Your browser is old and dusty. Try Google Chrome!

Details for slr1549

ORF slr1549
Accession NP_440801.1
Symbol
Category Protein modification and translation factors
Definition polypeptide deformylase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -271 -285 2.2612 0.178
NP_442761.1_5 Forward -284 -265 13.4708 0.0933
NP_440795.1_7 Forward -278 -271 14.6904 0.0123
NP_440795.1_7 Reverse -271 -278 14.6904 0.0123
NP_440795.1_7 Reverse -242 -249 7.80726 0.232
NP_441418.1_6 Forward -279 -260 -18.8801 0.0839
NP_441418.1_6 Reverse -270 -289 -19.8634 0.0979
NP_440897.1_6 Reverse -270 -289 11.405 0.0705
NP_441453.1_1 Forward -286 -268 12.998 0.0938
NP_441453.1_4 Reverse -270 -278 16.539 0.00633
NP_441453.1_4 Forward -279 -271 16.539 0.00633
NP_442151.1_6 Reverse -270 -284 9.14437 0.157
NP_442151.1_6 Forward -160 -146 8.65272 0.167
NP_441818.1_9 Reverse -367 -386 3.6377 0.18
NP_440226.1_1 Forward -279 -260 16.4207 0.0217
NP_440150.1_1 Reverse -244 -263 15.1424 0.0322
NP_440150.1_6 Reverse -267 -286 0.884433 0.295
NP_442655.1_10 Reverse -267 -286 -0.590531 0.178
NP_442173.1_1 Forward -278 -270 15.4574 0.00633
NP_442173.1_1 Reverse -271 -279 15.4574 0.00633
NP_442752.1_4 Forward -279 -272 13.8055 0.0199
NP_442752.1_4 Reverse -270 -277 13.8055 0.0199
NP_443027.1_4 Forward -281 -271 14.828 0.0437
NP_443027.1_4 Reverse -268 -278 13.2547 0.0521
NP_443027.1_4 Forward -162 -152 9.61647 0.159
NP_441812.1_3 Forward -280 -266 7.47274 0.272
NP_442975.1_10 Forward -283 -269 14.0603 0.0459
NP_440784.1_7 Forward -278 -271 15.9687 0.0123
NP_440784.1_7 Reverse -271 -278 15.9687 0.0123
NP_440061.1_9 Forward -281 -267 10.2254 0.126
NP_440061.1_9 Forward -42 -28 4.91554 0.3
NP_440878.1_9 Forward -289 -270 3.53937 0.174
NP_440878.1_9 Forward -235 -216 -2.95047 0.281
NP_442062.1_3 Forward -88 -69 -1.96717 0.265
NP_442062.1_8 Reverse -270 -280 19.4496 0.000558
NP_442062.1_8 Forward -279 -269 10.3048 0.0493
NP_441900.1_1 Forward -37 -18 9.1044 0.3
NP_440304.1_4 Forward -281 -271 10.8948 0.051
NP_440304.1_4 Reverse -268 -278 10.8948 0.051
NP_442242.1_4 Forward -278 -271 14.3954 0.0124
NP_442242.1_4 Reverse -271 -278 14.3954 0.0124
NP_441781.1_7 Forward -279 -260 -3.04881 0.294
NP_441581.1_6 Reverse -271 -290 9.58335 0.291
NP_441208.1_9 Reverse -267 -281 6.09611 0.253
NP_440370.1_10 Reverse -261 -280 6.39097 0.296
NP_442110.1_7 Reverse -270 -284 3.53951 0.21
NP_442110.1_7 Forward -279 -265 2.2612 0.222
NP_441925.1_4 Forward -226 -207 -7.6711 0.196
NP_441925.1_4 Forward -224 -205 -17.4058 0.294
NP_441925.1_4 Forward -218 -199 -17.5041 0.296
NP_440856.1_4 Reverse -263 -282 4.52268 0.104
NP_441083.1_3 Reverse -97 -107 15.0242 0.138
NP_441083.1_5 Reverse -270 -280 11.3864 0.0159
NP_441083.1_5 Forward -279 -269 11.2881 0.0159
NP_442115.2_7 Forward -278 -261 9.08529 0.198
NP_441149.1_7 Forward -69 -50 0.884433 0.276
NP_441738.1_2 Forward -277 -270 15.28 0.0102
NP_441738.1_2 Reverse -272 -279 15.28 0.0102
NP_441558.1_5 Forward -281 -262 9.53756 0.118
NP_441558.1_5 Reverse -268 -287 3.93269 0.294
NP_440209.1_1 Reverse -270 -278 18.1123 0.00295
NP_440209.1_1 Forward -279 -271 18.1123 0.00295
NP_441713.1_1 Forward -285 -266 2.26107 0.0649
NP_441713.1_1 Reverse -264 -283 -15.0452 0.26
NP_441713.1_5 Reverse -153 -172 9.3409 0.246
NP_441770.1_4 Forward -240 -221 -10.4236 0.271
NP_440178.1_7 Forward -280 -261 -19.6667 0.178
NP_442570.1_3 Reverse -239 -258 -6.39206 0.257
NP_441716.1_1 Reverse -270 -284 12.9793 0.0689
NP_441327.1_5 Reverse -291 -300 16.2243 0.164
NP_442111.1_4 Reverse -269 -283 16.9125 0.0123
NP_442111.1_4 Forward -280 -266 4.03116 0.223
NP_441163.1_1 Forward -287 -270 4.36469 0.289
NP_440851.1_5 Forward -174 -155 16.0265 0.159
NP_440906.1_5 Forward -278 -271 15.8704 0.0124
NP_440906.1_5 Reverse -271 -278 15.8704 0.0124
NP_440906.1_9 Forward -392 -373 21.3364 0.13
NP_440747.1_10 Reverse -267 -279 17.1486 0.000663
NP_440747.1_10 Forward -282 -270 7.70879 0.00236
NP_441837.1_10 Forward -390 -371 12.9791 0.184
NP_441130.1_10 Forward -281 -267 10.521 0.112
NP_441486.1_1 Forward -282 -268 -3.83532 0.183
NP_441486.1_1 Reverse -267 -281 -6.39192 0.294
NP_442634.1_4 Reverse -268 -282 16.9125 0.01
NP_442634.1_4 Forward -281 -267 -1.18038 0.149
NP_442634.1_4 Reverse -149 -163 -3.73699 0.164
NP_441265.1_3 Forward -285 -271 3.14618 0.181
NP_440403.1_4 Forward -32 -13 -9.93197 0.288
NP_442848.1_1 Reverse -145 -159 -2.95034 0.263
NP_441012.1_4 Forward -283 -270 7.19745 0.272
NP_443018.1_3 Forward -278 -271 14.8871 0.0123
NP_443018.1_3 Reverse -271 -278 14.8871 0.0123
NP_443018.1_3 Reverse -152 -159 4.26735 0.267
