Your browser is old and dusty. Try Google Chrome!

Details for slr1583

ORF slr1583
Accession NP_442917.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -300 -286 2.75286 0.172
NP_440795.1_7 Reverse -293 -300 11.3472 0.0978
NP_442100.1_4 Forward -202 -183 11.11 0.278
NP_440815.1_5 Reverse -190 -209 16.4207 0.0952
NP_441453.1_4 Forward -301 -293 13.5891 0.0246
NP_441453.1_4 Reverse -292 -300 7.19758 0.0757
NP_441453.1_7 Forward -209 -202 11.9372 0.298
NP_442151.1_6 Forward -301 -287 5.01447 0.298
NP_441818.1_1 Forward -300 -289 16.4794 0.0156
NP_441818.1_9 Reverse -351 -370 -10.6203 0.296
NP_440996.1_5 Forward -44 -35 15.1735 0.245
NP_442173.1_1 Reverse -112 -120 7.29591 0.176
NP_442173.1_1 Reverse -293 -301 6.01761 0.2
NP_442173.1_1 Forward -300 -292 5.62429 0.206
NP_442752.1_4 Reverse -292 -299 10.8555 0.0846
NP_443027.1_4 Forward -303 -293 12.4681 0.0755
NP_443027.1_4 Reverse -290 -300 10.3048 0.134
NP_441812.1_3 Reverse -291 -305 17.1092 0.0639
NP_442975.1_10 Forward -305 -291 3.93223 0.249
NP_442975.1_10 Reverse -288 -302 3.44058 0.259
NP_440784.1_7 Forward -300 -293 12.4288 0.0475
NP_440784.1_7 Reverse -293 -300 6.23397 0.241
NP_441250.1_2 Reverse -374 -393 13.5691 0.236
NP_442062.1_3 Forward -49 -30 1.96607 0.223
NP_442062.1_3 Reverse -33 -52 -1.37718 0.259
NP_442062.1_8 Forward -301 -291 14.0414 0.0168
NP_440304.1_4 Forward -303 -293 10.4031 0.051
NP_440304.1_4 Reverse -290 -300 9.22315 0.06
NP_440044.1_8 Forward -300 -281 5.50599 0.102
NP_440044.1_8 Reverse -293 -312 -3.93378 0.295
NP_442097.1_9 Reverse -241 -259 13.0972 0.271
NP_442602.1_3 Forward -266 -247 -2.45882 0.258
NP_441935.1_1 Forward -79 -60 7.7676 0.24
NP_441208.1_9 Forward -22 -8 8.06273 0.219
NP_441208.1_9 Reverse -289 -303 5.50613 0.267
NP_441594.1_6 Reverse -188 -207 3.44104 0.23
NP_441365.1_5 Forward -100 -81 -6.68705 0.255
NP_441082.1_2 Forward -95 -77 9.75391 0.298
NP_441925.1_4 Forward -375 -356 -5.31116 0.177
NP_440330.1_2 Reverse -136 -155 17.994 0.129
NP_440769.1_8 Reverse -36 -55 9.3409 0.214
NP_441083.1_5 Forward -301 -291 10.5014 0.0197
NP_441083.1_5 Reverse -292 -302 1.55333 0.204
NP_442827.1_4 Forward -226 -207 24.2863 0.0105
NP_442827.1_8 Forward -214 -195 -0.787962 0.235
NP_441434.1_1 Forward -26 -12 8.31942 0.259
NP_441942.1_7 Reverse -139 -158 11.5042 0.277
NP_440209.1_1 Reverse -292 -300 8.37755 0.0576
NP_440209.1_1 Forward -301 -293 8.27922 0.0687
NP_442889.1_8 Forward -304 -290 17.4035 0.0176
NP_442570.1_3 Forward -208 -189 0.392778 0.207
NP_442570.1_3 Forward -202 -183 -1.27885 0.212
NP_442570.1_3 Forward -386 -367 -1.96717 0.212
NP_442461.1_4 Forward -305 -286 9.83255 0.214
NP_441716.1_1 Forward -301 -287 7.9644 0.153
NP_441716.1_1 Forward -151 -137 3.63784 0.259
NP_442111.1_3 Forward -142 -129 13.2397 0.262
NP_442111.1_4 Forward -125 -111 9.2427 0.0619
NP_440343.1_3 Forward -375 -357 6.80322 0.225
NP_440906.1_5 Reverse -293 -300 6.23397 0.234
NP_440906.1_5 Forward -300 -293 6.0373 0.262
NP_440747.1_10 Reverse -289 -301 -2.22263 0.026
NP_440747.1_10 Forward -304 -292 -11.7607 0.142
NP_441486.1_1 Forward -304 -290 9.43936 0.026
NP_441486.1_1 Reverse -289 -303 2.85119 0.074
NP_441194.1_1 Forward -52 -33 15.2305 0.213
NP_442634.1_4 Reverse -290 -304 -3.54032 0.161
NP_440470.1_5 Forward -55 -36 8.16414 0.26
NP_441014.1_8 Forward -131 -112 -9.34199 0.295
NP_442848.1_1 Reverse -286 -300 -3.147 0.263
NP_442848.1_4 Reverse -360 -374 11.6026 0.267
