Your browser is old and dusty. Try Google Chrome!

Details for slr1564

ORF slr1564
Accession NP_442891.1
Symbol sigF
Category RNA synthesis, modification, and DNA transcription
Definition group 3 RNA polymerase sigma factor
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440815.1_2 Reverse -277 -291 10.3237 0.265
NP_442272.1_4 Forward -151 -133 20.4397 0.00498
NP_442877.1_3 Forward -53 -34 9.93006 0.274
NP_443043.1_3 Forward -357 -338 15.0441 0.137
NP_440561.1_1 Reverse -93 -112 10.6184 0.277
NP_442655.1_2 Reverse -135 -154 1.86774 0.281
NP_442752.1_4 Forward -113 -106 5.25066 0.256
NP_441250.1_3 Reverse -285 -304 2.0644 0.28
NP_440110.1_4 Reverse -39 -58 5.99764 0.162
NP_442062.1_3 Forward -301 -282 0.196116 0.239
NP_440893.1_3 Forward -216 -197 0.0970122 0.28
NP_441594.1_6 Forward -360 -341 3.73603 0.225
NP_441082.1_10 Reverse -168 -181 7.59077 0.297
NP_441558.1_5 Forward -202 -183 7.37428 0.182
NP_441955.1_8 Reverse -163 -180 12.9202 0.199
NP_442136.1_4 Forward -376 -357 5.30853 0.295
NP_442889.1_1 Forward -131 -112 -5.11376 0.169
NP_441713.1_1 Forward -119 -100 -13.9635 0.257
NP_441792.1_5 Reverse -104 -120 11.1699 0.197
NP_441716.1_1 Reverse -342 -356 3.73617 0.259
NP_441014.1_10 Forward -216 -197 -2.8529 0.289
NP_442848.1_5 Forward -348 -330 -3.6191 0.294
NP_442848.1_9 Reverse -44 -63 -1.67217 0.296
NP_441012.1_4 Forward -345 -332 5.82081 0.29
NP_441077.1_6 Reverse -278 -294 7.04377 0.233
NP_440781.1_6 Reverse -134 -152 7.00065 0.265
NP_440642.1_7 Reverse -196 -215 15.1424 0.287
NP_442205.1_9 Forward -357 -341 2.32015 0.218
NP_439968.1_8 Reverse -329 -345 13.4315 0.256
NP_441958.1_5 Forward -114 -104 -1.88825 0.26
NP_440450.1_7 Forward -386 -372 15.7319 0.247
NP_442836.1_5 Forward -221 -202 1.47442 0.283
NP_440203.1_5 Forward -122 -112 13.4509 0.115
NP_442816.1_7 Forward -284 -265 9.02356 0.238
NP_439990.1_8 Reverse -120 -139 -3.04881 0.283
NP_442690.1_1 Reverse -131 -150 -4.03212 0.145
NP_442690.1_1 Forward -290 -271 -6.1954 0.165
NP_442064.1_4 Reverse -99 -118 5.70185 0.267
NP_442002.1_1 Forward -175 -157 -9.22396 0.274
NP_441294.1_4 Reverse -168 -187 6.68596 0.258
NP_441000.1_1 Reverse -360 -378 12.715 0.201
NP_440147.1_4 Forward -115 -102 4.14919 0.171
NP_441041.1_4 Reverse -104 -123 0.0977854 0.0907
NP_441041.1_4 Reverse -216 -235 -10.1286 0.228
NP_442004.1_6 Reverse -104 -118 2.75286 0.257
NP_439966.1_9 Reverse -330 -339 4.0313 0.253