NP_443018.1_3 Forward -159 -152 4.07068 0.299
NP_441316.1_7 Forward -281 -266 6.37141 0.107
NP_441316.1_7 Reverse -149 -164 -3.26502 0.273
NP_441634.1_8 Reverse -268 -282 -2.95034 0.295
NP_440376.1_1 Forward -279 -270 19.4693 0.000692
NP_440376.1_1 Reverse -270 -279 19.4693 0.000692
NP_440376.1_1 Forward -250 -241 5.50626 0.131
NP_442687.1_1 Reverse -225 -238 11.8184 0.273
NP_442687.1_7 Forward -280 -270 15.8113 0.0125
NP_442687.1_7 Reverse -269 -279 9.02648 0.0994
NP_440066.1_5 Forward -342 -323 10.52 0.251
NP_441846.1_10 Reverse -198 -217 -19.7651 0.256
NP_441846.1_10 Reverse -200 -219 -20.0601 0.256
NP_441846.1_10 Reverse -199 -218 -21.0434 0.256
NP_442530.1_2 Forward -143 -133 15.123 0.203
NP_441422.1_7 Forward -281 -264 -3.00942 0.226
NP_440533.1_9 Forward -279 -260 5.01433 0.214
NP_440533.1_9 Reverse -270 -289 2.0644 0.289
NP_441763.1_10 Forward -290 -271 8.16011 0.22
NP_442658.1_1 Forward -281 -271 15.9091 0.00966
NP_442658.1_1 Reverse -268 -278 14.2375 0.0237
NP_440141.1_8 Reverse -192 -211 7.27595 0.243
NP_442782.1_2 Forward -279 -265 11.7993 0.173
NP_442782.1_2 Reverse -270 -284 0.982901 0.282
NP_442544.1_2 Forward -210 -196 -1.37704 0.287
NP_442544.1_6 Forward -167 -148 -7.76869 0.298
NP_441414.1_9 Forward -250 -231 -6.49039 0.196
NP_440800.1_2 Reverse -61 -80 14.4698 0.261
NP_442937.1_5 Reverse -242 -261 11.7008 0.132
NP_442321.1_1 Reverse -190 -209 -6.49039 0.24
NP_441958.1_5 Reverse -269 -279 21.2195 0.000805
NP_441958.1_5 Forward -280 -270 12.2714 0.00183
NP_441127.1_1 Forward -107 -93 10.1277 0.259
NP_442486.1_6 Forward -166 -147 1.86774 0.266
NP_440203.1_5 Forward -163 -153 13.5492 0.114
NP_440984.1_7 Reverse -265 -279 6.29277 0.219
NP_440984.1_7 Forward -255 -241 5.80112 0.24
NP_439990.1_5 Forward -284 -271 11.3273 0.128
NP_442690.1_1 Reverse -66 -85 -10.9153 0.22
NP_442911.1_2 Forward -289 -270 -2.85214 0.104
NP_442911.1_4 Forward -344 -325 11.0117 0.265
NP_441580.1_6 Reverse -259 -278 -5.40875 0.235
NP_440153.1_8 Forward -222 -209 6.90245 0.17
NP_441591.1_10 Reverse -154 -173 7.86593 0.267
NP_442064.1_4 Reverse -237 -256 4.32522 0.29
NP_442051.1_5 Forward -110 -91 11.4058 0.29
NP_443055.1_6 Reverse -262 -280 -0.178247 0.254
NP_441129.1_3 Reverse -266 -285 -17.6018 0.281
NP_441099.1_5 Reverse -260 -279 7.7676 0.0409
NP_442002.1_9 Forward -280 -273 10.7572 0.185
NP_440411.1_4 Reverse -66 -85 17.5024 0.0789
NP_442438.1_10 Forward -284 -270 10.816 0.0484
NP_441000.1_5 Forward -82 -63 4.62021 0.284
NP_441000.1_6 Forward -280 -266 4.42448 0.0953
NP_442771.1_1 Reverse -268 -286 -6.4707 0.168
NP_440484.1_3 Reverse -268 -282 12.3893 0.242
NP_440147.1_4 Forward -281 -268 10.4424 0.0355
NP_440147.1_4 Reverse -268 -281 8.9674 0.0448
NP_441295.1_4 Forward -255 -236 7.47261 0.29
NP_441295.1_4 Forward -284 -265 -4.91709 0.29
NP_441550.1_8 Reverse -268 -278 15.8108 0.0132
NP_441550.1_8 Forward -281 -271 6.0761 0.214
NP_441916.1_7 Forward -279 -269 18.9579 0.00144
NP_441916.1_7 Reverse -270 -280 18.4663 0.00144
NP_441916.1_7 Forward -250 -240 4.10993 0.19
NP_441041.1_4 Reverse -145 -164 9.24257 0.033
NP_441041.1_4 Reverse -270 -289 1.27776 0.0813
NP_441041.1_4 Forward -279 -260 0.982764 0.0818
NP_441041.1_4 Reverse -207 -226 -7.17871 0.182
NP_441041.1_7 Reverse -267 -279 13.3454 0.0485
NP_441041.1_7 Forward -282 -270 7.61196 0.162
NP_442396.1_5 Forward -230 -217 8.9674 0.139
NP_441725.1_4 Reverse -265 -279 12.2903 0.0693
NP_441725.1_5 Reverse -271 -281 11.2881 0.0247
NP_441725.1_5 Forward -278 -268 1.94665 0.115
NP_441725.1_5 Forward -159 -149 -1.10161 0.288
NP_441725.1_8 Forward -172 -153 8.65258 0.273
NP_439966.1_7 Forward -281 -271 18.4657 0.00473
NP_439966.1_7 Reverse -268 -278 14.3359 0.0203
NP_439966.1_9 Forward -281 -272 0.983037 0.253
NP_442941.1_3 Forward -278 -268 19.2529 0.00262
NP_442941.1_3 Reverse -271 -281 11.4848 0.0116
NP_442941.1_3 Forward -159 -149 0.275027 0.222
NP_440289.1_2 Forward -282 -269 5.03416 0.0636
NP_440289.1_2 Reverse -267 -280 -3.52063 0.267
NP_442281.1_1 Reverse -265 -279 15.6336 0.0113
NP_442281.1_1 Forward -284 -270 11.7003 0.0438
NP_442281.1_1 Reverse -146 -160 2.75226 0.257
NP_441556.1_4 Reverse -232 -251 9.71588 0.297
NP_441556.1_7 Forward -176 -157 3.73524 0.263
NP_440498.1_1 Reverse -261 -279 8.57394 0.0786
NP_440498.1_1 Forward -169 -151 -3.91409 0.281
NP_441644.1_6 Forward -279 -269 19.0557 0.000803
NP_441644.1_6 Reverse -270 -280 10.1076 0.0628
NP_441644.1_6 Reverse -151 -161 6.0761 0.167
NP_441644.1_6 Reverse -241 -251 3.61784 0.272
NP_441644.1_10 Reverse -59 -69 16.1063 0.286
NP_442215.1_2 Reverse -136 -152 -3.77637 0.222
