Your browser is old and dusty. Try Google Chrome!

Details for slr1593

ORF slr1593
Accession NP_440309.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -21 -28 7.51227 0.24
NP_442151.1_6 Reverse -357 -371 5.30946 0.284
NP_441818.1_9 Reverse -20 -39 -5.01543 0.248
NP_442623.1_3 Reverse -21 -40 -11.1119 0.224
NP_440931.1_7 Reverse -225 -243 10.5398 0.287
NP_441098.1_3 Reverse -195 -214 -2.00377 0.279
NP_441098.1_3 Forward -216 -197 -7.36319 0.288
NP_440996.1_3 Reverse -131 -149 11.9172 0.221
NP_443027.1_4 Reverse -18 -28 8.92815 0.181
NP_442975.1_10 Reverse -336 -350 5.40719 0.224
NP_440784.1_7 Forward -159 -152 7.51227 0.138
NP_440061.1_9 Forward -144 -130 8.84875 0.161
NP_440061.1_9 Reverse -18 -32 5.70218 0.275
NP_442062.1_3 Reverse -91 -110 6.39097 0.182
NP_442062.1_3 Forward -63 -44 0.196116 0.239
NP_442062.1_8 Forward -366 -356 3.12662 0.285
NP_440304.1_4 Reverse -355 -365 4.69992 0.252
NP_440304.1_4 Reverse -131 -141 4.3066 0.271
NP_441208.1_1 Reverse -125 -144 -3.24547 0.258
NP_441594.1_6 Reverse -354 -373 5.30933 0.209
NP_440769.1_8 Forward -79 -60 11.7008 0.17
NP_442136.1_1 Forward -119 -100 16.6174 0.0862
NP_441025.1_6 Reverse -102 -121 17.6155 0.0963
NP_440438.2_8 Forward -118 -99 8.75091 0.115
NP_442634.1_4 Reverse -375 -389 -6.09693 0.299
NP_440470.1_5 Forward -70 -51 8.54611 0.253
NP_440376.1_1 Forward -366 -357 3.93297 0.188
NP_441077.1_2 Forward -64 -45 13.9891 0.106
NP_441077.1_6 Forward -59 -43 10.418 0.163
NP_441077.1_6 Forward -256 -240 6.94736 0.234
NP_441077.1_6 Reverse -40 -56 4.6336 0.255
NP_441846.1_10 Reverse -22 -41 -22.6167 0.264
NP_442658.1_1 Reverse -355 -365 5.97777 0.242
NP_442658.1_1 Reverse -131 -141 5.48612 0.265
NP_442205.1_9 Reverse -32 -48 -0.138127 0.264
NP_440184.1_1 Reverse -101 -120 3.25897 0.243
NP_442321.1_4 Forward -375 -356 -9.047 0.293
NP_440203.1_5 Forward -139 -129 10.0093 0.242
NP_439990.1_5 Forward -371 -358 6.21414 0.249
NP_442690.1_1 Reverse -102 -121 -3.73712 0.142
NP_443055.1_3 Reverse -348 -367 12.0775 0.231
NP_441424.1_2 Reverse -101 -120 15.9945 0.104
NP_442431.1_10 Reverse -17 -35 -0.177514 0.286
NP_440147.1_4 Forward -368 -355 -0.570702 0.291
NP_441041.1_4 Reverse -357 -376 0.982764 0.0818
NP_441041.1_4 Reverse -126 -145 -12.3902 0.265
NP_441041.1_7 Reverse -354 -366 6.44582 0.21
NP_442996.1_1 Forward -68 -49 10.3605 0.21
NP_442004.1_4 Reverse -340 -359 6.98015 0.299
NP_441725.1_5 Forward -365 -355 5.09324 0.115
NP_441725.1_5 Forward -141 -131 4.79825 0.115
NP_439966.1_7 Forward -135 -125 7.74772 0.15
NP_441334.1_7 Forward -144 -125 -17.7985 0.275
NP_441079.1_7 Reverse -64 -83 -4.81951 0.254
NP_442012.1_1 Reverse -156 -175 -1.08219 0.274
NP_441644.1_6 Reverse -357 -367 3.71617 0.267
NP_442215.1_2 Forward -368 -352 -3.8747 0.223
NP_442215.1_2 Forward -137 -121 -4.66135 0.237
NP_442215.1_2 Reverse -361 -377 -5.448 0.25
NP_441751.2_8 Forward -141 -127 -5.70361 0.231