NP_442848.1_9 Forward -131 -112 7.37428 0.182
NP_443018.1_3 Reverse -293 -300 13.8055 0.024
NP_443018.1_3 Forward -300 -293 13.6088 0.0352
NP_443018.1_3 Forward -144 -137 8.39725 0.147
NP_441634.1_8 Reverse -290 -304 2.45787 0.167
NP_440376.1_1 Reverse -292 -301 16.2243 0.00412
NP_440376.1_1 Forward -301 -292 9.63616 0.0385
NP_440376.1_1 Reverse -184 -193 2.06468 0.236
NP_440376.1_1 Forward -265 -256 -0.000272808 0.285
NP_441588.1_4 Forward -143 -133 8.1415 0.154
NP_441588.1_4 Reverse -294 -304 5.68323 0.245
NP_442687.1_7 Forward -302 -292 7.45319 0.132
NP_441077.1_6 Forward -45 -29 10.1288 0.164
NP_442485.1_3 Reverse -112 -131 -3.44213 0.274
NP_440642.1_10 Forward -196 -182 13.372 0.133
NP_440642.1_10 Forward -380 -366 3.53891 0.271
NP_440360.1_10 Forward -130 -116 1.76955 0.289
NP_442658.1_1 Reverse -290 -300 5.87944 0.246
NP_442496.1_5 Forward -264 -246 4.83737 0.288
NP_440656.1_8 Forward -312 -293 -3.04881 0.193
NP_442544.1_6 Forward -308 -289 -6.68705 0.298
NP_441958.1_5 Forward -302 -292 11.3864 0.0074
NP_441958.1_5 Reverse -291 -301 2.53664 0.0409
NP_439905.1_2 Reverse -137 -151 7.9644 0.289
NP_442876.1_6 Forward -56 -38 13.6573 0.23
NP_442064.1_4 Reverse -282 -301 5.50519 0.267
NP_441504.1_2 Forward -196 -179 11.8386 0.234
NP_441646.1_1 Forward -200 -181 4.62101 0.191
NP_441646.1_1 Reverse -116 -135 -0.4922 0.266
NP_442438.1_5 Forward -376 -357 19.6648 0.0401
NP_440147.1_4 Reverse -134 -147 3.36254 0.188
NP_440147.1_4 Forward -303 -290 1.39592 0.23
NP_441550.1_8 Forward -303 -293 9.91099 0.0807
NP_441916.1_7 Reverse -292 -302 16.2046 0.00566
NP_442996.1_1 Forward -46 -27 9.02356 0.21
NP_442004.1_6 Forward -384 -370 2.16287 0.273
NP_441725.1_5 Forward -300 -290 8.73149 0.0585
NP_441725.1_5 Reverse -293 -303 1.94665 0.115
NP_439966.1_7 Forward -303 -293 11.1893 0.0709
NP_439966.1_7 Reverse -290 -300 6.0761 0.195
NP_442941.1_3 Reverse -293 -303 10.2065 0.0213
NP_442941.1_3 Forward -300 -290 10.1081 0.024
NP_440289.1_2 Forward -304 -291 3.5592 0.0767
NP_440289.1_2 Reverse -289 -302 -3.02898 0.263
NP_440983.1_5 Reverse -219 -238 0.294447 0.214
NP_440260.1_8 Forward -203 -185 -0.472507 0.214
NP_442281.1_1 Reverse -287 -301 15.0436 0.0144
NP_442281.1_1 Forward -306 -292 14.2569 0.0198
NP_442281.1_1 Forward -150 -136 6.0955 0.136
NP_441079.1_7 Forward -45 -26 1.86696 0.177
NP_441079.1_7 Forward -46 -27 -3.73788 0.238
NP_442575.1_8 Reverse -112 -131 -4.52377 0.263
NP_441556.1_7 Reverse -60 -79 2.85027 0.265
NP_442982.1_5 Forward -311 -292 -3.3438 0.297
NP_440453.1_1 Reverse -189 -208 8.94757 0.271
NP_441644.1_6 Reverse -292 -302 17.3841 0.00127
NP_441644.1_6 Forward -301 -291 15.6142 0.00525
NP_441644.1_6 Reverse -123 -133 7.15773 0.133
NP_440867.1_10 Reverse -241 -260 6.19431 0.256
NP_442215.1_2 Reverse -360 -376 1.82849 0.127
NP_442029.1_6 Reverse -100 -119 11.8975 0.155
NP_440253.1_2 Forward -301 -283 13.1955 0.0239
NP_440929.1_8 Reverse -292 -301 9.53783 0.0296
NP_440929.1_8 Forward -301 -292 9.4395 0.0326
NP_442933.1_3 Reverse -29 -48 15.326 0.267
NP_442933.1_10 Reverse -292 -301 14.2577 0.0126
NP_442933.1_10 Forward -301 -292 7.76787 0.11
NP_441751.2_8 Reverse -293 -307 3.14618 0.0713
NP_441751.2_8 Forward -300 -286 -4.22864 0.166
NP_442926.1_3 Reverse -112 -131 3.73603 0.279
NP_442926.1_3 Forward -156 -137 2.75272 0.295
NP_442554.1_8 Reverse -293 -303 15.9097 0.00747
NP_442554.1_8 Forward -300 -290 14.828 0.0108
NP_442554.1_8 Forward -69 -59 4.89658 0.168
