 15.1821 0.0124
NP_442039.1_4 Reverse -208 -215 15.1821 0.0124
NP_442039.1_4 Reverse -365 -372 11.6422 0.0747
NP_442039.1_7 Forward -326 -316 7.35486 0.277
NP_442039.1_7 Reverse -217 -227 7.15819 0.279
NP_442829.1_2 Reverse -177 -193 7.56129 0.297
NP_441926.1_3 Forward -342 -326 2.91013 0.251
NP_440825.1_7 Reverse -208 -218 14.2759 0.152
NP_442837.1_3 Forward -215 -208 15.7721 0.0124
NP_442837.1_3 Reverse -208 -215 15.7721 0.0124
NP_442837.1_3 Forward -372 -365 6.0373 0.25
NP_442837.1_3 Reverse -365 -372 6.0373 0.25
NP_442053.1_1 Forward -373 -364 16.6177 0.00257
NP_442053.1_1 Reverse -207 -216 9.24284 0.068
NP_442053.1_1 Forward -216 -207 8.94785 0.07
NP_442053.1_1 Reverse -364 -373 8.65285 0.0741
NP_442053.1_1 Reverse -333 -342 3.93297 0.278
NP_440505.1_3 Reverse -362 -372 8.04317 0.147
NP_440505.1_3 Reverse -205 -215 7.55152 0.151
NP_440505.1_3 Forward -375 -365 6.07655 0.197
NP_440505.1_7 Reverse -97 -116 3.93269 0.207
NP_442360.1_5 Forward -104 -94 12.9597 0.298
NP_441102.1_1 Forward -341 -322 6.09597 0.246
NP_441203.1_1 Reverse -208 -227 -12.5869 0.143
NP_441408.2_7 Forward -321 -302 -3.3438 0.272
NP_440914.1_1 Reverse -320 -330 12.5188 0.0569
NP_440914.1_1 Reverse -327 -337 8.71269 0.186
NP_440914.1_1 Forward -216 -206 7.24882 0.242
NP_440914.1_1 Forward -373 -363 6.56569 0.273
NP_441011.1_8 Reverse -208 -217 15.6344 0.00738
NP_441011.1_8 Forward -215 -206 14.356 0.0249
NP_441011.1_8 Reverse -365 -374 13.3727 0.0328
NP_442101.1_10 Forward -224 -205 3.93269 0.0668
NP_442533.1_6 Reverse -207 -216 15.1427 0.00675
NP_442533.1_6 Forward -373 -364 14.2577 0.0132
NP_442533.1_6 Reverse -364 -373 7.47288 0.0898
NP_442533.1_6 Forward -216 -207 7.47288 0.0898
NP_442533.1_6 Reverse -374 -383 5.80125 0.128
NP_442533.1_6 Reverse -320 -329 4.71961 0.177
NP_442533.1_6 Forward -394 -385 2.75299 0.241
NP_442541.1_10 Forward -329 -315 2.5556 0.255
NP_442232.1_3 Reverse -356 -375 5.01433 0.0823
NP_441482.1_7 Reverse -358 -372 -1.08205 0.0618
NP_441482.1_7 Reverse -201 -215 -1.47537 0.0721
NP_441482.1_7 Forward -379 -365 -2.06536 0.0922
NP_439944.1_9 Forward -215 -205 17.3846 0.00516
NP_439944.1_9 Reverse -208 -218 7.15819 0.153
NP_439944.1_9 Reverse -305 -315 5.78156 0.221
NP_441697.1_5 Forward -72 -53 -10.2658 0.278
NP_441028.1_6 Forward -177 -167 3.51951 0.292
NP_442202.1_10 Forward -329 -315 5.21113 0.255
NP_440116.1_8 Forward -215 -196 -1.86883 0.122
NP_440115.1_6 Reverse -361 -371 15.3197 0.0488
NP_440115.1_6 Forward -219 -209 8.33817 0.13