NP_442215.1_2 Forward -162 -146 -6.43131 0.271
NP_442029.1_6 Reverse -265 -284 11.8975 0.155
NP_442247.1_5 Reverse -224 -238 14.1999 0.264
NP_440253.1_2 Reverse -270 -288 2.47742 0.137
NP_440929.1_8 Forward -279 -270 19.2726 0.000701
NP_440929.1_8 Reverse -270 -279 19.2726 0.000701
NP_442933.1_10 Forward -279 -270 17.601 0.00325
NP_442933.1_10 Reverse -270 -279 17.601 0.00325
NP_441751.2_8 Forward -278 -264 5.1128 0.0448
NP_441751.2_8 Reverse -271 -285 -1.77037 0.13
NP_442554.1_8 Forward -278 -268 17.2863 0.00543
NP_442554.1_8 Reverse -271 -281 13.8447 0.0145
NP_442554.1_8 Forward -159 -149 5.28991 0.153
NP_442554.1_8 Reverse -152 -162 2.83163 0.253
NP_442554.1_8 Forward -22 -12 2.83163 0.253
NP_441586.1_6 Forward -162 -143 3.34271 0.277
NP_441762.1_7 Reverse -269 -281 2.98891 0.0676
NP_441762.1_7 Forward -280 -268 2.30059 0.0676
NP_442142.1_4 Forward -282 -269 17.7182 0.0255
NP_442142.1_4 Reverse -267 -280 15.4566 0.0264
NP_442142.1_4 Reverse -148 -161 4.64028 0.214
NP_442292.1_1 Forward -278 -269 17.5026 0.00435
NP_442292.1_1 Reverse -271 -280 9.63616 0.0183
NP_442292.1_1 Forward -159 -150 5.70292 0.135
NP_440919.1_7 Reverse -69 -87 5.64375 0.285
NP_442476.1_6 Forward -278 -264 2.35953 0.186
NP_440895.1_6 Reverse -264 -277 9.16406 0.228
NP_442381.1_8 Forward -282 -263 -12.9802 0.267
NP_442381.1_8 Reverse -259 -278 -14.6519 0.284
NP_441523.1_6 Forward -283 -264 5.01433 0.245
NP_441523.1_6 Reverse -266 -285 4.42435 0.252
NP_443009.1_5 Reverse -269 -280 19.626 0.00102
NP_443009.1_5 Forward -280 -269 7.82632 0.118
NP_443009.1_5 Reverse -374 -385 3.99143 0.268
NP_442741.1_1 Reverse -310 -329 5.40766 0.184
NP_441715.1_4 Forward -278 -268 16.7946 0.0106
NP_441715.1_4 Reverse -271 -281 16.303 0.0117
NP_440357.1_3 Reverse -238 -257 0.687771 0.28
NP_440183.1_9 Reverse -100 -119 -16.5201 0.276
NP_440379.1_5 Reverse -255 -274 -2.0655 0.194
NP_441468.1_1 Forward -278 -271 15.8704 0.0124
NP_441468.1_1 Reverse -271 -278 15.8704 0.0124
NP_441468.1_1 Reverse -152 -159 4.07068 0.263
NP_441020.2_6 Forward -281 -264 6.43035 0.262
NP_441015.1_10 Reverse -265 -284 1.67108 0.158
NP_441673.1_1 Forward -279 -270 20.8459 0.000698
NP_441673.1_1 Reverse -270 -279 20.8459 0.000698
NP_441826.1_2 Reverse -145 -159 3.93283 0.105
NP_441826.1_2 Forward -285 -271 3.93283 0.105
NP_441330.1_1 Reverse -265 -284 5.11266 0.0304
NP_442490.1_9 Forward -291 -272 -5.80207 0.273
NP_442868.1_6 Reverse -268 -278 10.4031 0.038
NP_442868.1_6 Forward -281 -271 0.963343 0.205
NP_442719.1_2 Reverse -89 -107 -11.0929 0.287
NP_441251.1_8 Forward -96 -83 11.3298 0.27
NP_442808.1_1 Forward -280 -270 18.4657 0.00201
NP_442808.1_1 Reverse -269 -279 8.73102 0.0481
NP_441101.1_10 Forward -173 -154 -7.57203 0.29
NP_440145.1_3 Forward -289 -270 -1.08219 0.146
NP_440145.1_3 Reverse -260 -279 -5.9004 0.282
NP_442542.1_2 Reverse -239 -252 14.3756 0.114
NP_442050.1_5 Reverse -268 -278 15.9091 0.0091
NP_442050.1_5 Forward -281 -271 9.12434 0.193
NP_440558.1_2 Forward -169 -150 3.44104 0.156
NP_440558.1_2 Reverse -261 -280 -1.47551 0.214
NP_440558.1_2 Reverse -153 -172 -5.60541 0.262
NP_442789.1_4 Reverse -12 -31 -3.04881 0.246
NP_441878.1_6 Reverse -269 -279 10.5014 0.0176
NP_441878.1_6 Forward -280 -270 10.4031 0.0176
NP_441878.1_6 Reverse -240 -250 -6.70647 0.194
NP_441878.1_6 Reverse -374 -384 -7.0998 0.204
NP_441036.1_8 Forward -280 -270 17.7779 0.000554
NP_441036.1_8 Reverse -269 -279 15.713 0.00724
NP_441534.1_5 Forward -103 -84 0.491109 0.293
NP_441557.1_5 Forward -279 -270 19.9609 0.000699
NP_441557.1_5 Reverse -270 -279 19.9609 0.000699
NP_441445.1_1 Reverse -366 -385 0.982764 0.264
NP_441445.1_1 Reverse -5 -24 -0.197208 0.286
NP_441433.1_8 Forward -153 -134 8.45592 0.161
NP_442777.1_3 Forward -167 -149 6.31156 0.224
NP_442419.1_2 Reverse -265 -284 0.294447 0.243
NP_441308.1_8 Forward -281 -271 10.1081 0.22
NP_440101.1_3 Reverse -265 -284 1.86774 0.267
NP_440101.1_5 Forward -286 -267 3.83436 0.196
NP_442183.1_1 Reverse -270 -284 9.93102 0.0903
NP_442183.1_1 Forward -279 -265 5.40779 0.218
NP_441574.1_1 Reverse -363 -382 0.294447 0.196
NP_442347.1_2 Reverse -271 -280 11.1111 0.056
NP_442347.1_2 Forward -278 -269 3.34298 0.284
NP_442645.1_2 Reverse -262 -281 -22.0267 0.29
NP_442645.1_2 Forward -162 -143 -22.0267 0.29
NP_441037.1_4 Reverse -268 -278 7.22024 0.237
NP_441037.1_4 Forward -281 -271 7.02532 0.237
NP_442594.1_8 Reverse -201 -220 5.50599 0.247
NP_442317.1_6 Forward -45 -26 3.34271 0.263
NP_442317.1_6 Forward -389 -370 3.14605 0.264
NP_441633.1_3 Reverse -268 -281 3.5592 0.0699
NP_441633.1_3 Forward -386 -373 2.2809 0.1
