Your browser is old and dusty. Try Google Chrome!

Details for slr1563

ORF slr1563
Accession NP_442890.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -161 -175 8.35772 0.0913
NP_441061.1_2 Reverse -307 -321 0.392915 0.211
NP_441061.1_2 Reverse -109 -123 -2.06536 0.281
NP_440795.1_7 Forward -197 -190 10.8555 0.132
NP_440795.1_7 Forward -107 -100 7.31561 0.259
NP_441418.1_6 Reverse -189 -208 -23.305 0.194
NP_441418.1_6 Forward -178 -159 -28.8115 0.211
NP_441418.1_6 Forward -123 -104 -29.4998 0.228
NP_440815.1_2 Forward -302 -288 10.2254 0.265
NP_440897.1_6 Forward -170 -151 -3.24622 0.237
NP_441453.1_4 Forward -178 -170 4.24765 0.259
NP_441453.1_4 Reverse -189 -197 3.756 0.288
NP_441623.1_1 Reverse -260 -278 -3.42244 0.258
NP_441818.1_6 Forward -176 -162 14.2576 0.204
NP_440226.1_1 Reverse -189 -208 4.12936 0.202
NP_441465.1_8 Reverse -248 -266 7.78729 0.235
NP_442169.1_1 Reverse -321 -340 -2.55715 0.279
NP_441630.1_3 Forward -63 -44 -1.18052 0.293
NP_440120.1_4 Reverse -15 -29 14.4542 0.273
NP_442287.1_1 Forward -86 -76 14.4342 0.266
NP_443027.1_4 Forward -200 -190 10.1081 0.144
NP_443027.1_4 Forward -312 -302 9.61647 0.159
NP_443027.1_4 Forward -180 -170 5.78156 0.298
NP_441812.1_3 Reverse -188 -202 13.0776 0.179
NP_441225.1_4 Reverse -156 -175 -12.2919 0.284
NP_441675.1_4 Reverse -130 -149 2.3594 0.294
NP_440784.1_7 Reverse -190 -197 9.67555 0.104
NP_441250.1_3 Reverse -199 -218 1.57275 0.287
NP_440061.1_9 Forward -131 -117 9.73373 0.14
NP_440061.1_9 Reverse -74 -88 4.91554 0.3
NP_441054.1_4 Forward -379 -361 3.46073 0.168
NP_441054.1_4 Forward -208 -190 -0.865831 0.19
NP_441476.1_5 Forward -315 -296 -7.86702 0.291
NP_440878.1_9 Reverse -159 -178 -1.08219 0.224
NP_442062.1_8 Reverse -189 -199 6.37155 0.127
NP_441859.1_2 Reverse -158 -177 17.1082 0.101
NP_440044.1_8 Forward -197 -178 -0.590531 0.224
NP_440853.1_2 Forward -270 -251 30.6787 0.000486
NP_440853.1_4 Forward -141 -122 20.6481 0.0241
NP_440853.1_5 Forward -201 -182 22.6156 0.0456
NP_440853.1_7 Forward -75 -56 21.6323 0.0604
NP_440853.1_8 Forward -231 -212 18.9773 0.227
NP_441935.1_1 Forward -117 -98 10.6192 0.211
NP_441208.1_9 Reverse -186 -200 4.91614 0.282
NP_441594.1_6 Reverse -69 -88 8.75091 0.153
NP_442196.1_10 Forward -180 -161 16.1257 0.149
NP_440273.1_3 Forward -233 -214 4.81767 0.279
NP_441083.1_3 Reverse -159 -169 13.4509 0.213
NP_441083.1_5 Forward -198 -188 8.04317 0.046
NP_441558.1_5 Forward -180 -161 4.916 0.267
NP_441770.1_4 Forward -116 -97 -5.01543 0.204
NP_442570.1_3 Reverse -181 -200 -9.44032 0.299
NP_441716.1_1 Reverse -189 -203 2.75286 0.294
NP_440747.1_10 Reverse -186 -198 5.05386 0.019
NP_441130.1_10 Forward -63 -49 6.48943 0.187
NP_441130.1_10 Reverse -167 -181 6.48943 0.187
NP_441486.1_1 Forward -201 -187 2.94952 0.0718
NP_441486.1_1 Reverse -186 -200 -1.08205 0.167
NP_442634.1_4 Forward -371 -357 11.701 0.0479
NP_441014.1_10 Reverse -188 -207 4.52188 0.196
NP_441014.1_10 Reverse -119 -138 -1.37794 0.26
NP_442848.1_5 Reverse -98 -116 -2.73412 0.286
NP_442848.1_9 Forward -90 -71 -1.67217 0.296
NP_443018.1_3 Forward -177 -170 12.5271 0.0523
NP_443018.1_3 Reverse -170 -177 12.5271 0.0523
NP_443018.1_3 Forward -197 -190 4.07068 0.299
NP_441634.1_8 Forward -180 -166 5.99778 0.114
NP_441634.1_8 Reverse -70 -84 -4.03198 0.295
NP_440376.1_1 Forward -198 -189 6.48957 0.0963
NP_440376.1_1 Reverse -189 -198 -0.000272808 0.285
NP_441588.1_4 Forward -196 -186 5.48657 0.258
NP_442687.1_7 Reverse -188 -198 6.37155 0.171