NP_440202.1_8 Forward -340 -321 9.51453 0.297
NP_441514.1_4 Reverse -311 -330 13.8621 0.259
NP_442288.1_3 Reverse -321 -338 7.217 0.257
NP_441644.1_6 Reverse -104 -114 5.09279 0.21
NP_440867.1_10 Forward -240 -221 8.35759 0.251
NP_442029.1_6 Forward -118 -99 6.19431 0.242
NP_442029.1_10 Reverse -161 -180 14.2574 0.145
NP_442933.1_1 Forward -94 -75 9.97848 0.253
NP_442933.1_1 Forward -93 -74 8.06865 0.253
NP_442933.1_2 Reverse -74 -92 8.59626 0.257
NP_440919.1_5 Forward -350 -331 18.3873 0.295
NP_442476.1_5 Forward -357 -338 11.2092 0.265
NP_440421.1_1 Reverse -188 -202 13.4709 0.297
NP_440405.1_3 Reverse -342 -361 10.9152 0.293
NP_440125.1_8 Forward -100 -82 14.6697 0.254
NP_440379.1_5 Reverse -100 -119 -9.34199 0.263
NP_442719.1_2 Forward -88 -70 -4.2098 0.208
NP_442719.1_2 Forward -89 -71 -7.84802 0.239
NP_442719.1_2 Reverse -145 -163 -10.9946 0.286
NP_442719.1_2 Forward -230 -212 -11.9779 0.299
NP_442227.1_2 Reverse -160 -179 -1.57384 0.264
NP_443058.1_7 Reverse -109 -128 2.26107 0.293
NP_442808.1_1 Forward -17 -7 1.25791 0.289
NP_441906.1_2 Forward -156 -137 3.14526 0.286
NP_441114.1_3 Forward -123 -114 7.27622 0.247
NP_440558.1_2 Reverse -106 -125 4.81767 0.148
NP_440558.1_2 Forward -209 -190 3.24438 0.159
NP_440558.1_2 Reverse -112 -131 -0.197208 0.198
NP_440558.1_2 Forward -128 -109 -3.44213 0.236
NP_440558.1_2 Reverse -193 -212 -5.60541 0.262
NP_442350.1_3 Reverse -292 -310 25.486 0.00592
NP_440084.1_8 Reverse -361 -375 11.1842 0.251
NP_440084.1_8 Reverse -83 -97 8.79688 0.299
NP_440101.1_5 Reverse -335 -354 1.0811 0.261
NP_442183.1_9 Forward -360 -350 14.7297 0.206
NP_442166.1_7 Forward -112 -98 10.7177 0.19
NP_441549.1_9 Reverse -338 -356 -9.42063 0.248
NP_442965.1_2 Forward -172 -153 -6.29373 0.257
NP_442594.1_8 Forward -175 -156 3.04771 0.289
NP_441633.1_3 Reverse -343 -356 -4.30728 0.191
NP_442998.1_5 Reverse -384 -394 9.7148 0.236
NP_440299.1_1 Forward -229 -216 4.83694 0.197
NP_440640.1_9 Forward -347 -328 12.4875 0.281
NP_440256.1_1 Forward -116 -97 -8.65367 0.264
NP_442007.1_8 Forward -346 -328 10.1465 0.258
NP_441559.1_8 Reverse -99 -113 -0.688726 0.179
NP_441559.1_8 Forward -210 -196 -6.58858 0.279
NP_440915.1_6 Reverse -100 -114 1.76955 0.131
NP_440717.1_3 Reverse -160 -174 13.5686 0.227
NP_440717.1_3 Reverse -154 -168 10.717 0.23
NP_441866.1_4 Forward -293 -280 17.1354 0.231
NP_441866.1_4 Forward -261 -248 11.8832 0.3