NP_441633.1_3 Forward -281 -268 -3.81562 0.177
NP_440136.1_2 Forward -278 -271 15.9687 0.0123
NP_440136.1_2 Reverse -271 -278 15.9687 0.0123
NP_442998.1_10 Forward -277 -270 15.5754 0.0102
NP_442998.1_10 Reverse -272 -279 15.5754 0.0102
NP_440899.1_1 Forward -171 -152 10.2617 0.187
NP_440299.1_1 Forward -283 -270 20.1765 0.00128
NP_440299.1_1 Forward -254 -241 5.42692 0.176
NP_441799.1_1 Reverse -266 -280 16.9119 0.0128
NP_441799.1_1 Forward -283 -269 5.01387 0.227
NP_442802.1_2 Forward -400 -381 14.8466 0.212
NP_441007.1_10 Reverse -265 -278 3.36254 0.182
NP_440256.1_1 Forward -282 -263 6.09597 0.0316
NP_440256.1_1 Reverse -267 -286 3.44104 0.0523
NP_440256.1_1 Forward -163 -144 -0.787193 0.0961
NP_441559.1_8 Forward -284 -270 11.996 0.0574
NP_441559.1_8 Reverse -265 -279 1.57289 0.155
NP_441559.1_8 Reverse -156 -170 -7.57189 0.295
NP_440915.1_6 Forward -283 -269 14.7492 0.0183
NP_440915.1_6 Reverse -266 -280 1.08123 0.147
NP_442158.1_4 Forward -231 -221 10.7964 0.283
NP_441866.1_4 Forward -300 -287 14.5093 0.273
NP_442866.1_1 Reverse -155 -174 -2.65548 0.214
NP_440748.1_5 Forward -163 -144 6.88262 0.188
NP_440748.1_5 Reverse -147 -166 -1.18052 0.267
NP_440748.1_5 Reverse -261 -280 -1.86883 0.27
NP_441464.1_8 Forward -384 -370 10.6193 0.178
NP_440026.1_4 Reverse -267 -286 9.0459 0.259
NP_440026.1_7 Reverse -265 -280 17.4828 0.159
NP_441939.1_3 Forward -278 -259 16.3224 0.0401
NP_441199.1_6 Forward -283 -264 4.81767 0.159
NP_442993.1_1 Reverse -270 -286 2.12349 0.0502
NP_442993.1_1 Forward -279 -263 -11.1512 0.235
NP_442386.1_9 Forward -280 -271 15.7322 0.0144
NP_442386.1_9 Reverse -269 -278 6.39082 0.219
NP_441340.1_5 Forward -278 -271 15.6737 0.0124
NP_441340.1_5 Reverse -271 -278 15.6737 0.0124
NP_441340.1_5 Forward -159 -152 3.97235 0.274
NP_442484.1_2 Reverse -259 -278 -1.67217 0.295
NP_440597.1_1 Forward -337 -318 15.0441 0.232
NP_440586.1_8 Forward -278 -271 13.2151 0.026
NP_440586.1_8 Reverse -271 -278 13.2151 0.026
NP_440586.1_8 Forward -159 -152 9.57686 0.146
NP_442251.1_6 Forward -278 -271 15.2804 0.0124
NP_442251.1_6 Reverse -271 -278 15.2804 0.0124
NP_441262.1_3 Reverse -270 -277 14.7888 0.0223
NP_441262.1_3 Forward -279 -272 14.7888 0.0223
NP_443051.1_1 Reverse -269 -278 19.5676 0.00335
NP_443051.1_1 Forward -280 -271 10.4228 0.00754
NP_439937.1_9 Reverse -269 -286 -8.61494 0.176
NP_439937.1_9 Forward -326 -309 -12.9415 0.278
NP_442374.1_3 Reverse -90 -107 12.4285 0.269
NP_440439.1_1 Reverse -267 -280 18.1122 0.0105
NP_440439.1_1 Forward -282 -269 15.2606 0.0137
NP_439943.1_7 Forward -284 -265 7.07928 0.208
NP_440372.1_2 Forward -278 -271 16.3621 0.0124
NP_440372.1_2 Reverse -271 -278 16.3621 0.0124
NP_440574.1_3 Forward -165 -146 10.5209 0.142
NP_441803.1_2 Reverse -265 -284 -1.08219 0.294
NP_439977.1_5 Reverse -264 -283 4.32602 0.153
NP_440139.1_1 Reverse -264 -283 7.27514 0.134
NP_441572.1_7 Forward -285 -266 5.89931 0.0856
NP_441572.1_7 Reverse -264 -283 -5.21209 0.253
NP_440267.1_2 Reverse -265 -279 12.5853 0.125
NP_442384.1_10 Reverse -270 -283 15.7522 0.00946
NP_442384.1_10 Forward -279 -266 9.95071 0.047
NP_442384.1_10 Reverse -160 -173 4.14919 0.167
NP_442790.1_4 Forward -288 -269 -13.8652 0.268
NP_442262.1_10 Forward -278 -271 14.1988 0.0123
NP_442262.1_10 Reverse -271 -278 14.1988 0.0123
NP_441689.1_5 Forward -281 -271 8.53436 0.132
NP_441689.1_5 Reverse -268 -278 8.3377 0.132
NP_442244.1_6 Reverse -252 -271 4.81767 0.287
NP_440163.1_10 Forward -282 -272 16.303 0.0762
NP_440344.1_10 Forward -286 -269 3.28376 0.0273
NP_440344.1_10 Reverse -263 -280 -9.59759 0.15
NP_440282.1_10 Reverse -260 -279 -5.11376 0.25
NP_440282.1_10 Forward -170 -151 -10.0303 0.29
NP_442123.1_3 Forward -279 -260 10.8159 0.269
NP_440487.1_1 Reverse -267 -286 -4.13045 0.214
NP_441965.1_10 Forward -282 -266 2.51681 0.287
NP_441640.1_8 Reverse -271 -290 7.47261 0.11
NP_440297.1_9 Reverse -271 -281 9.32148 0.0917
NP_440297.1_9 Forward -278 -268 -0.216628 0.282
NP_440297.1_9 Forward -159 -149 -0.216628 0.282
NP_440297.1_9 Reverse -152 -162 -0.511621 0.289
NP_442280.1_1 Reverse -310 -329 3.24438 0.287
NP_441896.1_3 Forward -288 -269 1.27776 0.218
NP_440999.1_9 Forward -283 -269 10.6193 0.0502
NP_440888.1_2 Reverse -270 -284 15.9285 0.00837
NP_440888.1_2 Forward -279 -265 11.5037 0.0657
NP_440888.1_2 Forward -333 -319 5.21053 0.288
NP_439969.1_3 Forward -284 -265 -0.688862 0.271
NP_442948.1_2 Reverse -269 -288 14.9458 0.106
NP_442948.1_2 Forward -280 -261 7.37428 0.229
NP_442277.1_4 Forward -393 -374 1.86696 0.264
NP_442033.1_10 Reverse -268 -287 -8.26035 0.193