NP_442485.1_2 Forward -172 -153 8.94757 0.288
NP_442485.1_3 Forward -189 -170 4.62101 0.176
NP_442485.1_3 Forward -326 -307 -1.86883 0.261
NP_442485.1_3 Reverse -158 -177 -2.85214 0.268
NP_442485.1_3 Reverse -103 -122 -4.03212 0.277
NP_442485.1_3 Reverse -316 -335 -4.13045 0.278
NP_441950.1_8 Reverse -317 -331 8.45605 0.209
NP_441950.1_8 Forward -173 -159 4.62115 0.292
NP_440360.1_5 Reverse -99 -118 0.392778 0.297
NP_442658.1_1 Forward -171 -161 6.96107 0.214
NP_442658.1_1 Reverse -167 -177 6.37109 0.231
NP_442658.1_1 Forward -200 -190 5.38779 0.269
NP_440141.1_2 Reverse -251 -270 20.7464 0.138
NP_440141.1_8 Forward -178 -159 7.47261 0.24
NP_440528.1_1 Forward -135 -122 19.3645 0.111
NP_442205.1_3 Reverse -188 -207 18.9238 0.15
NP_440656.1_8 Forward -189 -170 -0.000545616 0.142
NP_441487.1_9 Forward -82 -63 -2.36049 0.293
NP_442937.1_5 Reverse -184 -203 6.39097 0.28
NP_441127.1_1 Forward -172 -158 13.6676 0.175
NP_441127.1_1 Reverse -44 -58 11.701 0.215
NP_441127.1_1 Forward -178 -164 8.45605 0.295
NP_440203.1_5 Reverse -111 -121 14.5325 0.0886
NP_440203.1_5 Forward -127 -117 9.91099 0.245
NP_439905.1_1 Forward -177 -164 14.8673 0.106
NP_439905.1_1 Reverse -161 -174 8.86907 0.228
NP_439905.1_1 Reverse -190 -203 7.6891 0.25
NP_443001.1_7 Forward -129 -110 2.45773 0.279
NP_440984.1_7 Reverse -164 -178 8.84938 0.134
NP_440984.1_7 Reverse -156 -170 4.62115 0.296
NP_441162.1_3 Reverse -163 -182 7.66927 0.287
NP_441338.2_5 Forward -84 -65 2.65439 0.299
NP_442911.1_2 Forward -208 -189 -7.57203 0.214
NP_441580.1_6 Reverse -322 -341 -2.16383 0.216
NP_440153.1_8 Forward -81 -68 -3.12731 0.285
NP_443055.1_6 Forward -186 -168 3.55831 0.195
NP_443055.1_6 Reverse -161 -179 -1.35821 0.277
NP_440993.1_4 Reverse -306 -323 8.88863 0.216
NP_441913.1_1 Forward -399 -383 14.4007 0.246
NP_441129.1_8 Forward -337 -318 14.1591 0.195
NP_441099.1_5 Reverse -110 -129 -10.0303 0.24
NP_442002.1_1 Reverse -30 -48 -9.12563 0.272
NP_441294.1_7 Reverse -95 -109 8.67469 0.289
NP_441292.1_9 Forward -347 -328 17.5015 0.112
NP_441000.1_6 Reverse -168 -182 -4.4253 0.243
NP_441175.1_2 Reverse -72 -91 10.7175 0.175
NP_441550.1_8 Reverse -187 -197 8.92768 0.112
NP_441331.1_1 Forward -59 -40 -10.227 0.297
NP_440206.1_4 Reverse -110 -129 -0.689632 0.29
NP_441041.1_4 Forward -129 -110 -7.96535 0.194
NP_441041.1_4 Reverse -109 -128 -8.35868 0.2
NP_441041.1_4 Forward -198 -179 -11.8003 0.252
NP_441041.1_4 Reverse -318 -337 -13.7669 0.295
NP_440569.1_10 Forward -149 -130 2.91208 0.28
NP_442004.1_6 Forward -198 -184 3.34284 0.242
NP_441725.1_5 Reverse -190 -200 -1.10161 0.288
NP_439966.1_7 Reverse -167 -177 4.7978 0.258
NP_440202.1_8 Forward -186 -167 11.2653 0.282
NP_442941.1_3 Reverse -170 -180 -0.314959 0.256
NP_442941.1_3 Forward -197 -187 -1.19994 0.288
NP_440260.1_8 Reverse -180 -198 7.98396 0.154
NP_441514.1_6 Reverse -332 -339 14.2971 0.248
NP_441514.1_6 Reverse -265 -272 12.7238 0.29
NP_442281.1_1 Reverse -350 -364 2.65393 0.26
NP_441334.1_7 Reverse -304 -323 -12.1936 0.142
NP_442575.1_8 Forward -181 -162 -0.4922 0.232
NP_440479.1_9 Reverse -144 -162 12.1139 0.297
NP_441087.1_6 Forward -20 -2 8.27817 0.218
NP_441087.1_6 Forward -338 -320 -1.55487 0.269
NP_441860.1_10 Reverse -55 -74 19.8623 0.0447
NP_441644.1_6 Reverse -169 -179 12.9592 0.0265
NP_441644.1_6 Forward -198 -188 12.4676 0.0321
NP_441644.1_6 Reverse -355 -365 7.55106 0.123
NP_440867.1_10 Reverse -160 -179 7.66927 0.251
NP_442215.1_2 Forward -132 -116 10.285 0.0501