NP_442554.1_8 Forward -131 -121 3.22496 0.235
NP_442554.1_8 Reverse -137 -147 1.84832 0.292
NP_442970.1_1 Reverse -1 -15 9.36983 0.274
NP_442142.1_4 Reverse -289 -302 13.49 0.0348
NP_442142.1_4 Forward -304 -291 13.3917 0.0362
NP_442292.1_1 Forward -300 -291 15.536 0.0107
NP_442292.1_1 Reverse -293 -302 7.76787 0.0615
NP_441899.1_4 Forward -251 -232 17.2074 0.25
NP_440895.1_8 Reverse -246 -260 15.1426 0.232
NP_441711.1_2 Forward -375 -356 11.2084 0.293
NP_443009.1_5 Forward -302 -291 8.21964 0.114
NP_443009.1_5 Reverse -374 -385 5.85971 0.185
NP_443009.1_5 Reverse -291 -302 4.8764 0.226
NP_442408.2_1 Forward -193 -174 0.58944 0.202
NP_441715.1_4 Forward -300 -290 4.99491 0.24
NP_441715.1_4 Reverse -293 -303 4.79825 0.248
NP_440183.1_9 Forward -130 -111 -2.75381 0.175
NP_440183.1_9 Reverse -63 -82 -20.1584 0.282
NP_441198.1_8 Forward -303 -293 12.6854 0.12
NP_441468.1_1 Reverse -293 -300 13.8055 0.0242
NP_441468.1_1 Forward -300 -293 6.0373 0.223
NP_441015.1_10 Reverse -357 -376 -9.14533 0.28
NP_441673.1_1 Reverse -292 -301 11.1111 0.0121
NP_441673.1_1 Forward -301 -292 11.0128 0.018
NP_441339.1_4 Forward -385 -366 -6.29373 0.286
NP_441096.1_5 Forward -207 -189 16.3413 0.297
NP_441826.1_2 Forward -250 -236 -0.492064 0.213
NP_441826.1_2 Forward -120 -106 -4.22864 0.293
NP_442868.1_6 Reverse -103 -113 3.32329 0.2
NP_442868.1_6 Reverse -290 -300 0.176696 0.247
NP_442719.1_2 Forward -264 -246 -4.2098 0.208
NP_442719.1_2 Reverse -39 -57 -4.60312 0.213
NP_442719.1_2 Reverse -249 -267 -11.1913 0.29
NP_441056.1_1 Reverse -136 -155 -4.03212 0.246
NP_441612.1_2 Forward -353 -343 9.80785 0.21
NP_441612.1_2 Reverse -184 -194 6.4194 0.291
NP_442808.1_1 Forward -302 -292 6.17443 0.126
NP_442808.1_1 Forward -207 -197 5.28945 0.162
NP_441101.1_2 Forward -393 -374 18.6815 0.15
NP_441101.1_10 Forward -377 -358 -5.80207 0.285
NP_440145.1_3 Reverse -282 -301 -4.81876 0.25
NP_442050.1_5 Forward -303 -293 8.63269 0.223
NP_442050.1_5 Reverse -290 -300 6.76441 0.282
NP_440558.1_2 Reverse -139 -158 3.14605 0.161
NP_440558.1_2 Forward -203 -184 -6.1954 0.272
NP_441518.1_3 Reverse -282 -301 -14.7502 0.28
NP_442688.1_4 Forward -383 -364 16.0274 0.163
NP_441878.1_6 Reverse -291 -301 11.3864 0.0176
NP_441878.1_6 Forward -302 -292 9.51814 0.0252
NP_441878.1_6 Reverse -122 -132 0.668351 0.139
NP_441100.1_6 Reverse -339 -353 18.9521 0.243
NP_441036.1_8 Forward -302 -292 5.87989 0.253
NP_441557.1_5 Reverse -292 -301 10.2261 0.0144
NP_441557.1_5 Forward -301 -292 10.1278 0.0188
NP_440084.1_8 Reverse -40 -54 11.6616 0.241
NP_440084.1_8 Forward -42 -28 9.94278 0.271
NP_440738.1_5 Forward -356 -337 1.76941 0.289
NP_442469.1_2 Reverse -183 -201 13.3922 0.298
NP_442183.1_1 Reverse -292 -306 12.291 0.0616
NP_442183.1_1 Forward -301 -287 6.88276 0.157
NP_442397.1_9 Reverse -184 -203 13.2741 0.22
NP_442397.1_9 Forward -384 -365 6.09597 0.246
NP_442047.1_2 Forward -249 -235 14.4542 0.19
NP_440136.1_2 Reverse -293 -300 6.52896 0.116
NP_440136.1_2 Forward -300 -293 6.13563 0.193
NP_442998.1_5 Forward -58 -48 11.8781 0.176
NP_442998.1_10 Reverse -294 -301 6.23397 0.157
NP_442998.1_10 Forward -299 -292 6.13563 0.181
NP_441799.1_1 Forward -305 -291 13.6669 0.0311
NP_441007.1_10 Forward -306 -293 2.08423 0.2
NP_441007.1_10 Reverse -287 -300 -0.472371 0.285
NP_440256.1_1 Forward -304 -285 8.35759 0.0236
NP_440256.1_1 Reverse -289 -308 -5.80207 0.193