NP_441543.1_2 Reverse -271 -280 18.486 0.00236
NP_441543.1_2 Forward -278 -269 15.9293 0.00518
NP_441543.1_2 Forward -159 -150 5.21127 0.209
NP_441543.1_3 Forward -220 -206 18.7801 0.163
NP_442845.1_2 Reverse -264 -278 4.81781 0.251
NP_442845.1_2 Forward -285 -271 3.63784 0.282
NP_442845.1_4 Reverse -268 -287 8.65258 0.185
NP_441551.1_5 Forward -283 -267 9.69426 0.207
NP_441319.1_8 Forward -285 -267 8.27895 0.233
NP_441469.1_8 Forward -280 -271 16.126 0.00797
NP_441469.1_8 Reverse -269 -278 6.5879 0.227
NP_443064.1_6 Forward -279 -269 10.8217 0.13
NP_442578.1_7 Forward -278 -271 14.5921 0.026
NP_442578.1_7 Reverse -271 -278 14.5921 0.026
NP_440710.1_1 Forward -258 -240 0.609134 0.161
NP_441462.1_2 Forward -279 -269 20.2362 0.000805
NP_441462.1_2 Reverse -270 -280 11.5831 0.00406
NP_441621.1_7 Forward -281 -267 4.32615 0.0934
NP_441621.1_7 Reverse -268 -282 -3.34366 0.188
NP_443062.1_1 Forward -279 -261 7.76586 0.168
NP_442204.1_1 Reverse -266 -277 11.3667 0.0565
NP_442204.1_1 Forward -283 -272 9.69511 0.0736
NP_442204.1_1 Reverse -306 -317 -0.236322 0.289
NP_442204.1_5 Forward -289 -270 5.11266 0.16
NP_440516.1_2 Forward -285 -267 5.23069 0.132
NP_440516.1_8 Forward -279 -270 16.9127 0.00442
NP_440516.1_8 Reverse -270 -279 16.9127 0.00442
NP_442428.1_5 Forward -278 -271 15.8704 0.0124
NP_442428.1_5 Reverse -271 -278 15.8704 0.0124
NP_442428.1_5 Reverse -152 -159 4.46401 0.267
NP_442428.1_8 Reverse -380 -399 -0.4922 0.274
NP_442859.1_2 Forward -284 -265 2.26107 0.28
NP_440673.1_2 Forward -295 -276 8.63366 0.264
NP_440673.1_3 Forward -277 -270 12.4288 0.0426
NP_440673.1_3 Reverse -272 -279 12.4288 0.0426
NP_440673.1_3 Reverse -100 -107 6.23397 0.283
NP_440865.1_9 Reverse -264 -283 8.06259 0.0657
NP_441052.1_2 Reverse -270 -280 10.5014 0.0285
NP_441052.1_2 Forward -279 -269 10.4031 0.0285
NP_441052.1_2 Reverse -241 -251 4.10993 0.166
NP_441052.1_2 Forward -256 -246 2.04498 0.22
NP_442219.1_9 Reverse -271 -280 8.35786 0.0681
NP_442219.1_9 Forward -278 -269 8.25953 0.0681
NP_440436.1_4 Reverse -271 -280 18.1905 0.00233
NP_440436.1_4 Forward -159 -150 11.0124 0.0655
NP_440436.1_4 Forward -278 -269 9.24241 0.0871
NP_441884.1_8 Forward -280 -261 -2.85214 0.141
NP_441884.1_9 Reverse -11 -30 -14.7502 0.138
NP_442086.1_3 Forward -278 -259 6.58763 0.285
NP_440689.1_1 Forward -325 -307 8.86894 0.297
NP_442907.1_9 Forward -284 -265 -6.39206 0.289
NP_441719.1_4 Forward -278 -271 16.3621 0.0124
NP_441719.1_4 Reverse -271 -278 16.3621 0.0124
NP_441733.1_10 Reverse -267 -280 5.82081 0.203
NP_441004.1_5 Reverse -372 -386 10.1277 0.248
NP_442366.1_3 Reverse -269 -287 6.90232 0.0773
NP_442873.1_3 Reverse -231 -250 4.52188 0.263
NP_441115.1_4 Reverse -269 -287 13.293 0.0827
NP_442206.1_1 Forward -250 -231 -12.6852 0.235
NP_442206.1_10 Reverse -151 -166 14.5329 0.0799
NP_442206.1_10 Reverse -270 -285 3.12649 0.191
NP_443054.1_2 Forward -41 -27 4.71948 0.24
NP_443054.1_2 Reverse -268 -282 1.08123 0.251
NP_441851.1_9 Forward -178 -159 19.5673 0.0617
NP_441851.1_10 Forward -280 -270 16.008 0.00552
NP_441851.1_10 Reverse -269 -279 8.53483 0.114
NP_441851.1_10 Reverse -150 -160 4.40493 0.271
NP_442622.1_1 Reverse -254 -273 -12.5869 0.27
NP_442622.1_5 Forward -281 -262 5.80098 0.0634
NP_442622.1_8 Forward -279 -261 -18.8604 0.285
NP_442856.1_8 Reverse -168 -186 13.3922 0.269
NP_442515.1_1 Forward -251 -237 3.24451 0.122
NP_442515.1_1 Forward -385 -371 1.96621 0.145
NP_440593.1_3 Reverse -307 -326 3.04771 0.164
NP_441349.1_10 Forward -289 -270 -1.96717 0.112
NP_441349.1_10 Reverse -260 -279 -2.45882 0.119
NP_441409.1_6 Forward -285 -266 21.9273 0.00394
NP_441409.1_6 Reverse -264 -283 -14.6519 0.263
NP_441394.1_7 Forward -394 -380 16.4209 0.299
NP_440432.1_9 Forward -278 -263 5.09311 0.0595
NP_442450.1_5 Forward -281 -271 9.32148 0.115
NP_442168.1_5 Forward -278 -259 4.62101 0.218
NP_440588.1_2 Forward -288 -269 13.9625 0.0175
NP_440588.1_2 Reverse -261 -280 -1.96717 0.158
NP_440588.1_2 Forward -393 -374 -4.13045 0.207
NP_441570.1_1 Forward -279 -261 0.609134 0.0379
NP_441570.1_1 Forward -160 -142 -10.3056 0.166
NP_440078.1_10 Reverse -270 -289 5.40766 0.226
NP_441078.1_4 Forward -279 -270 19.6659 0.0007
NP_441078.1_4 Reverse -270 -279 19.6659 0.0007
NP_441078.1_4 Reverse -241 -250 6.39124 0.0775
NP_441078.1_4 Reverse -375 -384 -1.08191 0.222
NP_441078.1_4 Forward -384 -375 -1.6719 0.266
NP_441078.1_4 Forward -250 -241 -1.77023 0.266
NP_441078.1_4 Reverse -151 -160 -2.06522 0.295
NP_442729.1_8 Forward -283 -270 8.08242 0.125
NP_442729.1_8 Reverse -213 -226 6.90245 0.173