NP_442866.1_9 Reverse -191 -210 6.98095 0.278
NP_442386.1_5 Forward -348 -329 4.71854 0.263
NP_441750.1_1 Forward -67 -48 -6.88371 0.244
NP_441750.1_7 Reverse -36 -46 13.2547 0.274
NP_441340.1_9 Reverse -86 -96 7.19474 0.29
NP_440327.1_6 Forward -372 -353 2.16274 0.299
NP_441506.1_1 Reverse -73 -92 14.8825 0.187
NP_440192.1_9 Forward -348 -329 17.109 0.218
NP_442959.1_5 Forward -298 -279 8.55425 0.224
NP_440027.1_3 Forward -342 -324 2.57501 0.289
NP_440439.1_1 Forward -171 -158 0.215946 0.199
NP_440439.1_1 Forward -116 -103 -1.45568 0.269
NP_439977.1_6 Forward -181 -163 15.7521 0.271
NP_440139.1_1 Forward -48 -29 9.83173 0.095
NP_442384.1_10 Forward -160 -147 9.45906 0.0536
NP_442384.1_10 Reverse -104 -117 9.06573 0.0574
NP_441877.1_9 Forward -293 -276 2.00546 0.292
NP_440476.1_2 Forward -92 -73 14.9449 0.284
NP_441018.1_7 Reverse -319 -338 8.84924 0.239
NP_441060.1_4 Reverse -349 -367 7.29564 0.222
NP_442556.1_10 Reverse -327 -346 12.9369 0.217
NP_440350.1_5 Forward -284 -265 -3.83545 0.269
NP_442280.1_10 Reverse -160 -178 8.86344 0.246
NP_442280.1_10 Reverse -165 -183 5.55182 0.283
NP_441103.1_9 Reverse -161 -171 15.9076 0.192
NP_442454.1_2 Forward -302 -283 8.35512 0.291
NP_442807.1_10 Forward -301 -287 13.0776 0.246
NP_442845.1_2 Forward -119 -105 12.1926 0.114
NP_442315.1_2 Forward -362 -350 11.347 0.291
NP_442337.1_8 Forward -368 -349 1.47442 0.238
NP_443062.1_1 Reverse -104 -122 8.74094 0.148
NP_443062.1_1 Reverse -33 -51 6.59578 0.195
NP_442204.1_1 Reverse -112 -123 -0.334653 0.295
NP_440544.1_5 Forward -77 -70 14.5681 0.264
NP_442780.1_3 Reverse -308 -327 6.63627 0.269
NP_440818.1_6 Forward -180 -161 6.68596 0.284
NP_440673.1_2 Forward -210 -191 7.95079 0.286
NP_440673.1_3 Forward -213 -206 7.80726 0.244
NP_441052.1_2 Forward -351 -341 8.04317 0.0533
NP_441052.1_2 Forward -160 -150 2.92996 0.187
NP_442086.1_4 Reverse -339 -358 16.6147 0.24
NP_442412.1_3 Reverse -169 -188 16.6174 0.162
NP_441004.1_1 Forward -118 -99 -14.9469 0.271
NP_441004.1_2 Forward -123 -104 -2.36049 0.264
NP_441034.1_2 Reverse -358 -377 16.4667 0.219
NP_442206.1_10 Forward -118 -103 2.04485 0.208
NP_442854.1_6 Forward -194 -175 5.211 0.249
NP_442898.1_1 Forward -283 -265 19.6628 0.155
NP_442856.1_7 Reverse -333 -352 -3.14714 0.241
NP_441668.1_5 Reverse -277 -296 9.0459 0.232
NP_442515.1_1 Reverse -344 -358 -0.000409212 0.206
NP_441396.1_2 Forward -83 -66 6.92128 0.107