NP_440007.1_9 Reverse -329 -343 1.67122 0.285
NP_440007.1_9 Reverse -203 -217 1.57289 0.285
NP_441347.1_5 Forward -330 -316 8.3571 0.292
NP_441602.1_3 Reverse -359 -378 -5.11376 0.278
NP_441170.1_2 Forward -342 -323 6.58763 0.128
NP_441106.1_1 Reverse -206 -215 9.73449 0.0311
NP_441106.1_1 Forward -217 -208 8.84951 0.0431
NP_441106.1_1 Forward -374 -365 8.55452 0.0538
NP_440429.1_4 Forward -223 -204 18.879 0.113
NP_001035870.1_3 Forward -340 -321 0.392778 0.176
NP_442306.1_10 Forward -378 -359 -1.86883 0.0583
NP_442306.1_10 Reverse -315 -334 -3.93378 0.11
NP_441286.1_1 Forward -217 -205 5.34885 0.0259
NP_441286.1_1 Reverse -206 -218 -3.20594 0.145
NP_441286.1_1 Forward -374 -362 -3.89426 0.147
NP_440670.1_8 Reverse -364 -373 18.0926 0.00136
NP_440670.1_8 Forward -373 -364 15.831 0.00494
NP_440670.1_8 Reverse -207 -216 8.94785 0.0606
NP_440670.1_8 Forward -216 -207 8.84951 0.0606
NP_440670.1_8 Forward -329 -320 5.01461 0.175
NP_440886.1_7 Forward -374 -364 16.4991 0.0104
NP_442614.1_2 Reverse -207 -221 8.84938 0.244
NP_440404.1_9 Reverse -137 -156 16.9494 0.142
NP_441784.1_4 Forward -180 -161 3.24438 0.262
NP_442072.1_9 Reverse -363 -381 -15.9105 0.192
NP_441427.1_6 Forward -332 -314 7.19731 0.297
NP_441403.1_4 Reverse -344 -362 5.62401 0.293
NP_440907.2_8 Reverse -208 -218 13.3526 0.0442
NP_440907.2_8 Forward -215 -205 9.81266 0.103
NP_440907.2_8 Forward -112 -102 9.616 0.103
NP_440907.2_8 Forward -372 -362 8.14104 0.117
NP_442264.1_2 Reverse -309 -326 5.84037 0.27
NP_441021.1_8 Reverse -359 -377 4.9357 0.215
NP_441021.1_8 Reverse -202 -220 0.707465 0.299
NP_440841.1_4 Reverse -205 -224 -10.0303 0.27
NP_441463.1_3 Reverse -197 -216 -3.83545 0.188
NP_442893.1_4 Reverse -55 -74 18.1898 0.0624
NP_441626.1_2 Forward -215 -208 15.7721 0.0124
NP_441626.1_2 Reverse -208 -215 15.7721 0.0124
NP_441626.1_2 Reverse -365 -372 12.2322 0.0511
NP_441626.1_2 Forward -372 -365 5.93897 0.231
NP_442365.1_7 Forward -377 -358 -0.295539 0.177
NP_442794.1_1 Reverse -306 -318 2.20226 0.299
NP_442615.1_1 Forward -225 -207 19.1937 0.00504
NP_442615.1_1 Reverse -355 -373 -3.91409 0.171
NP_441962.1_4 Reverse -148 -167 -4.91709 0.162
NP_441431.1_2 Reverse -316 -330 13.5686 0.0869
NP_441431.1_2 Forward -376 -362 8.3571 0.218
NP_441431.1_2 Reverse -204 -218 8.16044 0.222
NP_441431.1_2 Forward -219 -205 7.57046 0.238
NP_441431.1_2 Reverse -361 -375 6.0955 0.28
NP_441993.1_1 Forward -335 -316 2.1416 0.262
NP_440814.1_4 Reverse -198 -217 -12.1936 0.23
NP_440467.1_8 Forward -354 -335 9.63589 0.298
