Your browser is old and dusty. Try Google Chrome!

Details for slr1557

ORF slr1557
Accession NP_442884.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -218 -204 4.52282 0.147
NP_441061.1_2 Forward -181 -167 4.32615 0.151
NP_442100.1_1 Reverse -153 -172 6.34979 0.288
NP_441418.1_6 Reverse -185 -204 -23.01 0.19
NP_440897.1_6 Reverse -64 -83 -4.03287 0.262
NP_441818.1_9 Reverse -53 -72 -4.22878 0.234
NP_440150.1_6 Reverse -281 -300 5.80098 0.229
NP_440996.1_3 Reverse -172 -190 19.9803 0.0427
NP_441976.1_3 Forward -266 -247 19.9606 0.157
NP_443002.1_5 Reverse -173 -191 11.3264 0.247
NP_442173.1_1 Reverse -229 -237 4.73931 0.258
NP_441812.1_3 Forward -315 -301 9.04604 0.245
NP_440784.1_7 Forward -313 -306 5.84064 0.248
NP_440061.1_9 Reverse -208 -222 8.84875 0.161
NP_441476.1_5 Forward -199 -180 -6.68705 0.275
NP_439979.1_9 Reverse -53 -71 7.19731 0.288
NP_441859.1_3 Reverse -172 -191 3.24359 0.246
NP_441859.1_3 Reverse -209 -228 1.17865 0.293
NP_441925.1_2 Reverse -321 -340 7.07928 0.262
NP_441925.1_2 Reverse -176 -195 0.0977854 0.298
NP_441925.1_4 Forward -72 -53 -13.4726 0.257
NP_440856.1_7 Forward -384 -365 -9.63698 0.294
NP_441083.1_5 Forward -46 -36 0.57002 0.223
NP_441149.1_9 Reverse -117 -136 1.76863 0.221
NP_441955.1_8 Reverse -315 -332 8.49531 0.258
NP_441713.1_5 Reverse -314 -333 7.86593 0.255
NP_440178.1_7 Forward -318 -299 -13.4719 0.136
NP_442570.1_3 Reverse -354 -373 -4.91709 0.237
NP_442570.1_8 Reverse -195 -213 12.7038 0.179
NP_442111.1_3 Forward -124 -111 14.5765 0.23
NP_440747.1_10 Forward -76 -64 -11.7607 0.142
NP_442330.1_4 Reverse -249 -268 16.9955 0.233
NP_440403.1_4 Reverse -363 -382 -6.88371 0.236
NP_441695.1_4 Reverse -216 -234 11.8189 0.227
NP_441695.1_10 Forward -73 -54 20.9431 0.0449
NP_441012.1_4 Forward -95 -82 5.91914 0.286
NP_441643.1_3 Reverse -64 -83 9.83255 0.255
NP_440376.1_1 Reverse -64 -73 4.81794 0.149
NP_440376.1_1 Forward -320 -311 -0.196935 0.285
NP_441077.1_6 Forward -123 -107 10.0324 0.164
NP_440066.1_5 Reverse -178 -197 11.0117 0.251
NP_441846.1_10 Reverse -252 -271 -22.715 0.264
NP_440741.1_5 Reverse -275 -294 18.5591 0.182
NP_441763.1_10 Forward -341 -322 7.66846 0.23
NP_440141.1_4 Reverse -27 -46 -11.2103 0.298
NP_442205.1_9 Forward -320 -304 -2.30141 0.268
NP_441487.1_9 Forward -74 -55 -0.983855 0.27
NP_441127.1_1 Forward -133 -119 11.7993 0.215
NP_441127.1_1 Reverse -302 -316 7.66941 0.3
NP_440203.1_5 Forward -381 -371 8.73102 0.288
NP_442376.1_5 Reverse -182 -196 8.65272 0.194