NP_442215.1_2 Forward -329 -313 0.255197 0.154
NP_442215.1_2 Reverse -187 -203 -5.74299 0.256
NP_442029.1_6 Forward -90 -71 4.71934 0.265
NP_442029.1_10 Reverse -303 -322 9.3409 0.235
NP_442933.1_10 Forward -198 -189 4.52295 0.24
NP_442933.1_10 Reverse -189 -198 4.12963 0.28
NP_441751.2_8 Reverse -170 -184 -5.80194 0.239
NP_442554.1_8 Reverse -170 -180 15.123 0.00944
NP_442554.1_8 Forward -197 -187 4.50326 0.184
NP_442554.1_8 Forward -177 -167 4.3066 0.189
NP_442554.1_8 Reverse -356 -366 3.91327 0.203
NP_442554.1_8 Reverse -361 -371 3.81494 0.209
NP_442554.1_8 Reverse -190 -200 3.22496 0.235
NP_441762.1_7 Forward -179 -167 -4.9759 0.185
NP_442142.1_4 Forward -181 -168 9.45847 0.095
NP_442142.1_4 Reverse -166 -179 7.68852 0.132
NP_442142.1_4 Reverse -186 -199 4.73861 0.212
NP_442142.1_4 Forward -126 -113 3.26365 0.262
NP_442142.1_4 Forward -201 -188 2.67367 0.281
NP_442292.1_1 Reverse -170 -179 4.81794 0.17
NP_442292.1_1 Reverse -361 -370 2.75299 0.216
NP_443009.1_5 Reverse -188 -199 12.7428 0.0435
NP_442408.2_1 Forward -54 -35 -6.1954 0.282
NP_441715.1_4 Reverse -361 -371 5.68323 0.189
NP_440357.1_3 Reverse -158 -177 -0.4922 0.296
NP_440279.1_2 Reverse -184 -203 6.19431 0.255
NP_440158.1_8 Reverse -175 -194 10.3242 0.249
NP_440183.1_9 Reverse -162 -181 -18.3884 0.276
NP_440183.1_9 Reverse -171 -190 -18.9784 0.276
NP_440183.1_9 Forward -176 -157 -20.0601 0.282
NP_440379.1_5 Reverse -72 -91 9.63589 0.133
NP_440379.1_5 Reverse -105 -124 -1.96717 0.194
NP_440379.1_5 Reverse -318 -337 -2.75381 0.202
NP_440379.1_5 Reverse -160 -179 -3.24547 0.204
NP_440379.1_5 Forward -202 -183 -9.14533 0.259
NP_440379.1_5 Forward -373 -354 -11.0136 0.288
NP_441468.1_1 Forward -197 -190 4.07068 0.263
NP_441468.1_1 Reverse -170 -177 3.97235 0.277
NP_441468.1_1 Forward -177 -170 3.97235 0.277
NP_441015.1_10 Forward -174 -155 -7.96535 0.272
NP_441015.1_10 Forward -326 -307 -10.227 0.283
NP_441673.1_1 Forward -198 -189 1.37636 0.114
NP_441673.1_1 Reverse -189 -198 1.1797 0.163
NP_441244.1_8 Forward -175 -156 4.03102 0.145
NP_441826.1_5 Reverse -35 -54 0.491109 0.3
NP_442490.1_9 Forward -117 -98 -7.96535 0.282
NP_441612.1_2 Forward -198 -188 11.4537 0.21
NP_442808.1_1 Reverse -168 -178 7.0594 0.0892
NP_442808.1_1 Reverse -107 -117 4.40448 0.199
NP_442808.1_1 Forward -88 -78 4.40448 0.199
NP_441101.1_5 Reverse -282 -300 14.2708 0.284
NP_442542.1_9 Reverse -53 -67 5.01387 0.279
NP_440342.1_2 Reverse -72 -91 12.1925 0.214
NP_441114.1_3 Reverse -110 -119 7.57121 0.231
NP_440558.1_2 Reverse -111 -130 -0.787193 0.204
NP_440558.1_2 Reverse -166 -185 -4.13045 0.243
NP_440558.1_2 Reverse -105 -124 -5.11376 0.253
NP_440558.1_2 Forward -78 -59 -5.99873 0.269
NP_440558.1_2 Reverse -180 -199 -6.09707 0.271
NP_440558.1_2 Forward -202 -183 -6.1954 0.272
NP_440111.2_3 Reverse -2 -21 26.8438 0.00277
NP_442789.1_4 Forward -107 -88 -3.14714 0.246
NP_442789.1_4 Reverse -316 -335 -6.68705 0.287
NP_441878.1_6 Forward -199 -189 1.65166 0.0795
NP_441878.1_6 Forward -179 -169 0.766681 0.134
NP_441878.1_6 Reverse -168 -178 0.57002 0.14
NP_441878.1_6 Reverse -188 -198 -0.41329 0.177
NP_441557.1_5 Forward -198 -189 0.491382 0.144
NP_441557.1_5 Reverse -189 -198 0.29472 0.174
NP_441445.1_1 Reverse -180 -199 13.5691 0.0584
NP_441445.1_1 Forward -117 -98 2.3594 0.235
NP_441445.1_1 Forward -207 -188 0.884433 0.266
NP_441445.1_1 Reverse -63 -82 0.58944 0.272
NP_441445.1_1 Forward -90 -71 -0.39387 0.291
NP_441768.1_6 Reverse -151 -170 21.9273 0.0577
NP_441739.1_2 Forward -149 -133 1.82783 0.294