NP_440114.1_10 Forward -216 -202 16.1259 0.02
NP_440114.1_10 Forward -373 -359 14.1593 0.0429
NP_440114.1_10 Reverse -333 -347 7.47274 0.235
NP_440114.1_10 Forward -329 -315 6.48943 0.269
NP_440114.1_10 Reverse -207 -221 5.80112 0.292
NP_440293.1_3 Reverse -302 -321 1.37609 0.207
NP_440293.1_3 Forward -336 -317 -4.91709 0.268
NP_440766.1_4 Reverse -352 -366 7.37441 0.0939
NP_440766.1_4 Reverse -203 -217 7.07942 0.097
NP_440766.1_4 Reverse -360 -374 1.86788 0.209
NP_440766.1_5 Reverse -181 -193 14.8177 0.193
NP_439988.1_3 Forward -333 -319 4.81781 0.292
NP_441237.1_9 Reverse -122 -132 11.1898 0.196
NP_442743.1_4 Reverse -365 -384 2.94938 0.159
NP_442743.1_5 Forward -215 -196 5.50599 0.202
NP_440457.1_1 Reverse -203 -215 19.4102 0.0344
NP_440457.1_1 Reverse -360 -372 13.3137 0.0903
NP_440213.1_5 Forward -340 -321 11.5042 0.214
NP_440798.1_6 Reverse -208 -221 12.114 0.0516
NP_440798.1_6 Forward -372 -359 3.26421 0.151
NP_440798.1_6 Forward -112 -99 1.10092 0.234
NP_442680.1_5 Reverse -13 -32 -0.220842 0.278
NP_441984.1_1 Forward -379 -361 6.31233 0.288
NP_442509.1_9 Forward -373 -363 14.6309 0.0263
NP_442509.1_9 Reverse -364 -374 13.4509 0.0553
NP_442509.1_9 Reverse -207 -217 8.04271 0.192
NP_442509.1_9 Forward -216 -206 7.84605 0.2
NP_441253.1_8 Forward -221 -207 10.7645 0.282
NP_440554.1_4 Forward -215 -205 6.96153 0.107
NP_440554.1_4 Reverse -365 -375 6.76487 0.114
NP_440554.1_4 Forward -372 -362 5.87989 0.129
NP_440554.1_4 Reverse -208 -218 1.74999 0.29
NP_441845.1_6 Forward -354 -336 8.57394 0.125
NP_441885.1_5 Reverse -207 -217 10.1081 0.0145
NP_441885.1_5 Reverse -364 -374 9.22315 0.0223
NP_441885.1_5 Forward -216 -206 1.65166 0.106
NP_441885.1_5 Forward -373 -363 1.55333 0.109
NP_440478.1_4 Forward -352 -333 10.7175 0.267
NP_440478.1_10 Forward -375 -361 6.88276 0.286
NP_442341.1_7 Forward -384 -370 19.1741 0.00893
NP_442341.1_7 Reverse -363 -377 6.78443 0.118
NP_442341.1_7 Forward -395 -381 1.96621 0.274
NP_442341.1_9 Forward -375 -361 5.30886 0.274
NP_441756.1_5 Forward -377 -358 -2.45882 0.277
NP_441173.1_9 Forward -19 -11 13.1954 0.184
NP_441173.1_9 Forward -20 -12 12.9004 0.206
NP_441173.1_9 Forward -398 -390 12.1137 0.21
NP_441173.1_9 Forward -190 -182 12.1137 0.21
NP_440423.1_6 Reverse -356 -375 -4.13045 0.126
NP_440423.1_6 Reverse -199 -218 -21.0434 0.279
NP_443000.1_7 Reverse -205 -215 8.82982 0.0437
NP_443000.1_7 Reverse -362 -372 1.94665 0.226
NP_443000.1_7 Forward -375 -365 1.74999 0.229