NP_441580.1_6 Reverse -174 -193 -2.26216 0.217
NP_443055.1_6 Reverse -131 -149 1.39504 0.231
NP_442210.1_5 Forward -196 -177 11.2092 0.22
NP_441099.1_5 Reverse -122 -141 -10.0303 0.24
NP_442002.1_9 Reverse -35 -42 12.8221 0.185
NP_441294.1_7 Forward -223 -209 10.5945 0.181
NP_441646.1_1 Forward -378 -359 3.04771 0.21
NP_441646.1_1 Forward -321 -302 2.55606 0.218
NP_441646.1_1 Forward -226 -207 -0.0988766 0.259
NP_442771.1_1 Reverse -244 -262 -9.12563 0.216
NP_442884.1_2 Forward -271 -252 20.4523 0.133
NP_442884.1_3 Forward -366 -347 24.9755 0.0164
NP_442884.1_4 Forward -307 -288 30.1871 0.000515
NP_442884.1_5 Forward -331 -312 33.432 0.000017
NP_442884.1_6 Forward -250 -231 29.3995 0.000232
NP_442884.1_9 Forward -286 -273 21.3571 0.185
NP_442884.1_10 Forward -346 -332 23.009 0.0464
NP_440147.1_4 Forward -316 -303 4.24752 0.167
NP_441916.1_7 Reverse -64 -74 4.79825 0.159
NP_440465.1_10 Reverse -302 -321 3.14605 0.251
NP_441041.1_4 Reverse -64 -83 -12.4886 0.266
NP_441041.1_7 Forward -185 -173 5.95994 0.231
NP_440202.1_8 Forward -329 -310 10.3899 0.297
NP_440674.1_3 Forward -371 -352 4.42435 0.253
NP_440983.1_5 Forward -73 -54 -6.68705 0.278
NP_440177.1_9 Reverse -56 -75 12.6841 0.229
NP_441087.1_6 Forward -92 -74 3.8533 0.258
NP_441556.1_10 Reverse -204 -218 10.5138 0.267
NP_441644.1_6 Reverse -246 -256 6.96107 0.141
NP_440253.1_2 Forward -76 -58 -2.63579 0.271
NP_442554.1_8 Forward -254 -244 3.81494 0.209
NP_442554.1_8 Forward -218 -208 2.04498 0.285
NP_441762.1_7 Reverse -320 -332 -4.09092 0.153
NP_441762.1_7 Reverse -184 -196 -5.36923 0.203
NP_442301.1_2 Forward -71 -52 6.98015 0.258
NP_440357.1_3 Forward -184 -165 6.4893 0.237
NP_440158.1_8 Forward -184 -165 15.0441 0.18
NP_440464.1_10 Forward -218 -208 11.6713 0.287
NP_441758.1_3 Forward -249 -231 17.1279 0.285
NP_441020.2_6 Reverse -381 -398 9.57695 0.168
NP_441020.2_6 Reverse -65 -82 7.90532 0.215
NP_441673.1_1 Reverse -64 -73 -7.86675 0.187
NP_441673.1_1 Forward -73 -64 -7.96508 0.206
NP_441731.1_9 Reverse -54 -71 15.2801 0.209
NP_440265.1_8 Reverse -170 -188 15.0638 0.218
NP_441876.1_9 Forward -41 -31 13.5492 0.267
NP_442490.1_9 Forward -194 -175 -8.45701 0.291
NP_442719.1_2 Reverse -115 -133 -5.38976 0.219
NP_442227.1_2 Forward -82 -63 -3.73712 0.295
NP_442808.1_1 Reverse -184 -194 3.32285 0.244
NP_442808.1_1 Forward -294 -284 2.14288 0.275
NP_441101.1_10 Reverse -206 -225 -7.37537 0.29
NP_442542.1_2 Forward -184 -171 6.60746 0.216
NP_442050.1_1 Reverse -362 -381 13.0775 0.187
NP_440342.1_1 Reverse -60 -79 10.7175 0.279