NP_442192.1_8 Reverse -71 -90 9.24257 0.294
NP_442166.1_7 Reverse -319 -333 8.25939 0.245
NP_441870.1_7 Reverse -158 -177 14.0608 0.291
NP_442444.1_6 Forward -372 -354 12.1468 0.289
NP_442347.1_2 Reverse -302 -311 6.29291 0.175
NP_442347.1_2 Reverse -190 -199 3.53964 0.284
NP_442645.1_2 Reverse -181 -200 -14.3569 0.173
NP_440547.1_1 Reverse -103 -122 9.34008 0.252
NP_440547.1_5 Forward -184 -165 8.84924 0.225
NP_441633.1_3 Reverse -187 -200 -2.93064 0.177
NP_441633.1_3 Reverse -158 -171 -6.17557 0.238
NP_442764.1_8 Forward -140 -121 16.1257 0.0772
NP_442998.1_5 Forward -165 -155 7.35486 0.295
NP_440899.1_2 Forward -189 -170 9.93006 0.172
NP_440299.1_1 Reverse -185 -198 7.49186 0.112
NP_441799.1_1 Reverse -185 -199 9.93039 0.082
NP_441799.1_1 Forward -182 -168 5.01387 0.227
NP_440640.1_6 Forward -129 -110 2.65439 0.232
NP_441007.1_10 Reverse -164 -177 -0.964025 0.296
NP_442333.2_5 Forward -326 -307 -15.2418 0.29
NP_440256.1_1 Forward -121 -102 12.5858 0.0117
NP_440256.1_1 Forward -181 -162 -9.14533 0.275
NP_441559.1_8 Forward -16 -2 -6.09693 0.274
NP_441559.1_8 Forward -203 -189 -6.29359 0.276
NP_441559.1_8 Reverse -71 -85 -7.76856 0.299
NP_440915.1_6 Forward -182 -168 -3.54032 0.298
NP_442158.1_4 Reverse -389 -399 14.4347 0.182
NP_442452.1_3 Forward -326 -307 15.4374 0.0828
NP_442866.1_1 Reverse -164 -183 -5.11376 0.24
NP_442866.1_1 Forward -326 -307 -9.14533 0.29
NP_442866.1_1 Reverse -103 -122 -9.14533 0.29
NP_440748.1_5 Reverse -111 -130 -2.36049 0.273
NP_440657.1_3 Forward -46 -29 1.90713 0.269
NP_440026.1_2 Forward -99 -80 11.9958 0.297
NP_442386.1_9 Reverse -168 -177 14.1589 0.0289
NP_441750.1_1 Forward -178 -159 -4.52377 0.204
NP_441750.1_1 Forward -89 -70 -11.4069 0.3
NP_441750.1_1 Reverse -87 -106 -13.3736 0.3
NP_441340.1_5 Reverse -170 -177 4.07068 0.239
NP_441340.1_5 Forward -177 -170 4.07068 0.239
NP_442484.1_2 Reverse -307 -326 4.52268 0.186
NP_441952.1_9 Reverse -335 -354 13.2105 0.282
NP_441160.1_5 Reverse -61 -80 -3.04881 0.288
NP_441160.1_5 Forward -119 -100 -5.99873 0.288
NP_440586.1_8 Forward -177 -170 7.61025 0.227
NP_440586.1_8 Reverse -170 -177 7.61025 0.227
NP_440586.1_8 Forward -197 -190 7.41359 0.251
NP_440969.1_3 Forward -336 -318 9.26148 0.278
NP_440027.1_3 Forward -208 -190 2.28001 0.292
NP_440027.1_3 Forward -198 -180 2.08335 0.293
NP_443051.1_1 Forward -179 -170 -0.000272808 0.245
NP_440451.1_10 Forward -197 -178 9.34008 0.264
NP_439937.1_8 Forward -312 -293 2.16274 0.217
NP_439937.1_8 Forward -89 -70 -1.47551 0.249
NP_439937.1_9 Forward -152 -135 -11.4665 0.256
NP_441595.1_2 Reverse -123 -136 11.2343 0.277
NP_440439.1_1 Forward -121 -108 -2.144 0.298
NP_440316.1_10 Forward -179 -169 16.1063 0.153
NP_441803.1_2 Reverse -313 -332 1.37609 0.232
NP_441803.1_2 Forward -177 -158 0.58944 0.249
NP_439977.1_8 Forward -356 -337 16.3746 0.205
NP_441572.1_7 Forward -375 -356 1.47442 0.149
NP_440267.1_2 Reverse -355 -369 10.422 0.14
NP_442384.1_10 Forward -198 -185 12.409 0.0283
NP_442384.1_10 Reverse -189 -202 4.54251 0.153
NP_442114.1_2 Forward -231 -212 3.24438 0.262
NP_441877.1_5 Reverse -240 -259 3.53937 0.234
NP_441877.1_7 Reverse -91 -110 1.76863 0.241
NP_441018.1_7 Reverse -179 -198 12.1925 0.167
NP_442790.1_3 Reverse -161 -180 8.55425 0.217
NP_442262.1_10 Forward -177 -170 10.4622 0.145
NP_442262.1_10 Reverse -170 -177 10.4622 0.145
NP_440163.1_10 Reverse -102 -112 7.94484 0.297
NP_441060.1_3 Reverse -69 -88 10.3242 0.218
NP_442910.1_6 Reverse -161 -175 9.5377 0.207