NP_443000.1_7 Forward -218 -208 1.35667 0.251
NP_441842.1_10 Reverse -200 -214 11.0127 0.145
NP_440275.1_3 Reverse -362 -372 14.4347 0.0216
NP_440275.1_3 Reverse -205 -215 10.0098 0.0454
NP_440275.1_3 Forward -375 -365 5.78156 0.131
NP_440275.1_3 Forward -218 -208 1.35667 0.29
NP_440091.1_1 Reverse -203 -215 10.8554 0.0429
NP_440312.1_6 Reverse -62 -81 15.7877 0.271
NP_440312.1_7 Reverse -134 -153 18.8592 0.266
NP_443060.1_5 Forward -337 -318 4.52188 0.295
NP_440679.1_10 Reverse -335 -354 -11.6036 0.182
NP_442451.1_2 Forward -381 -362 4.52268 0.121
NP_441122.1_1 Forward -333 -318 14.7295 0.126
NP_441122.1_1 Reverse -305 -320 3.02816 0.287
NP_440175.1_4 Reverse -243 -262 -12.6852 0.235
NP_440149.1_8 Reverse -364 -383 -0.983855 0.154
NP_441105.1_3 Reverse -353 -372 -6.88371 0.243
NP_442373.1_2 Forward -101 -82 -7.37537 0.233
NP_440216.1_1 Forward -373 -359 14.1593 0.00516
NP_440216.1_1 Reverse -207 -221 5.70279 0.0186
NP_440216.1_1 Reverse -364 -378 -1.08205 0.0293
NP_440216.1_1 Forward -216 -202 -2.16369 0.0482
NP_440216.1_1 Forward -329 -315 -11.6035 0.203
NP_440172.1_1 Reverse -207 -217 18.5646 0.00421
NP_440172.1_1 Forward -373 -363 13.353 0.0211
NP_440172.1_1 Forward -216 -206 6.56821 0.102
NP_440172.1_1 Reverse -320 -330 6.07655 0.115
NP_440172.1_1 Reverse -333 -343 1.74999 0.299
NP_442015.1_10 Forward -377 -364 19.2922 0.00444
NP_442015.1_10 Forward -220 -207 4.05085 0.178
NP_442015.1_10 Reverse -360 -373 3.16588 0.185
NP_441226.1_7 Forward -215 -208 14.4934 0.0123
NP_441226.1_7 Reverse -208 -215 14.4934 0.0123
NP_441226.1_7 Reverse -365 -372 12.7234 0.0312
NP_441226.1_7 Forward -341 -334 12.4284 0.0404
NP_441226.1_7 Forward -372 -365 11.5435 0.0757
NP_441111.1_7 Forward -215 -207 18.7023 0.00294
NP_441111.1_7 Reverse -365 -373 8.96754 0.0463
NP_441111.1_7 Forward -372 -364 8.86921 0.0589
NP_441111.1_7 Reverse -208 -216 8.86921 0.0589
NP_441766.1_2 Reverse -207 -216 17.896 0.00297
NP_441766.1_2 Forward -373 -364 13.9627 0.0114
NP_441766.1_2 Forward -216 -207 9.4395 0.0285
NP_441766.1_2 Reverse -364 -373 7.76787 0.0714
NP_440416.1_9 Reverse -357 -376 -6.78538 0.0943
NP_440416.1_9 Forward -336 -317 -11.3086 0.149
NP_440416.1_9 Forward -380 -361 -13.7669 0.169
NP_440416.1_9 Reverse -302 -321 -19.2734 0.272
NP_443052.1_8 Forward -226 -207 -1.47551 0.0795
NP_443052.1_8 Reverse -197 -216 -6.1954 0.141
NP_443052.1_9 Forward -271 -252 -0.787193 0.216
NP_440591.1_9 Reverse -363 -381 5.82068 0.235
NP_440261.1_5 Reverse -208 -221 -1.16069 0.0662
NP_440261.1_5 Forward -372 -359 -4.40561 0.147