NP_440558.1_2 Forward -258 -239 -3.93378 0.239
NP_441878.1_6 Reverse -63 -73 -7.00147 0.201
NP_441036.1_8 Forward -322 -312 9.32148 0.174
NP_441445.1_1 Reverse -55 -74 -0.4922 0.294
NP_441590.1_4 Forward -77 -58 8.4551 0.249
NP_441433.1_3 Reverse -190 -209 17.109 0.115
NP_440101.1_10 Forward -320 -301 11.2092 0.146
NP_441574.1_1 Reverse -52 -71 0.982764 0.182
NP_442645.1_3 Forward -257 -238 5.11266 0.261
NP_440547.1_1 Reverse -168 -187 10.2251 0.237
NP_441037.1_4 Reverse -244 -254 12.5804 0.0967
NP_442590.1_9 Reverse -228 -247 3.53937 0.285
NP_442998.1_5 Forward -125 -115 9.81313 0.233
NP_442998.1_5 Reverse -34 -44 7.74818 0.284
NP_440299.1_6 Reverse -215 -234 5.99764 0.268
NP_441799.1_1 Forward -318 -304 4.03056 0.269
NP_441007.1_10 Reverse -56 -69 0.412608 0.23
NP_441559.1_8 Forward -376 -362 3.24451 0.143
NP_441559.1_8 Forward -298 -284 -4.32697 0.222
NP_441559.1_8 Forward -78 -64 -6.19526 0.275
NP_441179.1_9 Forward -295 -285 9.41933 0.28
NP_441866.1_6 Forward -395 -376 6.1935 0.293
NP_441464.1_8 Forward -73 -59 4.91614 0.26
NP_442386.1_9 Reverse -209 -218 6.39082 0.219
NP_440168.1_8 Forward -200 -181 5.60432 0.215
NP_440684.1_9 Forward -320 -306 10.0294 0.209
NP_439937.1_8 Reverse -180 -199 5.11266 0.197
NP_439937.1_9 Forward -256 -239 -0.0601847 0.109
NP_439937.1_9 Forward -77 -60 -1.24015 0.122
NP_439937.1_9 Forward -195 -178 -13.1381 0.28
NP_439937.1_9 Reverse -209 -226 -17.1697 0.294
NP_442294.1_3 Forward -108 -94 13.2736 0.274
NP_441595.1_10 Reverse -323 -342 12.9387 0.283
NP_440398.1_2 Forward -326 -307 6.09597 0.231
NP_440819.1_5 Forward -125 -117 7.59091 0.272
NP_442384.1_10 Reverse -305 -318 10.7374 0.0423
NP_442790.1_4 Forward -380 -361 -10.9153 0.219
NP_440344.1_10 Reverse -178 -195 -12.1542 0.243
NP_440531.1_3 Reverse -312 -331 8.25926 0.281
NP_441335.1_8 Reverse -234 -253 18.4857 0.111
NP_442693.1_7 Reverse -63 -82 13.0775 0.202
NP_442280.1_10 Forward -87 -69 5.45442 0.284
NP_441103.1_9 Forward -41 -31 14.1497 0.23
NP_440894.1_10 Forward -95 -76 10.0292 0.155
NP_440999.1_9 Forward -186 -172 1.86788 0.157
NP_440491.1_1 Reverse -64 -83 6.81956 0.288
NP_440052.1_5 Reverse -53 -72 2.3594 0.165
NP_442277.1_2 Forward -85 -71 11.701 0.263
NP_442033.1_10 Forward -257 -238 -8.06369 0.189
NP_442845.1_2 Forward -230 -216 4.12949 0.267
NP_443064.1_3 Reverse -218 -237 11.2092 0.159
NP_441462.1_2 Reverse -67 -77 5.19158 0.0752
NP_441462.1_6 Reverse -22 -40 12.5072 0.19
NP_441621.1_7 Reverse -183 -197 -3.34366 0.188