NP_442142.1_4 Forward -163 -150 7.59019 0.135
NP_442292.1_2 Forward -113 -99 15.8402 0.269
NP_440045.1_3 Forward -147 -130 7.80625 0.254
NP_440464.1_10 Forward -224 -214 15.3955 0.169
NP_440464.1_10 Reverse -310 -320 14.345 0.169
NP_441673.1_1 Reverse -357 -366 -8.06341 0.254
NP_441764.1_1 Reverse -101 -120 10.7175 0.186
NP_441764.1_8 Reverse -38 -48 11.0236 0.287
NP_441056.1_1 Reverse -14 -33 -8.45701 0.282
NP_441612.1_2 Reverse -275 -285 8.45247 0.214
NP_441612.1_2 Reverse -38 -48 7.19391 0.26
NP_442559.1_3 Reverse -347 -366 7.37428 0.291
NP_440789.1_1 Forward -118 -99 19.2715 0.0581
NP_442542.1_2 Reverse -355 -368 10.2457 0.127
NP_442739.1_2 Reverse -196 -215 13.2486 0.246
NP_441114.1_3 Forward -140 -131 7.57121 0.231
NP_440923.1_1 Forward -119 -101 23.4211 0.00313
NP_441878.1_6 Reverse -356 -366 3.22496 0.0296
NP_441878.1_6 Reverse -125 -135 1.35667 0.101
NP_441878.1_6 Reverse -132 -142 -7.49312 0.231
NP_442066.2_4 Forward -366 -347 -7.08038 0.264
NP_442350.1_1 Reverse -7 -26 14.9458 0.278
NP_440084.1_8 Forward -56 -42 10.8022 0.26
NP_441819.1_5 Reverse -48 -67 11.9838 0.247
NP_441819.1_5 Reverse -103 -122 8.6416 0.295
NP_441037.1_4 Forward -318 -308 6.73295 0.245
NP_441633.1_3 Reverse -142 -155 -6.56889 0.259
NP_441728.2_2 Reverse -356 -375 15.9291 0.218
NP_440709.1_1 Forward -120 -101 2.45694 0.22
NP_441395.1_6 Reverse -197 -216 14.5621 0.299
NP_441464.1_8 Forward -366 -352 7.86607 0.205
NP_441199.1_6 Forward -36 -17 2.65439 0.197
NP_441340.1_9 Forward -60 -50 7.29115 0.289
NP_440027.1_4 Reverse -234 -253 5.8596 0.186
NP_439984.1_10 Forward -40 -26 10.0287 0.296
NP_441167.1_1 Forward -253 -234 10.4225 0.17
NP_440408.1_7 Forward -316 -297 8.75091 0.269
NP_440770.1_5 Forward -95 -76 13.7982 0.292
NP_440316.1_10 Reverse -356 -366 6.17489 0.265
NP_441877.1_9 Forward -119 -102 6.33202 0.284
NP_442917.1_1 Forward -66 -47 19.1731 0.03
NP_442917.1_1 Reverse -44 -63 18.5831 0.03
NP_442917.1_1 Reverse -77 -96 14.9449 0.101
NP_441640.1_8 Reverse -358 -377 -3.44213 0.257
NP_440888.1_2 Forward -29 -15 7.96378 0.175
NP_441268.1_1 Reverse -171 -190 16.1855 0.194
NP_442277.1_7 Forward -313 -297 -0.757133 0.228
NP_442033.1_5 Forward -365 -346 14.4541 0.273
NP_442845.1_2 Reverse -14 -28 3.93283 0.272
NP_442710.1_6 Reverse -211 -230 12.9791 0.204
NP_442710.1_7 Forward -59 -40 -7.89551 0.299
NP_441469.1_8 Reverse -356 -365 7.86621 0.227
NP_440148.1_3 Reverse -353 -367 17.8958 0.208
NP_441462.1_2 Forward -366 -356 -1.00328 0.274
NP_443062.1_6 Forward -374 -355 1.27776 0.276
NP_440519.1_8 Reverse -20 -36 21.003 0.0394
NP_440544.1_5 Forward -45 -38 14.5681 0.264
NP_442780.1_1 Reverse -103 -122 17.7974 0.0721
NP_442780.1_3 Reverse -47 -66 7.87766 0.269
NP_442428.1_4 Reverse -125 -144 2.75272 0.248
NP_441267.1_1 Forward -372 -353 0.392778 0.281
NP_440673.1_3 Forward -140 -133 8.98723 0.203
NP_440673.1_3 Reverse -171 -178 7.41394 0.263
NP_441052.1_2 Reverse -309 -319 3.61828 0.177