NP_440261.1_5 Reverse -365 -378 -6.37223 0.201
NP_440261.1_5 Reverse -375 -388 -6.56889 0.201
NP_440261.1_5 Forward -215 -202 -10.3055 0.201
NP_440261.1_5 Reverse -90 -103 -11.9771 0.268
NP_440988.1_5 Reverse -70 -89 16.272 0.183
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTTTTGCCCATTACCGGTGCATCGCCGCCGATCGCCCGCTCTAAACTGCGGCTTAAGCGCCATCGGGTTTGGCCATTGGCCGCCAATACCAAAGCTAATGTTGGTTGATCCAAAACCCGGTCAGATTTCAAACTTCGCCACCACTGGCCATATAACTGGGTTAATCGATGGGTTTTGCCACTGAGCGATCGCCCTTCTAGCCAGATTATTTCTGCCAAATCTTTTACCCCTGATAGTTCCCGTTGGTTCTGCTAAGATTTCCTGTATTGCTCAATCCCAAAACCTTACGGATCGAACCCTGGGCCACCGTAGTTTGGGTAGCTTGAAAGAAAACTAAAACTTTATCAGACAACCTTATCAAACAATATCTTAGCTGTTTTTTTACCCAATCATCAGTCA

CDS

ATGGATTTAACAAATTGGTGGCAAGGGGCAACCCAGTGGTTTGGCAGATCTTCACAAAAATCCTTGGAGCAAGCCTTCCGGTCTGCCCTAAAAATAAAAGAAATTGAAGATCAATACTTCCAAGGCAAAAAAATAGGGCCAGAAAATTGTGATTATAGTGCCGACACTGTCACCTATTTTGCCAACCAAATTCAGCGGCATCTGAGGAAAATAGAGCAGGAAATTTACCACCTCAACAGCGACCAAGAATTCGTCAAAATTCTGAGCCTAGATCCAGCAGTTAAACAGGATCCACAAACGGAATATGTTCTCAATCAATTGCAATTCATTGATGACATATTGCAACGCTATGACGGTGAACTGCCCCAGGTTAGTCCCCCCAAGCAAATTGCCAATGGGGGCGTTCTGGATTTACCCGCCATAACTGCTAATAAACAACGGCAAATCAACAAAAAGCGCCGGGACGGTTTTCAATATATTCGGCGGGAAGATACCCAACAAAAAGTAGATACTGCCACCCAAAAATCTGGCGTTTTGCCCCGTTCCTTCTTGCGTACCATCGACCGTCTGAAGCGGGAAATGGACCCCCAGTCCAGTGACACTGAGCAAAAGGTGCTCAAACAATATCGCAATTCTCGCTATAAAACTGCCCTCTCAATTAAGTTTGTTTTAACCTTAATTATTGTGCCCCTGCTGGCCCATCAATTGACTAAAACATTTTTTCTTTTGCCTTCGGTGGAATCATTTTTTGAGCGTAATAGTGAGGTTGTTTTTATTAACCAGAGTATGGAGACAGAAGCCTATGAGGAATTGAGTCATTTTGAAGAATCTCTGCGTTTTCGAGAATTGTTAGGTTTTGGCGAAAAACTTTCCCCCGAAGCTAAGGAAGAAAAACTGGCGGAGAAAGCCAAAGAAATTTCCGAAAGTTACCGTCGGGTTAGCACCAATGCGATCGCCAATATTTTTGCTGATATTTTTTCCCTGGTGGCCTTTTCACTTGTTTTGGTCAATAGTCAACGGGAAATTGAAGTTTTAAAAGAATTTATTGACGAAATTGTCTATGGCTTGAGTGACTCGGCTAAGGCATTCTTGATTATTCTCTTTACCGATATGTTTGTTGGTTTTCACTCTCCCCACGGTTGGGAAGTAATTTTGGCTAGTATCGCCCGTCATTTTGGTTTGCCGGAAAATCAAGATTTTAACTTTCTTTTTATCGCAACTTTCCCGGTAATTTTAGATACGGTCTTTAAATATTGGATCTTCCGTTATCTGAATAGTATTTCTCCCTCTGCCGTGGCTACCTACCGCAATATGAATGAGTAA

Protein

MDLTNWWQGATQWFGRSSQKSLEQAFRSALKIKEIEDQYFQGKKIGPENCDYSADTVTYFANQIQRHLRKIEQEIYHLNSDQEFVKILSLDPAVKQDPQTEYVLNQLQFIDDILQRYDGELPQVSPPKQIANGGVLDLPAITANKQRQINKKRRDGFQYIRREDTQQKVDTATQKSGVLPRSFLRTIDRLKREMDPQSSDTEQKVLKQYRNSRYKTALSIKFVLTLIIVPLLAHQLTKTFFLLPSVESFFERNSEVVFINQSMETEAYEELSHFEESLRFRELLGFGEKLSPEAKEEKLAEKAKEISESYRRVSTNAIANIFADIFSLVAFSLVLVNSQREIEVLKEFIDEIVYGLSDSAKAFLIILFTDMFVGFHSPHGWEVILASIARHFGLPENQDFNFLFIATFPVILDTVFKYWIFRYLNSISPSAVATYRNMNE