NP_441335.1_4 Forward -119 -100 8.45592 0.287
NP_441335.1_9 Reverse -161 -179 20.5695 0.0443
NP_441965.1_10 Forward -201 -185 3.40179 0.265
NP_440297.1_9 Reverse -109 -119 3.91327 0.253
NP_440297.1_9 Reverse -190 -200 -0.216628 0.282
NP_440297.1_9 Reverse -170 -180 -0.216628 0.282
NP_440350.1_1 Reverse -243 -262 -1.86883 0.235
NP_442280.1_10 Reverse -179 -197 17.4347 0.0964
NP_442280.1_10 Reverse -174 -192 4.77262 0.294
NP_441896.1_5 Reverse -183 -190 12.2322 0.273
NP_440894.1_10 Reverse -181 -200 5.89931 0.227
NP_440894.1_10 Reverse -158 -177 5.211 0.238
NP_441778.1_8 Reverse -155 -169 16.8135 0.273
NP_441894.1_1 Reverse -249 -268 5.99764 0.0648
NP_440999.1_9 Forward -331 -317 5.50613 0.111
NP_440999.1_9 Reverse -165 -179 -2.75368 0.276
NP_440999.1_9 Forward -109 -95 -2.85201 0.279
NP_440888.1_2 Reverse -189 -203 11.4053 0.0681
NP_440491.1_1 Reverse -46 -65 8.0865 0.251
NP_441543.1_2 Reverse -190 -199 6.39124 0.153
NP_441543.1_2 Forward -197 -188 4.32629 0.26
NP_441543.1_2 Reverse -170 -179 4.12963 0.279
NP_442845.1_2 Reverse -183 -197 5.40779 0.233
NP_441469.1_8 Reverse -168 -177 12.9794 0.087
NP_441469.1_8 Forward -199 -190 11.7011 0.152
NP_443064.1_8 Forward -62 -52 16.6958 0.189
NP_442337.1_8 Reverse -27 -46 -2.0655 0.293
NP_440148.1_1 Reverse -347 -366 -7.17871 0.281
NP_441621.1_7 Forward -89 -75 2.94952 0.123
NP_441621.1_7 Reverse -319 -333 -4.52363 0.232
NP_443062.1_1 Forward -364 -346 3.37804 0.3
NP_443062.1_6 Forward -125 -106 1.86774 0.266
NP_442204.1_1 Forward -319 -308 1.63197 0.267
NP_442204.1_1 Forward -373 -362 0.550326 0.281
NP_440516.1_6 Reverse -108 -122 8.16044 0.25
NP_440516.1_8 Forward -178 -169 -0.590259 0.283
NP_442428.1_5 Forward -197 -190 4.56234 0.249
NP_442428.1_5 Forward -177 -170 4.36568 0.271
NP_442428.1_5 Reverse -170 -177 4.36568 0.271
NP_441353.1_4 Reverse -44 -63 16.5191 0.272
NP_441443.1_7 Forward -120 -101 -0.787193 0.248
NP_440673.1_2 Forward -118 -99 12.5357 0.145
NP_440673.1_2 Reverse -159 -178 10.4871 0.207
NP_440673.1_2 Forward -374 -355 9.31652 0.248
NP_440673.1_2 Forward -91 -72 8.73121 0.263
NP_440673.1_3 Reverse -191 -198 9.38056 0.192
NP_440673.1_7 Reverse -171 -190 1.47442 0.248
NP_441052.1_2 Forward -198 -188 13.7464 0.0275
NP_441052.1_2 Reverse -189 -199 5.19158 0.128
NP_441052.1_2 Reverse -169 -179 4.79825 0.145
NP_441052.1_2 Reverse -120 -130 1.65166 0.233
NP_441052.1_2 Forward -108 -98 1.06167 0.252
NP_442219.1_8 Forward -112 -93 18.99 0.0434
NP_442219.1_8 Forward -359 -340 12.6122 0.154
NP_442219.1_8 Reverse -98 -117 11.8392 0.169
NP_442219.1_8 Reverse -179 -198 9.61661 0.224
NP_442219.1_8 Reverse -42 -61 7.58731 0.267
NP_440436.1_4 Reverse -161 -170 9.34074 0.0871
NP_440436.1_4 Reverse -190 -199 5.40752 0.204
NP_441884.1_9 Forward -181 -162 -22.8133 0.284
NP_441884.1_9 Reverse -43 -62 -23.6 0.284
NP_441884.1_9 Reverse -157 -176 -24.3866 0.286
NP_441357.1_2 Forward -275 -256 13.9625 0.29
NP_441004.1_1 Reverse -60 -79 -14.2585 0.265
NP_441004.1_1 Forward -123 -104 -14.8485 0.271
NP_442813.1_10 Reverse -92 -111 19.6656 0.159
NP_442366.1_3 Reverse -320 -338 -4.40575 0.271
NP_442366.1_10 Forward -173 -161 21.0818 0.0795
NP_439949.1_7 Reverse -381 -395 10.1277 0.293
NP_440129.1_10 Forward -124 -110 6.09611 0.181
NP_440296.1_6 Reverse -271 -289 15.5672 0.283
NP_440296.1_10 Reverse -43 -62 -11.6036 0.269
NP_441115.1_4 Forward -170 -152 12.5064 0.102
NP_442206.1_10 Forward -123 -108 -0.216765 0.287
NP_441851.1_10 Forward -199 -189 5.19158 0.221