NP_443062.1_1 Forward -219 -201 4.35311 0.264
NP_443062.1_6 Reverse -165 -184 1.57275 0.272
NP_441351.1_8 Forward -38 -19 0.982764 0.276
NP_440516.1_8 Reverse -67 -76 -0.000272808 0.156
NP_440783.1_5 Reverse -58 -77 -4.52377 0.276
NP_442120.1_10 Forward -123 -104 -8.65367 0.237
NP_440865.1_9 Forward -202 -183 -5.70374 0.216
NP_441052.1_2 Forward -371 -361 3.12662 0.184
NP_442219.1_8 Forward -321 -302 12.9988 0.153
NP_441884.1_9 Forward -224 -205 -23.1083 0.284
NP_441884.1_9 Reverse -18 -37 -28.3199 0.294
NP_441004.1_1 Reverse -357 -376 -16.8151 0.287
NP_441004.1_1 Reverse -55 -74 -17.7001 0.294
NP_441004.1_2 Forward -184 -165 -4.22878 0.29
NP_442366.1_3 Forward -220 -202 7.39397 0.0747
NP_443054.1_2 Reverse -171 -185 0.88457 0.252
NP_441542.1_4 Reverse -326 -340 5.30946 0.264
NP_442011.1_1 Reverse -66 -85 2.85105 0.249
NP_441046.1_2 Reverse -300 -319 7.07928 0.221
NP_441349.1_10 Forward -83 -64 -3.24547 0.136
NP_442843.1_1 Forward -202 -183 -4.91709 0.239
NP_442843.1_1 Forward -148 -129 -11.5053 0.291
NP_439960.1_6 Forward -258 -239 7.37428 0.28
NP_439960.1_6 Forward -79 -60 6.88262 0.3
NP_440588.1_2 Forward -302 -283 -5.70374 0.259
NP_441078.1_4 Reverse -64 -73 -1.57357 0.266
NP_441663.1_8 Forward -247 -228 -2.85214 0.274
NP_442443.1_1 Reverse -313 -332 -5.9004 0.287
NP_443024.1_3 Forward -184 -174 13.2547 0.289
NP_442320.1_8 Reverse -179 -193 -2.75368 0.0966
NP_442797.1_7 Forward -195 -177 1.39578 0.259
NP_442797.1_7 Forward -232 -214 -1.55415 0.299
NP_442353.1_4 Forward -218 -199 18.7798 0.0597
NP_442489.1_7 Reverse -64 -73 -1.08191 0.179
NP_440386.1_3 Forward -55 -36 -12.1936 0.292
NP_441659.2_8 Reverse -246 -256 -0.216628 0.292
NP_442913.1_10 Reverse -296 -315 -2.45882 0.186
NP_442346.1_5 Reverse -304 -314 5.5849 0.238
NP_442346.1_5 Reverse -245 -255 4.69992 0.276
NP_440545.1_3 Reverse -206 -223 -0.649475 0.157
NP_440545.1_3 Forward -259 -242 -3.99273 0.215
NP_440545.1_3 Reverse -242 -259 -4.58271 0.229
NP_441856.1_6 Forward -135 -121 14.5526 0.272
NP_441923.1_6 Reverse -258 -272 15.0442 0.175
NP_440847.1_3 Forward -273 -259 13.1753 0.219
NP_441585.1_5 Forward -235 -216 -1.37794 0.298
NP_441888.1_7 Reverse -316 -330 9.04604 0.168
NP_442140.1_3 Reverse -247 -257 11.2881 0.0793
NP_440590.1_4 Forward -254 -241 1.88757 0.108
NP_440590.1_4 Forward -193 -180 -0.472371 0.189
NP_440590.1_4 Forward -75 -62 -4.60227 0.263
NP_441951.1_4 Forward -82 -63 1.57275 0.283
NP_441951.1_9 Forward -72 -53 0.294447 0.261
NP_440400.1_1 Forward -264 -245 -3.24622 0.292