NP_442443.1_4 Reverse -289 -299 15.1225 0.179
NP_440793.1_1 Reverse -347 -361 11.4053 0.279
NP_441094.1_5 Reverse -348 -367 22.056 0.13
NP_440526.1_3 Forward -159 -148 8.61296 0.118
NP_441432.1_8 Reverse -269 -278 16.8143 0.00595
NP_441432.1_8 Forward -280 -271 8.25953 0.0755
NP_441432.1_8 Reverse -150 -159 4.32629 0.223
NP_442320.1_8 Forward -285 -271 7.17775 0.0207
NP_442320.1_8 Reverse -264 -278 -0.983719 0.0817
NP_441732.1_2 Forward -283 -267 -7.51295 0.0859
NP_441732.1_2 Reverse -266 -282 -16.2644 0.165
NP_442815.1_2 Forward -395 -377 7.29564 0.205
NP_440760.1_1 Forward -279 -260 -20.3551 0.222
NP_440760.1_1 Forward -384 -365 -20.65 0.224
NP_442353.1_4 Forward -156 -137 2.35861 0.234
NP_440713.1_3 Forward -112 -93 8.84924 0.191
NP_440713.1_4 Reverse -260 -279 11.4058 0.115
NP_442489.1_7 Forward -279 -270 20.1576 0.000695
NP_442489.1_7 Reverse -270 -279 20.1576 0.000695
NP_442489.1_7 Reverse -241 -250 -1.37691 0.195
NP_442489.1_7 Reverse -151 -160 -1.37691 0.195
NP_442489.1_7 Reverse -375 -384 -2.06522 0.288
NP_442079.1_7 Reverse -271 -290 2.3594 0.229
NP_440559.1_1 Reverse -271 -280 8.75118 0.0586
NP_440559.1_1 Forward -278 -269 8.65285 0.0586
NP_441659.2_8 Forward -279 -269 20.9245 0.000805
NP_441659.2_8 Reverse -270 -280 11.9764 0.0147
NP_441659.2_8 Forward -160 -150 3.22496 0.169
NP_442913.1_10 Reverse -142 -161 -4.32711 0.234
NP_441040.1_5 Reverse -140 -159 3.6377 0.269
NP_442849.1_1 Reverse -197 -211 8.35772 0.282
NP_439956.1_7 Reverse -357 -376 4.916 0.257
NP_442776.1_1 Reverse -259 -278 15.4374 0.0822
NP_442776.1_1 Forward -180 -161 2.94938 0.294
NP_442346.1_2 Reverse -265 -284 5.70265 0.281
NP_442346.1_5 Reverse -269 -279 16.303 0.00248
NP_442346.1_5 Forward -280 -270 9.02648 0.118
NP_442346.1_5 Forward -108 -98 7.94484 0.152
NP_442346.1_5 Reverse -74 -84 6.46988 0.201
NP_442346.1_5 Reverse -150 -160 4.89658 0.269
NP_442346.1_5 Forward -161 -151 4.3066 0.291
NP_442346.1_5 Reverse -254 -264 4.20827 0.296
NP_442346.1_10 Reverse -155 -174 -3.14714 0.294
NP_440545.1_3 Reverse -266 -283 12.8219 0.0194
NP_440545.1_3 Forward -283 -266 -1.63279 0.171
NP_441653.1_2 Reverse -259 -278 3.81952 0.264
NP_440010.1_4 Reverse -266 -285 -0.00131823 0.25
NP_440010.1_10 Reverse -154 -173 2.75272 0.272
NP_442603.1_7 Reverse -270 -284 10.6187 0.125
NP_441888.1_7 Forward -284 -270 3.8345 0.225
NP_441948.1_4 Reverse -321 -339 -5.88071 0.279
NP_441833.1_4 Forward -278 -271 15.9687 0.0124
NP_441833.1_4 Reverse -271 -278 15.9687 0.0124
NP_441895.1_2 Reverse -194 -213 -26.8449 0.256
NP_441895.1_2 Reverse -193 -212 -26.8449 0.256
NP_441895.1_10 Reverse -288 -307 -18.8801 0.282
NP_442162.1_9 Forward -278 -271 16.2637 0.0124
NP_442162.1_9 Reverse -271 -278 16.2637 0.0124
NP_440671.1_4 Forward -285 -271 19.4691 0.00937
NP_440671.1_4 Reverse -264 -278 7.07942 0.227
NP_440671.1_4 Reverse -145 -159 5.70279 0.275
NP_440671.1_9 Forward -57 -44 18.5055 0.159
NP_440224.1_1 Reverse -259 -278 0.884433 0.132
NP_442073.1_6 Reverse -261 -280 1.17943 0.25
NP_442546.1_2 Forward -303 -284 1.86696 0.287
NP_442199.1_5 Reverse -262 -281 11.1109 0.0558
NP_442140.1_3 Reverse -271 -281 8.33817 0.119
NP_442140.1_3 Forward -278 -268 4.69992 0.238
NP_440875.1_9 Forward -277 -267 16.5483 0.0145
NP_440875.1_9 Reverse -272 -282 9.05339 0.233
NP_440875.1_9 Forward -163 -153 7.98268 0.251
NP_441813.1_5 Reverse -268 -278 18.1713 0.00743
NP_441813.1_5 Forward -281 -271 17.188 0.00979
NP_439901.1_1 Reverse -15 -34 7.86593 0.235
NP_440590.1_4 Reverse -271 -284 6.80412 0.0565
NP_440590.1_4 Forward -278 -265 -5.38892 0.277
NP_440567.1_1 Reverse -271 -285 7.86607 0.0642
NP_440567.1_1 Forward -278 -264 2.94952 0.157
NP_442497.1_10 Forward -278 -269 17.601 0.00813
NP_442497.1_10 Reverse -271 -280 10.4228 0.0087
NP_440821.1_4 Forward -281 -271 19.0562 0.00399
NP_440821.1_4 Reverse -268 -278 2.24165 0.131
NP_441239.1_9 Reverse -268 -280 15.5753 0.0186
NP_441239.1_9 Forward -281 -269 13.3137 0.037
NP_441727.1_3 Reverse -263 -282 2.85105 0.299
NP_441892.1_1 Reverse -261 -278 -5.76269 0.288
NP_442270.1_9 Reverse -140 -159 -11.7019 0.277
NP_442643.1_1 Forward -285 -266 -11.0136 0.231
NP_440833.1_6 Forward -77 -63 8.16044 0.277
NP_442138.1_10 Forward -279 -260 -7.76869 0.291
NP_441119.1_7 Reverse -214 -233 5.01433 0.233
NP_440412.1_2 Forward -161 -142 9.63589 0.281
NP_441782.1_5 Reverse -262 -281 6.88262 0.287
NP_442284.1_5 Reverse -226 -240 16.2235 0.294
NP_440546.1_4 Forward -279 -269 13.5365 0.0459
NP_440546.1_4 Reverse -270 -280 11.8882 0.0679
NP_440546.1_4 Reverse -75 -85 6.65249 0.288
NP_441230.1_5 Reverse -265 -284 9.83255 0.115