NP_441501.1_6 Forward -91 -72 12.3892 0.299
NP_442856.1_7 Reverse -72 -91 -0.885524 0.211
NP_442856.1_8 Reverse -318 -336 14.0805 0.269
NP_442515.1_1 Reverse -98 -112 0.0979218 0.203
NP_440463.1_8 Reverse -159 -178 10.8883 0.203
NP_441046.1_2 Forward -119 -100 3.6377 0.231
NP_440432.1_9 Reverse -170 -185 3.22482 0.0967
NP_439960.1_10 Reverse -159 -177 -2.53746 0.255
NP_440474.1_8 Forward -329 -315 5.21053 0.254
NP_441124.1_5 Reverse -126 -136 12.1487 0.23
NP_440588.1_2 Reverse -180 -199 1.76941 0.13
NP_440023.1_7 Reverse -361 -380 6.68596 0.269
NP_442006.1_2 Forward -178 -161 1.8088 0.111
NP_442006.1_2 Reverse -321 -338 -16.0874 0.238
NP_442006.1_2 Forward -307 -290 -18.5457 0.292
NP_442006.1_2 Forward -301 -284 -18.644 0.294
NP_441003.1_9 Reverse -289 -308 5.40766 0.264
NP_441078.1_4 Forward -198 -189 7.86621 0.0432
NP_441078.1_4 Reverse -189 -198 0.491382 0.188
NP_441078.1_4 Forward -178 -169 -1.6719 0.266
NP_441078.1_4 Reverse -169 -178 -1.77023 0.266
NP_442348.1_2 Forward -118 -109 14.356 0.159
NP_441432.1_8 Forward -179 -170 6.19458 0.118
NP_441732.1_2 Reverse -95 -111 -16.7561 0.195
NP_440199.1_10 Forward -201 -191 8.63316 0.231
NP_441945.1_10 Forward -124 -105 7.66927 0.284
NP_442353.1_4 Forward -204 -185 2.85027 0.228
NP_442353.1_4 Forward -333 -314 -0.492971 0.29
NP_442353.1_7 Reverse -102 -121 9.43923 0.216
NP_440913.1_1 Forward -180 -162 5.42735 0.241
NP_441072.1_8 Reverse -321 -340 11.7992 0.1
NP_442489.1_2 Forward -332 -313 4.71934 0.208
NP_442489.1_7 Forward -198 -189 8.1612 0.0294
NP_442489.1_7 Reverse -189 -198 0.491382 0.178
NP_442489.1_7 Forward -178 -169 -1.6719 0.235
NP_442489.1_7 Reverse -169 -178 -1.77023 0.247
NP_441659.2_8 Reverse -189 -199 0.0783647 0.277
NP_441022.1_1 Reverse -129 -138 13.7524 0.188
NP_442913.1_10 Reverse -90 -109 -5.21209 0.26
NP_442849.1_1 Reverse -50 -64 11.5043 0.203
NP_440708.1_6 Reverse -308 -327 -7.96535 0.255
NP_442776.1_1 Forward -129 -110 11.2092 0.159
NP_442776.1_1 Reverse -76 -95 4.32602 0.278
NP_442346.1_5 Reverse -188 -198 11.0914 0.0764
NP_442346.1_5 Reverse -354 -364 7.94484 0.152
NP_442346.1_5 Forward -179 -169 5.87989 0.225
NP_442346.1_5 Forward -199 -189 4.89658 0.269
NP_442346.1_10 Reverse -167 -186 7.47261 0.168
NP_442346.1_10 Reverse -158 -177 3.73603 0.194
NP_440545.1_3 Reverse -185 -202 7.02034 0.0522
NP_440545.1_3 Reverse -95 -112 -4.09106 0.218
NP_440545.1_3 Forward -314 -297 -6.94266 0.293
NP_441923.1_6 Forward -177 -163 11.7993 0.249
NP_441126.1_1 Forward -250 -231 11.807 0.27
NP_442551.1_4 Reverse -44 -59 -3.65835 0.292
NP_441585.1_5 Reverse -260 -279 -1.18128 0.298
NP_442404.1_9 Forward -307 -293 10.2254 0.263
NP_440772.1_6 Forward -125 -106 9.53756 0.273
NP_442140.1_3 Forward -177 -167 14.4347 0.0486
NP_441671.1_10 Forward -189 -170 -0.197208 0.29
NP_440875.1_9 Reverse -171 -181 11.9735 0.143
NP_440875.1_9 Reverse -111 -121 8.5667 0.233
NP_441813.1_7 Reverse -99 -113 13.5686 0.209
NP_440821.1_4 Forward -200 -190 -0.41329 0.257
NP_441239.1_9 Reverse -167 -179 15.8703 0.0178
NP_441239.1_9 Forward -180 -168 6.1355 0.2
NP_441239.1_9 Reverse -158 -170 5.44718 0.221
NP_441239.1_9 Forward -200 -188 3.08724 0.296
NP_441951.1_4 Forward -178 -159 0.294447 0.297
NP_441951.1_9 Forward -80 -61 2.85105 0.254
NP_442082.1_4 Reverse -205 -224 10.0292 0.165
NP_442044.1_1 Forward -315 -296 4.81767 0.131
NP_442044.1_1 Reverse -184 -203 -14.2585 0.284
NP_442270.1_9 Reverse -116 -135 -9.047 0.226
NP_440833.1_6 Forward -278 -264 16.0269 0.134