NP_441046.1_2 Reverse -211 -230 -0.295539 0.278
NP_440338.1_4 Forward -328 -309 6.29183 0.29
NP_441349.1_10 Forward -361 -342 -4.13045 0.161
NP_441394.1_2 Forward -180 -161 15.7324 0.265
NP_442843.1_1 Reverse -207 -226 -9.047 0.264
NP_442843.1_1 Reverse -324 -343 -11.4069 0.291
NP_440431.1_3 Reverse -347 -366 -7.37537 0.204
NP_440431.1_4 Reverse -75 -94 -7.01908 0.262
NP_442450.1_3 Forward -151 -133 13.0964 0.205
NP_442450.1_10 Reverse -33 -52 14.1583 0.0927
NP_440588.1_2 Reverse -148 -167 -0.787193 0.154
NP_441031.1_1 Reverse -280 -299 5.76226 0.282
NP_440707.1_9 Reverse -370 -389 0.884433 0.292
NP_441333.1_1 Forward -93 -83 16.6423 0.157
NP_441333.1_1 Reverse -140 -150 11.304 0.264
NP_442447.1_1 Reverse -73 -92 10.7175 0.258
NP_440760.1_7 Forward -98 -79 1.17865 0.299
NP_442353.1_4 Forward -353 -334 0.883656 0.262
NP_441452.1_1 Reverse -157 -176 15.8307 0.223
NP_441040.1_2 Reverse -95 -114 -10.6203 0.248
NP_441040.1_5 Forward -183 -164 6.68596 0.229
NP_442008.1_2 Forward -116 -97 3.83436 0.245
NP_440545.1_3 Forward -229 -212 -3.69774 0.21
NP_440831.1_3 Forward -185 -166 5.61052 0.28
NP_440459.1_2 Reverse -101 -118 8.88863 0.246
NP_440010.1_2 Reverse -105 -124 15.8299 0.298
NP_440847.1_3 Reverse -156 -170 14.0603 0.206
NP_440847.1_3 Reverse -25 -39 12.3887 0.249
NP_441888.1_7 Reverse -164 -178 3.93283 0.225
NP_441888.1_7 Forward -337 -323 3.04785 0.225
NP_442799.1_4 Reverse -379 -398 9.93088 0.201
NP_441329.1_6 Reverse -70 -89 6.63627 0.179
NP_441329.1_6 Reverse -71 -90 -1.95801 0.293
NP_440912.1_3 Forward -96 -77 8.4551 0.271
NP_441895.1_2 Reverse -354 -373 -17.3068 0.217
NP_442140.1_3 Reverse -34 -44 9.41981 0.108
NP_441813.1_7 Reverse -49 -63 12.5853 0.212
NP_442028.1_1 Forward -95 -82 11.6163 0.251
NP_440227.1_6 Forward -33 -19 14.8129 0.263
NP_442044.1_1 Forward -168 -149 0.491109 0.176
NP_442193.1_1 Forward -369 -351 7.68896 0.282
NP_442643.1_3 Forward -374 -355 -4.42544 0.261
NP_442643.1_3 Reverse -54 -73 -7.67036 0.286
NP_441541.1_1 Reverse -266 -284 1.91182 0.21
NP_440212.1_9 Reverse -81 -100 2.19508 0.252
NP_440212.1_9 Reverse -126 -145 0.849553 0.289
NP_441617.1_6 Reverse -145 -164 -2.55715 0.258
NP_442809.1_1 Reverse -289 -308 12.9783 0.277
NP_440546.1_4 Forward -113 -103 11.2095 0.0923
NP_440546.1_4 Reverse -33 -43 9.07643 0.156
NP_443033.1_7 Forward -124 -105 20.4523 0.0748
NP_442465.1_9 Forward -21 -7 8.94771 0.298