NP_442219.1_9 Forward -28 -19 2.458 0.27
NP_442864.1_2 Reverse -142 -161 12.4875 0.246
NP_441004.1_1 Reverse -17 -36 -18.1918 0.298
NP_441004.1_4 Reverse -130 -140 10.2065 0.254
NP_441004.1_4 Forward -268 -258 9.22315 0.259
NP_441004.1_5 Forward -269 -255 8.06273 0.278
NP_443054.1_2 Reverse -355 -369 2.45787 0.245
NP_442515.1_1 Forward -367 -353 -3.93365 0.298
NP_440338.1_4 Reverse -43 -62 21.1397 0.0192
NP_442689.1_8 Reverse -106 -123 -7.23765 0.292
NP_441124.1_5 Forward -61 -51 10.8118 0.283
NP_442168.1_5 Forward -170 -151 -1.67217 0.264
NP_441031.1_1 Forward -122 -103 10.679 0.193
NP_442006.1_2 Reverse -26 -43 -16.3824 0.25
NP_442006.1_2 Reverse -124 -141 -17.2674 0.271
NP_442006.1_2 Reverse -355 -372 -18.2507 0.289
NP_442006.1_2 Reverse -153 -170 -18.7424 0.295
NP_441078.1_4 Reverse -357 -366 -1.27858 0.246
NP_440526.1_3 Forward -365 -354 1.3365 0.267
NP_440629.1_1 Reverse -92 -110 5.82068 0.158
NP_440461.1_3 Reverse -356 -375 15.6341 0.212
NP_439935.1_6 Reverse -326 -345 22.6156 0.0414
NP_442400.1_10 Forward -324 -311 10.3749 0.261
NP_442489.1_7 Reverse -357 -366 -1.27858 0.185
NP_442489.1_7 Forward -366 -357 -1.77023 0.247
NP_441659.2_8 Forward -366 -356 4.50326 0.132
NP_439912.1_2 Reverse -377 -396 20.1573 0.0576
NP_442346.1_5 Reverse -356 -366 4.99491 0.267
NP_442346.1_5 Reverse -132 -142 4.79825 0.272
NP_440459.1_2 Forward -144 -127 12.3302 0.151
NP_442603.1_7 Forward -29 -15 8.45543 0.174
NP_441502.1_2 Forward -60 -41 20.1508 0.204
NP_441502.1_2 Reverse -39 -58 17.339 0.244
NP_441329.1_1 Reverse -189 -208 5.77684 0.265
NP_442943.1_1 Forward -121 -106 3.29703 0.278
NP_441239.1_9 Reverse -355 -367 3.18557 0.292
NP_440624.1_5 Forward -90 -72 6.60692 0.298
NP_442270.1_9 Forward -161 -142 -0.000545616 0.142
NP_441508.1_1 Reverse -102 -121 15.9397 0.101
NP_442772.1_1 Reverse -98 -117 23.3092 0.0197
NP_441541.1_1 Reverse -100 -118 -1.71687 0.242
NP_440212.1_3 Reverse -328 -347 8.35759 0.297
NP_441497.1_2 Reverse -293 -312 7.27595 0.233
NP_441848.1_4 Reverse -107 -123 7.45517 0.288
NP_441084.1_6 Reverse -124 -138 9.73195 0.269
NP_442786.1_2 Forward -66 -47 11.1244 0.27
NP_441959.1_8 Forward -209 -196 11.8907 0.286
NP_441959.1_10 Forward -20 -2 10.0785 0.299
NP_442931.1_10 Reverse -77 -96 15.2399 0.0543
NP_442931.1_10 Forward -66 -47 13.9616 0.0578
NP_442931.1_10 Reverse -44 -63 7.66846 0.212
NP_442533.1_1 Reverse -17 -36 -9.34199 0.223
NP_442533.1_6 Reverse -357 -366 5.01461 0.16
NP_442533.1_6 Forward -135 -126 2.55633 0.25
NP_440854.1_1 Forward -67 -48 9.88299 0.152
NP_441697.1_5 Reverse -41 -60 -7.68752 0.248
NP_441028.1_6 Forward -168 -158 3.51951 0.292
NP_440115.1_6 Reverse -130 -140 7.45319 0.147
NP_440608.1_1 Reverse -77 -96 13.0151 0.182
NP_440608.1_1 Forward -66 -47 10.0972 0.213
NP_441972.1_5 Reverse -21 -40 -5.60541 0.224
NP_441106.1_3 Forward -120 -101 25.4672 0.000189
NP_441286.1_1 Forward -367 -355 -4.9759 0.183