NP_440546.1_6 Reverse -178 -197 13.1758 0.207
NP_440812.1_1 Reverse -173 -192 3.04771 0.267
NP_442402.1_9 Forward -87 -68 9.24257 0.277
NP_440008.1_9 Forward -38 -19 8.75091 0.283
NP_440825.1_6 Forward -184 -165 10.8159 0.282
NP_441252.1_6 Reverse -360 -367 14.3954 0.168
NP_441576.1_8 Forward -197 -179 22.8319 0.0497
NP_441408.2_7 Reverse -372 -391 -2.26216 0.265
NP_442533.1_6 Forward -73 -64 5.50626 0.14
NP_442533.1_6 Reverse -64 -73 4.22796 0.186
NP_442533.1_6 Forward -314 -305 3.04799 0.228
NP_443050.1_2 Reverse -66 -85 11.3075 0.147
NP_443016.1_1 Reverse -204 -223 -4.03212 0.225
NP_441170.1_4 Reverse -353 -371 6.90232 0.194
NP_441106.1_1 Reverse -63 -72 2.85133 0.255
NP_001035870.1_10 Reverse -375 -394 14.2917 0.227
NP_442306.1_10 Forward -78 -59 -20.1584 0.202
NP_440670.1_8 Forward -255 -246 3.14632 0.296
NP_440886.1_7 Forward -74 -64 7.0594 0.106
NP_440886.1_7 Reverse -293 -303 4.69947 0.22
NP_440268.1_10 Forward -245 -231 25.5656 0.00364
NP_440828.1_1 Reverse -123 -142 7.37347 0.197
NP_442614.1_2 Reverse -67 -81 7.9644 0.257
NP_442382.1_9 Forward -285 -266 8.25844 0.286
NP_442264.1_5 Reverse -88 -102 12.291 0.253
NP_442211.1_9 Reverse -185 -204 2.0644 0.247
NP_442221.1_4 Reverse -57 -76 7.57094 0.296
NP_442209.1_9 Reverse -73 -92 20.5498 0.123
NP_442794.1_1 Reverse -206 -218 8.49544 0.104
NP_441962.1_4 Forward -187 -168 -6.39206 0.176
NP_441962.1_4 Forward -196 -177 -8.45701 0.2
NP_441962.1_4 Forward -223 -204 -14.0619 0.282
NP_440387.1_1 Reverse -185 -201 -6.43131 0.285
NP_441431.1_2 Forward -76 -62 8.65209 0.209
NP_441431.1_2 Reverse -64 -78 5.99717 0.281
NP_441993.1_1 Reverse -58 -77 8.96362 0.136
NP_441993.1_1 Forward -91 -72 3.506 0.233
NP_441993.1_1 Forward -317 -298 1.84923 0.269
NP_440814.1_8 Reverse -64 -83 0.786102 0.269
NP_440293.1_3 Reverse -86 -105 -4.6221 0.264
NP_440766.1_4 Reverse -63 -77 0.294584 0.291
NP_439988.1_3 Forward -259 -245 3.53951 0.298
NP_441237.1_9 Forward -254 -244 9.91146 0.261
NP_440324.1_7 Reverse -358 -375 15.2801 0.226
NP_442867.1_8 Reverse -349 -368 8.75091 0.23
NP_440457.1_1 Forward -223 -211 -0.649339 0.271
NP_440142.1_3 Reverse -54 -73 13.1758 0.235
NP_440478.1_10 Reverse -62 -76 8.65272 0.257
NP_441756.1_5 Forward -40 -21 -3.73712 0.29
NP_440275.1_3 Reverse -65 -75 4.99491 0.167
NP_440275.1_3 Forward -257 -247 4.40493 0.196
NP_440275.1_3 Reverse -285 -295 3.42162 0.229
NP_440679.1_5 Forward -216 -197 10.2259 0.29
NP_439962.1_4 Forward -78 -59 0.687771 0.197
NP_439962.1_4 Forward -190 -171 -0.000545616 0.197