NP_443035.1_10 Forward -176 -159 6.23369 0.273
NP_441782.1_10 Reverse -70 -84 15.3688 0.23
NP_440546.1_4 Forward -178 -168 10.8217 0.104
NP_440546.1_4 Reverse -169 -179 8.59164 0.181
NP_441607.1_1 Forward -236 -217 13.5106 0.271
NP_442611.1_1 Reverse -306 -325 7.96426 0.14
NP_440868.1_4 Forward -202 -190 0.825626 0.199
NP_440868.1_7 Forward -196 -177 18.0915 0.0902
NP_442499.1_3 Reverse -291 -309 3.3624 0.295
NP_441084.1_5 Forward -288 -269 21.8289 0.022
NP_441084.1_6 Forward -180 -166 13.2224 0.14
NP_440653.1_1 Reverse -112 -131 4.62101 0.272
NP_440653.1_10 Forward -129 -110 7.57094 0.201
NP_442460.1_7 Reverse -177 -196 10.1275 0.112
NP_442039.1_7 Forward -176 -166 13.2547 0.211
NP_442039.1_7 Forward -282 -272 11.5831 0.257
NP_442837.1_3 Reverse -302 -309 6.52896 0.2
NP_442532.1_7 Forward -178 -164 3.63784 0.192
NP_440914.1_1 Forward -198 -188 14.5682 0.0112
NP_440914.1_1 Reverse -109 -119 9.39583 0.186
NP_442533.1_1 Reverse -45 -64 -16.2252 0.263
NP_442533.1_6 Forward -198 -189 13.6677 0.0192
NP_442533.1_6 Reverse -189 -198 7.66954 0.0897
NP_442533.1_6 Forward -178 -169 7.17789 0.0948
NP_442533.1_6 Reverse -169 -178 6.68623 0.105
NP_442533.1_6 Reverse -72 -81 2.458 0.255
NP_442533.1_6 Forward -108 -99 2.35967 0.259
NP_442541.1_10 Forward -91 -77 3.34225 0.254
NP_442541.1_10 Reverse -160 -174 2.06395 0.269
NP_443016.1_1 Forward -184 -165 -8.45701 0.298
NP_440116.1_8 Forward -326 -307 -3.83545 0.158
NP_441527.1_4 Reverse -5 -24 -8.16498 0.241
NP_441527.1_4 Reverse -7 -26 -10.4568 0.27
NP_440007.1_9 Forward -319 -305 10.521 0.163
NP_440007.1_9 Forward -373 -359 7.9644 0.193
NP_439965.1_1 Reverse -180 -199 6.88262 0.076
NP_443045.1_9 Forward -55 -37 6.40989 0.3
NP_441602.1_3 Reverse -296 -315 -4.52377 0.268
NP_442890.1_9 Forward -318 -299 19.2723 0.113
NP_442890.1_10 Forward -207 -188 20.7473 0.0505
NP_441972.1_5 Forward -128 -109 -5.60541 0.224
NP_441972.1_5 Forward -107 -88 -7.67036 0.252
NP_441972.1_5 Forward -197 -178 -8.26035 0.26
NP_441972.1_5 Reverse -47 -66 -8.26035 0.26
NP_441106.1_1 Forward -179 -170 5.50626 0.145
NP_441106.1_1 Forward -199 -190 5.3096 0.162
NP_441106.1_1 Forward -170 -161 2.55633 0.28
NP_442588.1_1 Reverse -69 -88 13.6675 0.143
NP_442306.1_10 Forward -183 -164 -21.1417 0.247
NP_441186.1_4 Reverse -125 -135 15.3192 0.238
NP_441286.1_1 Reverse -188 -200 -5.17256 0.192
NP_441705.1_3 Reverse -124 -143 4.71934 0.21
NP_440886.1_7 Reverse -168 -178 7.74772 0.0843
NP_440886.1_7 Forward -199 -189 7.45273 0.093
NP_440828.1_4 Forward -91 -72 -0.39464 0.19
NP_440828.1_4 Reverse -159 -178 -2.45958 0.214
NP_441001.1_10 Reverse -71 -90 9.43923 0.249
NP_442614.1_2 Forward -198 -184 7.86607 0.262
NP_440028.1_6 Reverse -322 -340 14.2771 0.218
NP_441463.1_3 Reverse -179 -198 -8.55534 0.271
NP_442211.1_3 Forward -326 -307 12.1406 0.245
NP_440107.1_5 Forward -185 -166 0.392778 0.178
NP_442615.1_1 Reverse -180 -198 -0.570838 0.118
NP_441796.1_8 Forward -124 -106 21.8486 0.0463
NP_441431.1_2 Forward -181 -167 6.58715 0.266
NP_440114.1_10 Reverse -169 -183 12.3893 0.0845
NP_442437.1_8 Reverse -161 -180 10.3242 0.187
NP_440287.1_6 Forward -366 -347 0.58944 0.289
NP_440293.1_3 Reverse -167 -186 -2.16383 0.239
NP_440293.1_3 Forward -125 -106 -2.55715 0.241
NP_440766.1_5 Reverse -124 -136 13.6718 0.222
NP_442743.1_4 Reverse -322 -341 -6.78538 0.279
NP_442743.1_5 Forward -197 -178 5.40766 0.202
NP_439910.1_2 Forward -206 -189 -13.8258 0.163
NP_442867.1_8 Reverse -162 -181 5.60432 0.276
NP_442867.1_8 Reverse -171 -190 5.40766 0.276