NP_441930.1_2 Reverse -356 -366 13.5497 0.24
NP_442072.1_9 Reverse -125 -143 -21.8103 0.212
NP_442401.1_6 Forward -186 -169 17.7384 0.178
NP_440907.2_8 Forward -22 -12 9.02601 0.116
NP_440907.2_9 Reverse -243 -262 9.24175 0.115
NP_441463.1_6 Forward -144 -130 6.3193 0.274
NP_441962.1_4 Reverse -358 -377 -12.3902 0.256
NP_441993.1_1 Forward -372 -353 5.74752 0.195
NP_440935.1_6 Reverse -45 -62 16.3813 0.064
NP_441425.1_2 Reverse -287 -306 11.0271 0.298
NP_442698.1_10 Reverse -31 -50 -0.000545616 0.297
NP_441237.1_9 Forward -141 -131 11.3864 0.184
NP_440457.1_1 Reverse -129 -141 6.43049 0.121
NP_440213.1_5 Reverse -290 -309 6.78429 0.297
NP_440798.1_6 Forward -22 -9 7.00078 0.14
NP_442582.1_3 Forward -67 -53 17.7731 0.127
NP_441275.1_1 Forward -119 -101 21.4553 0.00273
NP_441173.1_9 Forward -395 -387 11.7204 0.226
NP_440750.1_5 Forward -69 -55 5.21113 0.294
NP_440552.1_8 Forward -207 -190 16.5722 0.098
NP_441105.1_3 Forward -377 -358 -0.0988766 0.132
NP_440172.1_1 Reverse -133 -143 4.10993 0.205
NP_442371.1_1 Forward -351 -341 12.4676 0.249
NP_442116.1_6 Forward -90 -73 8.45543 0.25
NP_442154.1_1 Reverse -21 -39 -17.0904 0.249
NP_440261.1_5 Forward -141 -128 -11.0921 0.237
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTATTTCAACCAATGAAACCGACTCATTTCATTGGCCACTGCCCCTTACTGGAGATATTGTCCGTAGTTCAATACAGAATTGCGGATAACGCAAACACAAAAACGATTTGTGCATGTATATCTCCAAATTGTGGACCAATGGTGTCAAATGTTACGGATAGTTAAGGGTTAGTTAGTTAGCCTCAACTTAAGTTAATCAAAATTGACAAACGAGTATAAGTCGCAATGATGTATCTCCCCGTCAGCGCTGATTATCAATCCATTGCCCCGCGCCCTTGAATTTGTTACAATTCTTAACAGTGACTTAATAATCTCTTAAGAATCTTGGTGTAAAGTCTTAAGAAAATCTTAAGGTTTTCTCCTCCCCCGGAGTCATCCCTATCGAATCCTGGAAGATCT

CDS

ATGTTTATATTTCCACGCTTTCCCCGGTCCCTATCTGAGAATGGTTTTTCTCAGCATGGGACTGCCCCTCCCGTCGTCCCAGAGGAGAGCAATAGTTCTTCGGATCGTAAGCAATATATTAAGTGGGCCCTAACTAAAGCGGTTACTGAGGGTGGATTCAGGCTTGATTTTCAACCCCAATGGGATGGGCAGGGAATTAATTTGGTGGGGGTAGAGGCCCTAGTCCGTTGGCAAGATCCCAAGTTGGGCAATGTGCCTCCCGCAGAATTCATTCCCATAGCTGAGGAAACGGGACTGGTGACAGCCATTGGGGAGTGGGTGTTGGACACGGCTTGTCGTCAATATAAAATTTGGCAAGCCCAGGGGGTACCGGCCTTTTTGTTGGGCGTGAATTTGTCCTTGCAACAGTTGCAAAAAGCTGACTTTGCCGAGACAGTCCGGTGCATTCTGGAGGAAACGAACATGCCCGCAGCCCAACTGCAGTTGGAGATGACCGAAGGATTAATTTTTCGAGATTTGCAGCACACTATTGGGGTGCTCCGGGATCTCCAACGACTGGGAGTGCATTTGGCGATCGACGATTTTGGCACTGGTTACTCTTCCCTGTCCGTGCTGAAGGAACTTCCTGTCCACACGCTAAAAATTGACAAATCTTTTTTAGAGGATCTGGAGACGCACCAAAAGGCGGAAGTTATTATCGAAAGCATTATCAACCTCGGTCAGCGTTTACAGTTGGTGGTGGTGGCGGAGGGCGTAGAAACGGAAGGCCAACTCCATTTACTGCAATCTTTACGGTGTGATGTACTCCAGGGTTTTTTCTTCAGTTGTCCCTTAAGTGAAGACAAGATGACCCACTATCTCCACCATTGTTGTTCTGCTAAAACTTTGAGCCGGGCGATCGCCTCCTATTAG

Protein

MFIFPRFPRSLSENGFSQHGTAPPVVPEESNSSSDRKQYIKWALTKAVTEGGFRLDFQPQWDGQGINLVGVEALVRWQDPKLGNVPPAEFIPIAEETGLVTAIGEWVLDTACRQYKIWQAQGVPAFLLGVNLSLQQLQKADFAETVRCILEETNMPAAQLQLEMTEGLIFRDLQHTIGVLRDLQRLGVHLAIDDFGTGYSSLSVLKELPVHTLKIDKSFLEDLETHQKAEVIIESIINLGQRLQLVVVAEGVETEGQLHLLQSLRCDVLQGFFFSCPLSEDKMTHYLHHCCSAKTLSRAIASY