NP_440175.1_7 Reverse -347 -365 12.2909 0.225
NP_440216.1_1 Reverse -64 -78 -11.8985 0.228
NP_440172.1_1 Reverse -173 -183 1.74999 0.299
NP_442015.1_10 Reverse -206 -219 2.77255 0.187
NP_441226.1_7 Forward -218 -211 9.47853 0.147
NP_441766.1_2 Forward -76 -67 1.96635 0.265
NP_440416.1_9 Forward -40 -21 -17.2085 0.234
NP_443052.1_8 Reverse -295 -314 -10.0303 0.201
NP_443052.1_9 Forward -265 -246 1.17943 0.186
NP_443052.1_9 Reverse -313 -332 -5.9004 0.274
NP_442154.1_1 Reverse -53 -71 -14.2388 0.217
NP_442154.1_1 Reverse -255 -273 -18.9587 0.288
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATAGATTCCTCGTCCTCTGCATTGACTCCGGTGTTGCCCAACTCAGGATAGGTAAACGTGACAATTTGGCCGCAATAACTGGGGTCGGTCATCACTTCCTGGTAGCCGGTCATACCCGTGTTGAATACCACCTCTCCCACTGTGGTACCATCGGCCCCGAAGGACCAACCGGGATAAGGGGTGCCATCCGCAAGGACAAGAAGGGCCGGTTTCGCCGCAGCAATTGGCATAATGATATATTGCAAGGTAGCTGGAATAGGACCATTCGGCCGTAGTGGGAAAAAGTTAAGTCCTTGGAGTCTTATCCAAGGCTGTGCTCCTTTGCCCGGCCGCCGCCGAATCAACCACATATTAGCAGATTCGCCCCTGTCGTCTGTTCCACTAATGTCAAATTGTCCTG

CDS

ATGGTTACTGCCATGAGTCCTGCTAAGCTGACCGACACCGATAAACAAGAGTTGGTGGACCTCTACCGGCAAACCCCCGCCACCACCACCACCCTGGCGGAACGTTTTGGGGTGAGCATTTCCACCGTCAGTCGTCTCTTAAAAACGGCGATCGCCAGTGGGGAATATGAAACCTTAGTGCAGGAAAAAAGGGGCAGTAAGGGAATTAAAAATGATGCCCAGTTGACGTTGCCGTTGCCCAAGCCATCTAGGAAAAAGTTGGAAGTGGCAGAAACCAATCTCCCTGGGGATGCCGTGGCGGAGGTGGCCCCTGTTGCTGGGCCGAATCATCAAGACAGAGAGACTAATGAAACTAATGCTAGTGGCCAGGGCAGAAGGGTGCGTTCCCGTCGTCGAGTCACCGCCAGCCCCGTTGCCCCAGAGCCTGGGGAGTTTACCGATGCGGAAAAAACCATTGATCCGCCGGCGATCGCCATCCCCTCCCTAGCCCAGCCCGATCCAACAGGATTTGGTGATATCCCAACCACCATGTCAGTGGCAAAAACTGAAGTACCGCCCGATGCCCCCATGGGGCGACGCCCCCAGATTGTTTCAATTAAATCTTCCGCCCTAGATGAAATTGTCAAGGACATAGACGAGGACTTGGGTTTACTGGATGGCGAAGATATCGATGACCTTGACGACGAAGACGATGATGATGAGTTTGAAGATGAATTAGACGATTTCGACGAAGACCAAGGGGAAGAGGATTATATTCCCACCCCAGTGGCCACCAAACAAACCCTAGCAAACACCGCAGAGCTAGTTTCAATTTTGCCCCTAATAGAAGCTTCTATGCCCAAAAACTGCTACCTAGTGGTGGACAGAAGGGGGGAATTGATTGTCCGTCCCCTGAAGGAATTTAGTCTTGATGGGGCCTTACCCCCCGAAGAAGTCCAGGCAAAAACCCTACCTGTTTTTGATAACCATCGGGTGGCCCGGCGCTTTTCCCTCAAAACCCAAAAGGTAATTCGTCTGCCCGACGCTAGCATTGTCCAAAAAACCGCCCAGGCACTCAAATCCAAGGGGATTACCAGGGTGTTCCTCGGCGGCCAGGTTTATTCCCTTTAA

Protein

MVTAMSPAKLTDTDKQELVDLYRQTPATTTTLAERFGVSISTVSRLLKTAIASGEYETLVQEKRGSKGIKNDAQLTLPLPKPSRKKLEVAETNLPGDAVAEVAPVAGPNHQDRETNETNASGQGRRVRSRRRVTASPVAPEPGEFTDAEKTIDPPAIAIPSLAQPDPTGFGDIPTTMSVAKTEVPPDAPMGRRPQIVSIKSSALDEIVKDIDEDLGLLDGEDIDDLDDEDDDDEFEDELDDFDEDQGEEDYIPTPVATKQTLANTAELVSILPLIEASMPKNCYLVVDRRGELIVRPLKEFSLDGALPPEEVQAKTLPVFDNHRVARRFSLKTQKVIRLPDASIVQKTAQALKSKGITRVFLGGQVYSL