NP_440801.1_8 Forward -199 -180 4.71934 0.196
NP_442297.1_4 Forward -319 -300 13.016 0.255
NP_440473.1_9 Forward -180 -161 -7.76869 0.238
NP_442509.1_9 Reverse -189 -199 6.46942 0.268
NP_440734.1_9 Forward -56 -37 9.0459 0.297
NP_440554.1_4 Reverse -170 -180 5.28991 0.153
NP_440554.1_4 Reverse -361 -371 2.04498 0.279
NP_440554.1_4 Reverse -190 -200 2.04498 0.279
NP_441845.1_3 Forward -189 -170 18.2882 0.161
NP_441885.1_5 Forward -198 -188 1.74999 0.0991
NP_442341.1_7 Reverse -188 -202 5.89945 0.142
NP_443000.1_3 Forward -170 -151 11.3286 0.255
NP_443000.1_7 Forward -180 -170 0.766681 0.29
NP_442513.1_6 Reverse -77 -96 10.52 0.296
NP_441842.1_7 Forward -66 -47 11.2084 0.259
NP_441842.1_7 Forward -349 -330 9.7334 0.261
NP_443060.1_5 Reverse -181 -200 18.0915 0.0544
NP_442354.1_7 Reverse -117 -136 10.3242 0.202
NP_439962.1_4 Reverse -161 -180 3.93269 0.187
NP_439962.1_4 Forward -338 -319 -5.70374 0.28
NP_442495.1_4 Forward -92 -82 11.7798 0.263
NP_440149.1_8 Reverse -189 -208 -5.11376 0.219
NP_441875.1_10 Reverse -250 -264 12.586 0.232
NP_441105.1_3 Reverse -149 -168 -1.86883 0.153
NP_441105.1_3 Reverse -178 -197 -9.44032 0.289
NP_440216.1_1 Reverse -169 -183 -12.2918 0.256
NP_440172.1_1 Forward -198 -188 9.41981 0.0586
NP_441852.1_7 Reverse -295 -314 14.8474 0.297
NP_442015.1_10 Forward -202 -189 4.34585 0.174
NP_441226.1_7 Reverse -307 -314 6.52862 0.253
NP_440244.1_1 Forward -172 -153 -4.6221 0.243
NP_441766.1_9 Reverse -161 -180 -1.96717 0.276
NP_440416.1_9 Reverse -182 -201 -11.4069 0.151
NP_440416.1_9 Forward -92 -73 -13.6686 0.169
NP_440416.1_9 Reverse -311 -330 -13.8652 0.171
NP_440416.1_9 Reverse -153 -172 -18.0934 0.251
NP_442154.1_1 Forward -116 -98 -14.2388 0.217
NP_442154.1_1 Forward -177 -159 -14.5338 0.218
NP_442564.1_9 Reverse -355 -369 14.6052 0.227
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCCAGGTAAAATTTCCAGTTCCAATTTCCAGGTGATGTCATGGCTAATTTGTTCAACTGGCTTCCCCTCCTCAGTGGCCGCCAAGCGGATGGGATCAAAGCCAAAGTGGAAATATATACTTGGCAAACTTGCCCTTTTTGCATCCGGGCGAAACTTTTACTGTGGTGGAAGGGAGTTAAGTTTATCGAGTACAAAATTGACGGCGATGACCAAGCCAGACAGGCCATGGCGGCAAGGGCAGAAGGAAGACGCACTGTGCCCCAAATTTTTGTCAATGACCAGGGCATTGGTGGCTGTGACCAACTGTATGGCCTGGACAGCCGCGGCCAGTTAGACCCCCTGTTGGCCACTCCTCCTAACCCAGCCTAGGTATTATTTGTCCCTGTCCTGTTTTCCCCT

CDS

GTGCCCGTGAATTCCCCAGCCCCCTGGCAAACCATTGCCCAACAAATCAGTCAGACCACTGGTCAACCCTTCCGTATTCAGGAACGGCGATCGGTGAGTGGTGGTTGTATTAATCAGGGCTATTGCCTGGTGGATGGGGAGCAAAAATATTTTGTCAAACTTAATCAAGCCCAGCAGTGGCAGATGTTTCAAGCGGAAGCCCTCGGGTTAGAAGCCATGGCGGCCACCCAAACCATTCGGGTTCCCCGTCCCATTTGCCACGGCAGTTCCGCTGGCCATAGTTATCTGGTGTTGGAATGGCTCGAGTTTGGCCGGGGTAACCATGACAGTTGGTACCGCATGGGACAAAATTTGGCGGCATTGCATCAAGCCGGGGGCAGTGCCCAATTTGGTTGGCAGACTGATAACACCATTGGAGCCACTCCCCAGCCCAATCCCTGGACCGATAGTTGGGCCGACTTTTTTGCGGAGCATCGCCTTGGCTATCAACTGGCCCTTGCTCGACGACGGGCAGGGAACTTTCCCGATCCCGCCGTAGTAGTTCCCAAAGTGAAGCAGCTGTTAGGCGATCGCCAACCGACACCAGCTTTAGTCCATGGGGATCTGTGGTCTGGCAATGGCGCAATTTTAACCACAGGGGAACCAGTCATCCTCGACCCGGCCACCTACTACGGCGATGGGGAAGTGGATCTGGCTATGACGGAATTATTTGGGGGATTTCCGGCGGCTTTTTACCAGGGTTACCATAGCATCAGTCCCGCGGAACCTGGTTATCAACAACGGAAAATTCTCTACAATCTGTACCACATTCTCAACCACTTCAATTTGTTTGGGGGTGGTTATCAACAGCAAGCCCAGCAAATGCTTAAACAATGCTTAAGGATTTAA

Protein

MPVNSPAPWQTIAQQISQTTGQPFRIQERRSVSGGCINQGYCLVDGEQKYFVKLNQAQQWQMFQAEALGLEAMAATQTIRVPRPICHGSSAGHSYLVLEWLEFGRGNHDSWYRMGQNLAALHQAGGSAQFGWQTDNTIGATPQPNPWTDSWADFFAEHRLGYQLALARRRAGNFPDPAVVVPKVKQLLGDRQPTPALVHGDLWSGNGAILTTGEPVILDPATYYGDGEVDLAMTELFGGFPAAFYQGYHSISPAEPGYQQRKILYNLYHILNHFNLFGGGYQQQAQQMLKQCLRI