NP_441090.1_6 Reverse -362 -376 18.3875 0.111
NP_441559.1_4 Reverse -359 -378 0.786102 0.28
NP_441559.1_8 Forward -118 -104 -6.09693 0.274
NP_441559.1_8 Reverse -369 -383 -7.76856 0.299
NP_440915.1_6 Reverse -288 -302 3.34284 0.103
NP_440915.1_6 Reverse -111 -125 -0.590395 0.202
NP_440915.1_6 Reverse -358 -372 -0.787057 0.209
NP_442158.1_4 Forward -160 -150 10.5998 0.285
NP_441199.1_5 Forward -223 -204 8.94757 0.259
NP_442993.1_1 Reverse -292 -308 6.45005 0.0391
NP_442993.1_1 Forward -145 -129 -7.90627 0.148
NP_442386.1_9 Reverse -291 -300 11.799 0.0835
NP_442386.1_9 Reverse -69 -78 8.2591 0.205
NP_442386.1_9 Forward -302 -293 4.91586 0.276
NP_441340.1_5 Forward -300 -293 13.5105 0.0314
NP_441340.1_5 Reverse -293 -300 6.23397 0.132
NP_442327.1_3 Reverse -35 -54 4.72643 0.283
NP_442791.1_5 Forward -207 -188 -10.0303 0.279
NP_442326.1_3 Forward -37 -18 17.7974 0.134
NP_440586.1_8 Forward -300 -293 11.3468 0.0736
NP_440586.1_8 Reverse -293 -300 9.47853 0.146
NP_440586.1_8 Forward -144 -137 7.21693 0.27
NP_440586.1_8 Reverse -124 -131 5.8403 0.283
NP_442251.1_6 Forward -274 -267 8.20058 0.23
NP_440192.1_4 Forward -116 -97 8.71846 0.29
NP_441262.1_3 Reverse -292 -299 5.25066 0.215
NP_440027.1_8 Reverse -133 -152 10.4217 0.243
NP_443051.1_1 Forward -302 -293 9.73449 0.0265
NP_443051.1_1 Reverse -291 -300 0.688044 0.134
NP_440451.1_10 Forward -370 -351 7.07848 0.292
NP_443039.1_7 Reverse -165 -179 7.07881 0.19
NP_440372.1_2 Reverse -293 -300 6.62729 0.151
NP_440372.1_2 Forward -300 -293 6.52896 0.188
NP_441138.1_5 Forward -169 -156 8.36957 0.247
NP_439977.1_5 Forward -76 -57 2.55606 0.171
NP_440139.1_1 Reverse -117 -136 0.785326 0.281
NP_441572.1_1 Reverse -348 -367 -3.04881 0.212
NP_440267.1_2 Forward -306 -292 8.45543 0.162
NP_442384.1_10 Reverse -292 -305 5.42749 0.13
NP_442114.1_2 Forward -44 -25 0.687771 0.262
NP_440364.1_10 Reverse -351 -370 14.1591 0.299
NP_441018.1_7 Reverse -202 -221 11.5042 0.185
NP_441018.1_7 Reverse -352 -371 8.06259 0.256
NP_442262.1_10 Reverse -293 -300 13.0188 0.0314
NP_442262.1_10 Forward -300 -293 11.6422 0.092
NP_442262.1_10 Forward -144 -137 10.7572 0.124
NP_441689.1_5 Forward -303 -293 8.23937 0.142
NP_441689.1_5 Reverse -290 -300 5.58445 0.23
NP_440163.1_10 Reverse -289 -299 13.353 0.13
NP_440344.1_10 Forward -308 -291 -8.0243 0.121
NP_440344.1_10 Reverse -285 -302 -8.0243 0.121
NP_440282.1_10 Reverse -180 -199 -8.35868 0.262
NP_442917.1_1 Forward -52 -33 30.9728 0.00000451
NP_442917.1_2 Forward -211 -192 18.879 0.0214
NP_440487.1_1 Forward -278 -259 -5.31042 0.215
NP_441965.1_10 Reverse -289 -305 4.18844 0.247
NP_440297.1_9 Forward -300 -290 9.61647 0.0917
NP_440297.1_9 Reverse -293 -303 8.92815 0.0967
NP_440297.1_9 Forward -131 -121 -0.118297 0.282
NP_440297.1_9 Reverse -124 -134 -0.216628 0.282
NP_441896.1_3 Forward -79 -60 -1.27885 0.255
NP_440834.1_2 Forward -387 -368 13.8633 0.275
NP_440999.1_9 Forward -305 -291 -0.885388 0.22
NP_440888.1_2 Forward -301 -287 14.9452 0.0137
NP_440888.1_2 Forward -114 -100 8.06211 0.172
NP_440888.1_2 Forward -200 -186 7.76712 0.184
NP_440179.1_6 Forward -131 -112 4.71934 0.246
NP_442948.1_2 Forward -302 -283 5.89931 0.246
NP_441543.1_2 Forward -300 -291 14.651 0.0119
NP_441543.1_2 Reverse -293 -302 6.39124 0.153
NP_442845.1_2 Forward -307 -293 10.816 0.142
NP_442845.1_2 Reverse -286 -300 10.6193 0.145
NP_441178.1_6 Forward -381 -362 3.63691 0.269
NP_442710.1_7 Forward -46 -27 -1.36005 0.221