NP_442479.1_9 Reverse -321 -340 -13.8652 0.293
NP_442402.1_4 Forward -359 -340 -8.06442 0.278
NP_442402.1_4 Forward -293 -274 -9.83437 0.293
NP_440696.1_3 Reverse -328 -346 2.47742 0.216
NP_442039.1_7 Forward -106 -96 6.8632 0.292
NP_441811.1_8 Forward -166 -152 10.9143 0.219
NP_442891.1_10 Forward -232 -213 19.9606 0.0713
NP_442679.1_1 Reverse -263 -282 4.71934 0.147
NP_442679.1_1 Reverse -57 -76 1.17943 0.185
NP_442829.1_2 Reverse -73 -89 10.0738 0.287
NP_440825.1_6 Reverse -367 -386 14.8474 0.228
NP_441760.1_7 Reverse -187 -205 12.5072 0.21
NP_440805.1_9 Forward -259 -241 15.1852 0.221
NP_440160.1_2 Reverse -98 -117 -7.86702 0.286
NP_442360.1_5 Reverse -110 -120 13.5497 0.278
NP_441959.1_8 Reverse -248 -261 10.541 0.286
NP_440308.1_6 Forward -184 -165 2.16274 0.296
NP_440914.1_1 Reverse -104 -114 11.3477 0.097
NP_442931.1_10 Forward -327 -308 6.88182 0.244
NP_442533.1_6 Reverse -104 -113 2.85133 0.236
NP_443016.1_10 Reverse -160 -179 9.83255 0.267
NP_442597.1_9 Reverse -310 -329 15.8036 0.284
NP_440816.1_2 Reverse -78 -97 18.9238 0.0664
NP_441028.1_6 Forward -78 -68 4.89613 0.275
NP_441028.1_6 Forward -284 -274 4.30615 0.278
NP_441527.1_4 Reverse -74 -93 -0.143661 0.145
NP_441527.1_4 Reverse -73 -92 -1.38506 0.147
NP_441527.1_4 Reverse -268 -287 -3.48588 0.167
NP_441527.1_4 Reverse -72 -91 -11.0297 0.278
NP_441527.1_4 Reverse -75 -94 -12.9396 0.296
NP_441527.1_4 Reverse -265 -284 -13.1306 0.298
NP_439965.1_7 Forward -86 -67 10.417 0.294
NP_440903.1_2 Reverse -69 -79 16.303 0.247
NP_442614.1_2 Forward -357 -343 7.86607 0.262
NP_440460.1_9 Reverse -80 -93 16.6372 0.268
NP_442072.1_9 Reverse -151 -169 -23.2853 0.288
NP_439958.1_2 Forward -102 -88 18.2892 0.115
NP_442365.1_7 Reverse -338 -357 -3.44213 0.22
NP_441460.1_5 Forward -292 -278 14.3553 0.258
NP_441401.1_4 Reverse -270 -283 14.3756 0.226
NP_441431.1_2 Forward -335 -321 8.3571 0.218
NP_441836.1_2 Forward -48 -29 1.17943 0.197
NP_441993.1_1 Forward -119 -100 4.38312 0.221
NP_442684.1_2 Forward -182 -163 15.0441 0.288
NP_441853.1_5 Forward -167 -148 2.0644 0.279
NP_441500.1_2 Forward -363 -344 11.3075 0.293
NP_441311.1_4 Reverse -27 -44 7.80699 0.298
NP_442867.1_8 Reverse -166 -185 14.4541 0.171
NP_440142.1_7 Reverse -217 -236 6.68596 0.259
NP_442509.1_9 Reverse -226 -236 6.86274 0.248
NP_442582.1_3 Reverse -74 -88 13.7625 0.257
NP_443037.1_7 Reverse -318 -337 -11.3086 0.285
NP_443037.1_8 Reverse -137 -156 4.916 0.28