NP_441230.1_5 Forward -37 -18 -1.08219 0.298
NP_440462.1_6 Reverse -268 -278 18.7612 0.00454
NP_440462.1_6 Forward -281 -271 15.418 0.0142
NP_442611.1_1 Reverse -270 -289 4.12936 0.197
NP_440868.1_4 Reverse -266 -278 14.7886 0.0169
NP_440868.1_4 Forward -283 -271 8.6921 0.0582
NP_441474.1_1 Reverse -260 -279 1.57197 0.247
NP_441474.1_1 Forward -220 -201 -2.95123 0.29
NP_442402.1_1 Forward -297 -278 9.14423 0.271
NP_442402.1_9 Reverse -205 -224 11.8975 0.233
NP_442402.1_9 Reverse -364 -383 11.0125 0.242
NP_442258.1_1 Forward -158 -139 15.1424 0.0339
NP_441084.1_6 Reverse -190 -204 12.5437 0.16
NP_440653.1_10 Reverse -145 -164 7.47261 0.203
NP_441843.2_9 Forward -374 -356 12.0482 0.205
NP_442923.1_6 Forward -359 -345 10.8977 0.268
NP_442039.1_4 Forward -278 -271 15.1821 0.0124
NP_442039.1_4 Reverse -271 -278 15.1821 0.0124
NP_442696.1_2 Reverse -177 -195 8.27895 0.295
NP_442696.1_6 Forward -222 -203 5.80098 0.0698
NP_442837.1_3 Forward -278 -271 15.7721 0.0124
NP_442837.1_3 Reverse -271 -278 15.7721 0.0124
NP_440160.1_9 Forward -75 -56 7.47261 0.291
NP_439994.1_1 Reverse -368 -387 8.35759 0.271
NP_439994.1_3 Reverse -269 -288 9.31652 0.253
NP_442053.1_1 Forward -279 -270 18.3876 0.0007
NP_442053.1_1 Reverse -270 -279 18.3876 0.0007
NP_440505.1_3 Reverse -268 -278 17.188 0.00332
NP_440505.1_3 Forward -281 -271 13.8447 0.0247
NP_441203.1_1 Reverse -271 -290 -9.44032 0.137
NP_440914.1_1 Forward -279 -269 16.3248 0.00196
NP_440914.1_1 Reverse -151 -161 11.3477 0.097
NP_440914.1_1 Reverse -270 -280 8.6151 0.186
NP_440914.1_1 Reverse -145 -155 8.12715 0.207
NP_441011.1_8 Reverse -271 -280 16.9127 0.00602
NP_441011.1_8 Forward -278 -269 16.6177 0.00602
NP_442533.1_1 Reverse -204 -223 -15.5368 0.256
NP_442533.1_6 Forward -279 -270 17.2076 0.00137
NP_442533.1_6 Reverse -270 -279 17.2076 0.00137
NP_442533.1_6 Reverse -241 -250 4.91628 0.165
NP_442535.1_9 Forward -288 -270 -4.20908 0.275
NP_441482.1_7 Reverse -264 -278 6.58777 0.0271
NP_441482.1_7 Forward -285 -271 0.589577 0.0554
NP_439944.1_9 Reverse -271 -281 10.3048 0.0887
NP_439944.1_9 Forward -278 -268 9.12481 0.1
NP_439944.1_9 Forward -159 -149 7.45319 0.141
NP_441697.1_5 Reverse -121 -140 -10.4568 0.279
NP_441527.1_4 Forward -141 -122 -9.2154 0.255
NP_441527.1_4 Reverse -285 -304 -12.2711 0.285
NP_440115.1_6 Reverse -267 -277 14.0414 0.0615
NP_440007.1_4 Reverse -259 -278 12.9791 0.204
NP_440007.1_9 Reverse -147 -161 12.1926 0.163
NP_440007.1_9 Forward -283 -269 4.32615 0.267
NP_440007.1_9 Reverse -238 -252 3.8345 0.267
NP_441347.1_5 Reverse -264 -278 12.782 0.238
NP_441602.1_8 Reverse -230 -249 17.994 0.111
NP_441972.1_5 Forward -278 -259 -8.85033 0.272
NP_441106.1_1 Reverse -269 -278 18.486 0.0028
NP_441106.1_1 Forward -280 -271 18.191 0.0028
NP_441106.1_1 Reverse -150 -159 3.14632 0.243
NP_441869.1_9 Forward -33 -14 15.8307 0.219
NP_442306.1_10 Forward -389 -370 -11.9969 0.159
NP_441186.1_3 Forward -346 -327 13.7649 0.242
NP_441286.1_1 Reverse -269 -281 5.05386 0.0259
NP_441286.1_1 Forward -161 -149 -1.73098 0.145
NP_441286.1_1 Forward -280 -268 -3.59927 0.145
NP_441286.1_1 Forward -24 -12 -5.95921 0.235
NP_442674.1_2 Reverse -93 -112 11.1109 0.208
NP_440670.1_8 Forward -279 -270 18.3876 0.000699
NP_440670.1_8 Reverse -270 -279 18.3876 0.000699
NP_440670.1_8 Reverse -151 -160 4.91628 0.179
NP_441479.1_1 Reverse -205 -224 6.29264 0.298
NP_440886.1_7 Forward -280 -270 17.7774 0.0011
NP_440886.1_7 Reverse -269 -279 8.04271 0.0805
NP_440886.1_7 Forward -385 -375 4.89613 0.213
NP_440828.1_4 Forward -176 -157 -5.80282 0.258
NP_442614.1_2 Forward -108 -94 9.5377 0.242
NP_439995.1_5 Forward -289 -270 5.60432 0.276
NP_441808.1_8 Reverse -154 -173 10.7175 0.231
NP_440907.2_8 Forward -278 -268 9.616 0.103
NP_440907.2_8 Reverse -271 -281 7.84605 0.117
NP_441463.1_2 Forward -57 -39 -1.1671 0.293
NP_441463.1_3 Reverse -260 -279 6.4893 0.0616
NP_441463.1_3 Forward -164 -145 -9.34199 0.278
NP_441463.1_3 Reverse -146 -165 -10.0303 0.288
NP_441626.1_2 Forward -278 -271 15.7721 0.0124
NP_441626.1_2 Reverse -271 -278 15.7721 0.0124
NP_442211.1_3 Forward -165 -146 9.12548 0.261
NP_442365.1_7 Forward -254 -235 -5.80207 0.279
NP_442794.1_1 Forward -283 -271 10.1671 0.0721
NP_442794.1_1 Reverse -147 -159 6.33216 0.185
NP_442615.1_1 Forward -288 -270 3.46073 0.0542
NP_442615.1_1 Reverse -261 -279 -0.374176 0.115
NP_440387.1_1 Reverse -270 -286 6.64671 0.0282
NP_440387.1_1 Forward -250 -234 -5.93965 0.258
NP_440387.1_1 Reverse -151 -167 -6.33298 0.279
NP_441431.1_2 Reverse -267 -281 7.27547 0.244
NP_441836.1_2 Reverse -235 -254 -2.16383 0.226