NP_442710.1_7 Reverse -27 -46 -5.49277 0.292
NP_441469.1_8 Forward -302 -293 5.3096 0.277
NP_441469.1_8 Reverse -291 -300 5.3096 0.277
NP_442337.1_8 Forward -211 -192 3.53937 0.216
NP_441462.1_2 Reverse -292 -302 10.5014 0.00824
NP_441462.1_2 Forward -301 -291 1.74999 0.0811
NP_443062.1_6 Reverse -284 -303 3.93269 0.225
NP_440519.1_6 Forward -205 -191 9.43936 0.29
NP_442204.1_1 Forward -149 -138 3.20526 0.266
NP_442204.1_1 Reverse -111 -122 0.157002 0.283
NP_442487.1_6 Forward -200 -181 14.0599 0.196
NP_442780.1_3 Reverse -33 -52 6.2543 0.269
NP_440454.1_2 Reverse -315 -329 12.4256 0.234
NP_440516.1_8 Reverse -292 -301 7.17789 0.0754
NP_440516.1_8 Forward -301 -292 7.07956 0.0867
NP_440516.1_8 Reverse -115 -124 -0.000272808 0.156
NP_441785.1_1 Forward -301 -287 14.3866 0.161
NP_442080.1_7 Forward -249 -230 3.24438 0.167
NP_442428.1_5 Reverse -293 -300 14.1988 0.0242
NP_442428.1_5 Forward -300 -293 6.0373 0.212
NP_440673.1_3 Forward -299 -292 11.6422 0.0724
NP_441052.1_2 Forward -301 -291 16.893 0.00732
NP_441052.1_2 Reverse -292 -302 7.25653 0.0765
NP_442219.1_9 Forward -300 -291 7.96454 0.0696
NP_440436.1_4 Forward -300 -291 14.2573 0.0147
NP_442705.1_1 Reverse -191 -210 9.73422 0.267
NP_441336.1_1 Forward -112 -93 20.2556 0.194
NP_441719.1_4 Reverse -293 -300 6.62729 0.151
NP_441719.1_4 Forward -300 -293 6.52896 0.188
NP_441004.1_2 Reverse -112 -131 -2.55715 0.264
NP_439949.1_7 Forward -169 -155 12.7826 0.259
NP_442694.1_4 Reverse -247 -256 17.4043 0.134
NP_442206.1_7 Reverse -240 -259 8.25926 0.295
NP_442206.1_10 Reverse -292 -307 4.1098 0.179
NP_443054.1_2 Reverse -373 -387 6.6861 0.185
NP_443054.1_2 Reverse -290 -304 2.94952 0.24
NP_441851.1_10 Reverse -291 -301 14.3364 0.0179
NP_441195.1_1 Reverse -380 -399 -3.3438 0.246
NP_441668.1_4 Forward -167 -148 -2.26216 0.288
NP_442515.1_1 Reverse -291 -305 -5.01529 0.298
NP_440593.1_3 Forward -383 -364 -7.57203 0.297
NP_441982.1_6 Forward -260 -251 12.6763 0.274
NP_440338.1_4 Reverse -29 -48 13.9616 0.12
NP_441349.1_10 Forward -311 -292 5.30933 0.0446
NP_441349.1_10 Reverse -282 -301 0.294447 0.089
NP_441409.1_6 Forward -307 -288 1.47442 0.0603
NP_440432.1_9 Forward -300 -285 -4.05167 0.196
NP_440474.1_8 Reverse -293 -307 10.2254 0.143
NP_441124.1_5 Forward -58 -48 14.345 0.215
NP_441124.1_5 Reverse -24 -34 10.5254 0.286
NP_442450.1_5 Forward -303 -293 6.46988 0.174
NP_440588.1_2 Forward -310 -291 4.32602 0.0835
NP_440040.1_4 Reverse -327 -346 11.1109 0.123
NP_442006.1_2 Forward -70 -53 -15.4975 0.227
NP_442243.1_1 Forward -378 -360 0.116744 0.236
NP_441570.1_1 Reverse -105 -123 -16.0088 0.237
NP_441078.1_4 Reverse -292 -301 17.4043 0.00223
NP_441078.1_4 Forward -301 -292 10.3245 0.0119
NP_442729.1_5 Reverse -122 -132 8.53483 0.248
NP_440539.1_9 Forward -267 -248 -3.44213 0.286
NP_442348.1_2 Reverse -336 -345 14.356 0.159
NP_440526.1_3 Forward -300 -289 10.1862 0.0646
NP_441432.1_8 Reverse -291 -300 14.0611 0.0258
NP_441432.1_8 Forward -302 -293 8.94785 0.0755
NP_442320.1_8 Reverse -286 -300 11.406 0.0183
NP_442320.1_8 Forward -307 -293 -5.11362 0.206
NP_441732.1_2 Forward -305 -289 -17.0511 0.231
NP_441030.1_6 Forward -373 -354 14.488 0.193
NP_440313.1_5 Reverse -328 -346 10.8348 0.294
NP_440629.1_1 Forward -48 -30 6.31233 0.152
NP_442003.1_4 Reverse -106 -125 10.5209 0.288
NP_442797.1_7 Forward -115 -97 0.707465 0.271
NP_440199.1_10 Forward -304 -294 15.8113 0.0861
NP_440199.1_10 Reverse -289 -299 14.0414 0.0895