NP_442936.1_10 Forward -141 -127 8.68964 0.269
NP_442862.1_3 Forward -69 -52 11.6419 0.202
NP_441173.1_9 Reverse -96 -104 12.1137 0.21
NP_443000.1_8 Reverse -100 -119 13.6675 0.296
NP_442932.1_9 Reverse -67 -86 14.0608 0.175
NP_442932.1_9 Forward -58 -39 3.34271 0.3
NP_441635.1_1 Reverse -280 -299 5.96782 0.258
NP_441207.1_7 Reverse -80 -94 14.096 0.192
NP_442495.1_4 Forward -121 -111 14.9263 0.156
NP_442495.1_4 Reverse -108 -118 12.0747 0.25
NP_442495.1_4 Reverse -326 -336 11.5831 0.271
NP_441804.1_1 Reverse -368 -387 17.3057 0.113
NP_441105.1_3 Forward -124 -105 1.37609 0.114
NP_441730.1_2 Forward -366 -348 7.29564 0.288
NP_440216.1_9 Forward -198 -189 12.4878 0.237
NP_441226.1_7 Reverse -100 -107 6.52862 0.253
NP_439971.2_3 Forward -347 -328 16.0856 0.272
NP_440416.1_9 Reverse -162 -181 -7.37537 0.0996
NP_440416.1_9 Forward -120 -101 -10.7186 0.145
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCTCTACAATCTGTACCACATTCTCAACCACTTCAATTTGTTTGGGGGTGGTTATCAACAGCAAGCCCAGCAAATGCTTAAACAATGCTTAAGGATTTAATTGAAGAATTGTTGACTTTTTCTACATGTTATTGTTCGGATTTTAGATTAATCCTATAATTAGCGTGGGTTCCTATGCCATATCTTCCCGTTGCTGGTAATTCCAACGCAAGCTAGTTGCCCAGCCAGAGCAGGGGAGAGGATGATGCCCAAACCTAAACAAAGCTTATTTTCATTAGCATTGCCTAGGGCATCGGTTGGCAGAAAGTTTTTATTTTTTCCAATTTTCTCCATGTATTTGCTGATGTAGGCAGAGTCCAACCATCGGTAAAGTTGATTAGAGTCGCCCAAACCTAAAACC

CDS

ATGACCAATGCCACCAGCGAAAGCCTCAAACTTGAGACTCTGAGACTGTTCAAAATCTACGCAGAGTCCCACGATATTGGCGTGCGTAATCGGATTATGGAAGTCAATCTGGGTCTGGTGAGAAAGGAAGCGCACCATTGGACGGCCCAGTGCAATGAAAGTTTTGAGGATTTGTCCCAGGTGGGGTGTTTGGGTCTGATCCGAGCCATTGAACGGTTTGATGTGAGTAAGGGCAATGCCTTTAGCTCCTTTGCCATTCCCTATGTGCGGGGAGAAATCCAGCATTTTCTGCGGGATAAAAGTAACTGTGTTCGTATTCCCCGGCGTTGGTTAGATTTGGGTCGTCAGGCGATCGCCGTCCAGCAGGAATTTCGCCTCAAATATGACCGGGCGGCCACGGACGAGGAAATTGCACAAATTTTAGCAGTGCCCCTGGCGGACTGGCAGGAAACCAAACTGGCGCTGCAGAATCGTGAACTGGTGAGTTTGGACACCAAGGTAAATGGCGACGATGAAGGACAAGTTAATCTGGGGGATTGTTTAGCCCACCACGAATTCCGTAGTTTTCAACTCAGCCAGGAAGATCAAATCCGTCTGCAACAGGCCTTAGCCGGTTTGGAAGAACGTACCCGCCGCATTGTGGAATTTGTTTTTCTCCACGACTTTACCCACAAGGAAGCCGCCGAAATGATGGGGGTTAGTGTGATTACCGTTTCCCGTCGCATTAAACAGGGCATTGGGGCTCTGAAAAAAGCCTTAAATACGGAAATTTTTTAA

Protein

MTNATSESLKLETLRLFKIYAESHDIGVRNRIMEVNLGLVRKEAHHWTAQCNESFEDLSQVGCLGLIRAIERFDVSKGNAFSSFAIPYVRGEIQHFLRDKSNCVRIPRRWLDLGRQAIAVQQEFRLKYDRAATDEEIAQILAVPLADWQETKLALQNRELVSLDTKVNGDDEGQVNLGDCLAHHEFRSFQLSQEDQIRLQQALAGLEERTRRIVEFVFLHDFTHKEAAEMMGVSVITVSRRIKQGIGALKKALNTEIF