NP_441057.1_3 Reverse -52 -71 -12.4886 0.255
NP_441057.1_3 Forward -392 -373 -12.5869 0.255
NP_442489.1_7 Reverse -292 -301 17.896 0.00138
NP_442489.1_7 Forward -301 -292 10.3245 0.0193
NP_440559.1_1 Forward -300 -291 7.76787 0.0918
NP_441659.2_8 Forward -301 -291 16.1063 0.00375
NP_441659.2_8 Reverse -292 -302 11.1898 0.0198
NP_441659.2_8 Reverse -123 -133 -0.314959 0.298
NP_442913.1_10 Forward -147 -128 0.0977854 0.156
NP_441040.1_5 Reverse -364 -383 14.8474 0.127
NP_442346.1_5 Reverse -291 -301 15.9097 0.00378
NP_442346.1_5 Forward -302 -292 15.123 0.00784
NP_442346.1_5 Reverse -122 -132 13.353 0.0261
NP_441856.1_5 Forward -261 -242 17.3048 0.214
NP_440486.1_6 Reverse -362 -381 15.7324 0.207
NP_440459.1_2 Reverse -233 -250 10.4619 0.198
NP_440459.1_2 Reverse -134 -151 7.80699 0.278
NP_441653.1_2 Forward -131 -112 9.03774 0.164
NP_442828.1_2 Forward -47 -28 16.4719 0.239
NP_441833.1_4 Reverse -293 -300 6.23397 0.163
NP_441833.1_4 Forward -300 -293 6.13563 0.198
NP_443040.1_1 Forward -48 -34 12.6964 0.276
NP_442799.1_8 Forward -265 -246 15.006 0.164
NP_442162.1_9 Reverse -293 -300 6.62729 0.142
NP_442162.1_9 Forward -300 -293 6.43063 0.208
NP_440671.1_4 Forward -250 -236 13.8643 0.0748
NP_440671.1_4 Reverse -286 -300 13.4709 0.0806
NP_440671.1_4 Reverse -105 -119 11.0127 0.142
NP_440671.1_4 Reverse -376 -390 7.47274 0.217
NP_440671.1_4 Forward -151 -137 5.30946 0.286
NP_442943.1_1 Forward -54 -39 10.1877 0.184
NP_441915.1_4 Forward -127 -108 9.7334 0.28
NP_442199.1_5 Reverse -284 -303 0.0977854 0.174
NP_442914.1_1 Reverse -173 -192 15.8307 0.0689
NP_441671.1_10 Forward -76 -57 -0.0988766 0.288
NP_440875.1_9 Reverse -294 -304 7.39866 0.267
NP_441813.1_5 Reverse -290 -300 6.17489 0.1
NP_441813.1_5 Forward -303 -293 6.07655 0.104
NP_440594.1_5 Reverse -378 -397 6.39016 0.293
NP_442472.1_10 Reverse -311 -330 15.4366 0.232
NP_442089.1_6 Reverse -236 -255 3.34271 0.275
NP_440590.1_4 Reverse -185 -198 -3.22564 0.255
NP_440590.1_4 Forward -264 -251 -4.50394 0.262
NP_440567.1_1 Reverse -293 -307 2.65453 0.167
NP_442497.1_10 Reverse -293 -302 7.86621 0.0695
NP_442497.1_10 Forward -300 -291 0.589713 0.153
NP_440821.1_4 Reverse -290 -300 8.53483 0.0468
NP_440821.1_4 Forward -303 -293 1.25834 0.139
NP_441239.1_9 Forward -303 -291 12.7237 0.0433
NP_441239.1_9 Forward -380 -368 4.75886 0.243
NP_441239.1_9 Reverse -290 -302 3.87389 0.272
NP_441727.1_3 Reverse -285 -304 2.65439 0.299
NP_440624.1_5 Reverse -28 -46 11.4272 0.192
NP_442193.1_3 Reverse -100 -119 19.5494 0.0901
NP_441508.1_1 Forward -48 -29 10.7498 0.279
NP_442216.1_4 Forward -343 -335 8.1805 0.255
NP_442138.1_9 Reverse -184 -203 12.29 0.202
NP_442052.1_7 Reverse -360 -374 11.996 0.277
NP_440546.1_4 Reverse -292 -302 12.9547 0.0572
NP_440546.1_4 Forward -301 -291 8.39772 0.192
NP_440462.1_6 Forward -303 -293 7.05986 0.0915
NP_440868.1_4 Forward -210 -198 -0.0593532 0.242
NP_442402.1_2 Forward -115 -101 11.5037 0.272
NP_442402.1_4 Forward -391 -372 -4.32786 0.224
NP_442402.1_6 Forward -60 -51 13.2744 0.289
NP_441084.1_6 Forward -253 -239 12.8346 0.152
NP_441084.1_6 Forward -303 -289 11.6711 0.194
NP_441084.1_6 Reverse -377 -391 10.7985 0.228
NP_442039.1_4 Reverse -293 -300 6.3323 0.289
NP_441926.1_3 Reverse -292 -308 5.76173 0.17
NP_442837.1_3 Reverse -293 -300 6.0373 0.25
NP_442837.1_3 Forward -300 -293 5.93897 0.265
NP_442053.1_1 Reverse -292 -301 8.65285 0.0741
NP_442053.1_1 Forward -301 -292 8.55452 0.0784
NP_440505.1_3 Reverse -290 -300 7.25653 0.16
NP_440505.1_3 Forward -303 -293 5.78156 0.211
NP_440505.1_3 Reverse -103 -113 4.3066 0.3
NP_442255.1_5 Reverse -217 -236 13.3725 0.227
NP_440914.1_1 Reverse -292 -302 15.1537 0.00654
NP_440914.1_1 Reverse -191 -201 9.49342 0.186
NP_440914.1_1 Forward -301 -291 8.12715 0.207
NP_441011.1_8 Reverse -293 -302 13.0777 0.0366
NP_442931.1_10 Forward -52 -33 23.6963 0.0105
NP_442533.1_1 Reverse -359 -378 -16.9135 0.277
NP_442533.1_1 Reverse -358 -377 -17.6018 0.291
NP_442533.1_6 Forward -301 -292 17.5026 0.00137
NP_442533.1_6 Reverse -292 -301 16.2243 0.00404
NP_442533.1_6 Forward -371 -362 9.34117 0.0634
NP_442533.1_6 Forward -145 -136 1.47469 0.298
NP_442541.1_10 Forward -132 -118 8.75042 0.218
NP_440854.1_1 Forward -53 -34 8.06865 0.171
NP_440854.1_6 Forward -52 -33 15.2305 0.252
NP_441482.1_7 Forward -151 -137 -2.75368 0.0997
NP_441482.1_7 Reverse -109 -123 -10.3252 0.209
NP_441482.1_7 Forward -126 -112 -12.2918 0.292
NP_439944.1_9 Reverse -293 -303 15.2213 0.0239
NP_439944.1_9 Forward -300 -290 9.41981 0.1
NP_442269.1_10 Reverse -357 -376 18.3873 0.113
NP_441697.1_5 Reverse -27 -46 10.4559 0.125
NP_441697.1_5 Forward -54 -35 -10.0748 0.278
NP_441697.1_5 Forward -44 -25 -10.3613 0.278
NP_441697.1_5 Forward -55 -36 -11.4117 0.295
NP_441028.1_6 Forward -192 -182 5.09279 0.267
NP_441028.1_6 Forward -381 -371 3.51951 0.292
NP_441527.1_4 Forward -54 -35 -12.1756 0.285
NP_440007.1_9 Reverse -288 -302 2.75286 0.277
NP_440007.1_9 Reverse -193 -207 1.47456 0.285
NP_440007.1_9 Forward -149 -135 1.37622 0.285
NP_441106.1_1 Forward -302 -293 8.65285 0.0522
NP_441106.1_1 Reverse -291 -300 6.48957 0.0895
NP_439903.1_6 Forward -304 -285 -0.689632 0.284
NP_441286.1_1 Reverse -291 -303 4.66053 0.031
NP_441286.1_1 Forward -302 -290 2.10393 0.0737
NP_440670.1_8 Reverse -292 -301 8.84951 0.0606
NP_440670.1_8 Forward -301 -292 8.55452 0.066
NP_440670.1_8 Forward -265 -256 3.24465 0.29
NP_441705.1_4 Reverse -130 -149 11.4058 0.218
NP_440886.1_7 Forward -302 -292 7.74772 0.0843
NP_440828.1_1 Forward -369 -350 1.08032 0.256
NP_442022.1_4 Reverse -356 -375 7.17762 0.268
NP_442264.1_2 Reverse -282 -299 7.11867 0.247
NP_441021.1_8 Reverse -287 -305 3.26407 0.23
NP_440176.1_3 Reverse -249 -263 11.7003 0.29
NP_441463.1_3 Reverse -282 -301 8.25926 0.0487
NP_441463.1_6 Forward -303 -289 7.4789 0.261
NP_442893.1_4 Reverse -26 -45 -0.39464 0.252
NP_441626.1_2 Reverse -293 -300 6.52896 0.137
NP_441626.1_2 Forward -300 -293 5.93897 0.231
NP_441460.1_2 Forward -380 -367 18.6032 0.0742
NP_442615.1_1 Reverse -283 -301 -6.07737 0.233
NP_442615.1_1 Forward -310 -292 -6.86402 0.266
NP_441962.1_4 Reverse -143 -162 -7.96535 0.195
NP_441962.1_4 Reverse -118 -137 -8.65367 0.203
NP_441962.1_4 Forward -300 -281 -15.1435 0.299
NP_440387.1_1 Reverse -292 -308 -1.90808 0.145
NP_442020.1_2 Forward -209 -190 11.2092 0.141
NP_441993.1_1 Reverse -105 -124 3.70092 0.23
NP_440358.1_8 Forward -169 -150 5.40766 0.189
NP_440467.1_3 Reverse -112 -131 11.7445 0.265
NP_440467.1_8 Reverse -111 -130 12.1925 0.223
NP_440114.1_10 Reverse -292 -306 17.3058 0.011
NP_440114.1_10 Forward -301 -287 6.6861 0.26
NP_440287.1_5 Forward -383 -364 6.58682 0.292
NP_440287.1_6 Forward -246 -227 0.58944 0.289
NP_441720.1_2 Forward -305 -286 3.04693 0.244
NP_440293.1_9 Forward -383 -369 10.8611 0.261
NP_442103.1_2 Reverse -203 -221 9.45814 0.246
NP_442930.1_1 Forward -346 -336 13.2542 0.239
NP_439910.1_2 Reverse -284 -301 -12.9408 0.113
NP_440502.1_3 Forward -191 -181 16.4197 0.1
NP_440457.1_1 Reverse -111 -123 7.61046 0.101
NP_440457.1_1 Forward -149 -137 4.75886 0.154
NP_440457.1_1 Reverse -119 -131 -0.74767 0.273
NP_442680.1_5 Forward -262 -243 1.04913 0.254
NP_440942.1_6 Forward -361 -342 4.03023 0.293
NP_442297.1_4 Reverse -370 -389 14.6695 0.186
NP_441984.1_6 Reverse -117 -129 18.1319 0.133
NP_441332.1_4 Forward -56 -37 4.32602 0.293
NP_442509.1_9 Reverse -105 -115 8.14104 0.192
NP_442514.1_5 Forward -379 -360 0.883656 0.178
NP_440554.1_4 Reverse -293 -303 6.37155 0.123
NP_440554.1_4 Forward -300 -290 4.10993 0.201
NP_441885.1_5 Forward -301 -291 11.6814 0.00668
NP_441885.1_5 Reverse -292 -302 1.65166 0.106
NP_442341.1_9 Forward -303 -289 16.2235 0.0379
NP_441173.1_9 Reverse -252 -260 13.2937 0.17
NP_442534.1_7 Reverse -234 -253 7.37428 0.269
NP_443000.1_7 Forward -303 -293 7.64985 0.0734
NP_443000.1_7 Reverse -290 -300 7.35486 0.0859
NP_443059.1_2 Reverse -205 -224 20.0581 0.271
NP_441842.1_10 Reverse -285 -299 9.43936 0.192
NP_440091.1_1 Reverse -288 -300 6.72548 0.0921
NP_443010.1_10 Forward -304 -287 2.77079 0.27
NP_441635.1_1 Forward -46 -27 11.2199 0.236
NP_441207.1_7 Forward -55 -41 13.7088 0.205
NP_440149.1_8 Reverse -105 -124 -5.01543 0.218
NP_441105.1_3 Reverse -281 -300 -6.29373 0.232
NP_441105.1_3 Reverse -287 -306 -6.78538 0.241
NP_440216.1_1 Reverse -292 -306 -11.6035 0.203
NP_440216.1_1 Forward -301 -287 -11.7018 0.212
NP_440216.1_9 Reverse -371 -380 5.99792 0.289
NP_440172.1_1 Reverse -292 -302 14.828 0.0101
NP_440172.1_1 Forward -301 -291 5.38824 0.145
NP_440172.1_1 Forward -145 -135 1.84832 0.294
NP_442015.1_10 Forward -62 -49 2.08423 0.202
NP_441045.1_2 Forward -267 -248 14.8474 0.159
NP_441226.1_7 Forward -300 -293 14.1984 0.024
NP_441226.1_7 Reverse -112 -119 7.1186 0.218
NP_440198.1_3 Forward -129 -110 14.7483 0.271
NP_441111.1_7 Reverse -293 -301 8.96754 0.0463
NP_441111.1_7 Forward -300 -292 8.86921 0.0589
NP_441766.1_2 Reverse -292 -301 7.76787 0.0714
NP_441766.1_2 Forward -301 -292 7.66954 0.0723
NP_441766.1_2 Reverse -111 -120 2.16301 0.262
NP_440416.1_9 Forward -201 -182 -9.63698 0.133
NP_443052.1_9 Reverse -138 -157 -0.0988766 0.204
NP_442116.1_6 Forward -54 -37 9.9833 0.227
NP_442226.1_8 Forward -230 -220 13.0581 0.274
NP_442046.1_9 Forward -54 -40 20.3541 0.0598
NP_440261.1_5 Reverse -293 -306 -12.1738 0.272
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAAAAATTCTTCAATCAGGGTTTCCCCTGGCCCAGCACCACTCCATAGACCAAAAACAAATTCCCCACTCGGATTGTTTTCGGTTAAGAGTTGTATAAAGGCCATCGCCATTTTAATAATCACGCTAAGATCACGGAGGATTGGCAAAAAGCCCAGGCTGATTGGTGACTTTTTTGGACAGCAACAACACTTCCCTGGATCGGCTTTGCCTTTCCCCATCTGACAGTGTAATTGGTTGATTATTTCAGTGGCCCGGCCGATGGATAATTACCATGGCCCGACCGACCGGGATTTCCAGACCAGTTTGAACAGTATTAAATTAGCCTTTCCGGACAAGGCCTCTGTGAAAATCTTAAAAAAGTATTAAGATTTTAAAAGCTAGCTTATTTTCGGAGGAAAT

CDS

GTGTTTACTCGACTTGCCCAGCAACACCGCGATTTCGTGAAGGATTTAGTCATGAGCTTGAGGGCTTTGGCCACTGTGCTCGAAAATCGGGGCTACATTGCTTCTTGCTACACCTGTGGCGACCAACTCAACAGCGCCTCCTTCATGGTGAGCTTGGGGGAAAATCATCTGATCCGCTTTTTGGTATCGGACTACGGCATCACCTGGACAGAAATGCGGGATGACCGAGAATTAATGAAATTAGAAGGAGCCGAGGCGATCGCCCAATTGGAAGAATTGGCCAATGTGGTCAAATATTGCCTAGCAGATGCCCCCAAAGGTGGCCGCAAAAAGCGCAAAACCGCCCAACTACAACTAGTCTAG

Protein

MFTRLAQQHRDFVKDLVMSLRALATVLENRGYIASCYTCGDQLNSASFMVSLGENHLIRFLVSDYGITWTEMRDDRELMKLEGAEAIAQLEELANVVKYCLADAPKGGRKKRKTAQLQLV