NP_440634.1_1 Reverse -268 -287 11.4058 0.287
NP_441993.1_1 Reverse -241 -260 2.53143 0.257
NP_441993.1_1 Forward -285 -266 0.874656 0.29
NP_440814.1_3 Reverse -222 -241 20.059 0.0113
NP_440467.1_8 Forward -172 -153 17.109 0.0964
NP_440114.1_10 Forward -279 -265 12.1926 0.0885
NP_440114.1_10 Reverse -23 -37 9.73436 0.164
NP_441425.1_6 Forward -150 -140 16.7946 0.223
NP_442698.1_10 Reverse -279 -298 3.6377 0.279
NP_441272.1_4 Reverse -238 -257 1.76941 0.241
NP_440293.1_3 Reverse -367 -386 1.96607 0.206
NP_440293.1_3 Reverse -58 -77 -5.60541 0.28
NP_440293.1_9 Reverse -208 -222 9.89475 0.285
NP_440766.1_4 Forward -283 -269 8.16106 0.0871
NP_442743.1_1 Forward -211 -192 9.34008 0.262
NP_442743.1_5 Forward -201 -182 4.42435 0.217
NP_439910.1_2 Forward -287 -270 -12.4492 0.0863
NP_439910.1_2 Reverse -262 -279 -22.184 0.215
NP_440457.1_1 Forward -283 -271 8.29878 0.101
NP_440457.1_1 Reverse -266 -278 0.727295 0.25
NP_440213.1_4 Forward -254 -235 19.6299 0.216
NP_440798.1_6 Forward -278 -265 0.707601 0.251
NP_442680.1_5 Reverse -280 -299 1.92835 0.237
NP_440801.1_5 Forward -54 -40 19.8624 0.101
NP_440801.1_9 Forward -204 -190 20.4949 0.0607
NP_440801.1_10 Forward -173 -154 22.0256 0.101
NP_441984.1_3 Reverse -237 -255 5.32902 0.287
NP_440473.1_1 Reverse -267 -286 16.1741 0.109
NP_442509.1_9 Reverse -270 -280 16.2041 0.00739
NP_442509.1_9 Forward -279 -269 8.04271 0.192
NP_442439.1_8 Forward -257 -238 9.73422 0.253
NP_440554.1_4 Forward -278 -268 17.9746 0.0131
NP_440554.1_4 Reverse -271 -281 14.6313 0.02
NP_442862.1_3 Reverse -353 -370 9.28195 0.226
NP_442862.1_3 Forward -57 -40 6.52869 0.263
NP_441885.1_5 Reverse -270 -280 11.4848 0.00668
NP_441885.1_5 Forward -279 -269 11.3864 0.00668
NP_441885.1_5 Reverse -241 -251 0.471689 0.145
NP_440478.1_10 Forward -281 -267 6.3911 0.291
NP_440478.1_10 Reverse -239 -253 6.29277 0.292
NP_442341.1_7 Reverse -269 -283 9.34103 0.0751
NP_442341.1_9 Reverse -268 -282 13.6669 0.0783
NP_442341.1_9 Forward -162 -148 5.60385 0.263
NP_442341.1_9 Forward -281 -267 5.50552 0.267
NP_441756.1_5 Forward -283 -264 4.81767 0.193
NP_441173.1_9 Forward -205 -197 14.0803 0.17
NP_442395.2_4 Reverse -269 -288 0.686995 0.262
NP_443000.1_7 Reverse -268 -278 20.3345 0.00223
NP_443000.1_7 Forward -281 -271 8.73149 0.0437
NP_443000.1_7 Reverse -253 -263 2.24165 0.226
NP_440275.1_3 Reverse -268 -278 16.1063 0.0155
NP_440275.1_3 Forward -281 -271 8.4365 0.0602
NP_442932.1_9 Reverse -279 -298 3.34271 0.3
NP_440091.1_1 Forward -283 -271 1.41561 0.197
NP_443060.1_2 Reverse -260 -279 1.47442 0.282
NP_441902.1_3 Forward -149 -139 13.2732 0.23
NP_440679.1_10 Reverse -153 -172 -11.2103 0.182
NP_441359.1_5 Forward -400 -381 8.75091 0.162
NP_439962.1_4 Reverse -380 -399 -7.76869 0.29
NP_440149.1_8 Forward -279 -260 -2.36049 0.168
NP_441105.1_3 Reverse -259 -278 -3.24547 0.175
NP_441105.1_3 Forward -290 -271 -4.72043 0.204
NP_440216.1_1 Forward -279 -265 15.1426 0.00419
NP_440216.1_1 Reverse -270 -284 -2.16369 0.0482
NP_440172.1_1 Forward -279 -269 17.5813 0.00421
NP_440172.1_1 Reverse -270 -280 8.73149 0.0586
NP_442015.1_10 Forward -283 -270 19.1938 0.00444
NP_442015.1_10 Reverse -266 -279 3.75586 0.178
NP_441226.1_7 Forward -278 -271 14.4934 0.0123
NP_441226.1_7 Reverse -271 -278 14.4934 0.0123
NP_441757.1_2 Forward -353 -335 6.31233 0.289
NP_441111.1_7 Forward -278 -270 18.7023 0.00294
NP_441111.1_7 Reverse -271 -279 18.7023 0.00294
NP_441766.1_2 Forward -279 -270 17.5026 0.00297
NP_441766.1_2 Reverse -270 -279 17.5026 0.00297
NP_442417.1_5 Reverse -270 -284 12.1926 0.0981
NP_440416.1_1 Forward -279 -260 -2.26216 0.116
NP_440416.1_9 Forward -286 -267 -4.52377 0.0776
NP_440416.1_9 Forward -296 -277 -16.0285 0.206
NP_440416.1_9 Reverse -263 -282 -16.5201 0.216
NP_443052.1_8 Forward -289 -270 -13.2752 0.279
NP_442154.1_1 Reverse -205 -223 -16.1071 0.232
NP_442226.1_1 Forward -203 -184 11.2092 0.281
NP_440261.1_5 Forward -278 -265 -2.83231 0.0932
NP_440261.1_5 Reverse -271 -284 -2.93064 0.0983
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCCCGCATTGATGCCGGCAATAACCCAATCCACTTCTGGATAAAAATGAACTACTCCCAACCGGGTACAGTCCGCCGGAGTGCCGTCCACTGCGTAACGATTTTTGCCTCTTTGTTCCACGGCGATCGCCTGGTCAGTGGTCACCTTATGGCCACAGCCGGAATGTTGATTTTTGGGAGCCACCCACACCCCCCTTTTACCAAGGGCTTCATAGAGAGCTTCAATACCAGGGGCATCAATGCCATCGTCATTGGTGAGCAAAAAATTCATAGGATGTGTAACTAGTCAAACGGGCAACGGTAAGCAAACCTTTTAAACCATAGCGAAAATTGTCCAGGCCGTGATTTTGTTAAGATGTAGTCCAAGACCCCATTGTTGAGATAGGCCCGTAGAACGTCC

CDS

ATGACTGCCACCATCCTCGTTGAAAAGCAAAAAGTTGATCGTCCCCCTTTAGAACTTCATTACCTAGGGGACAAGGTGCTCCGACAACCGGCCAAGCGCATTGCCAAGGTGGATGACAGCATTCGCAAATTGGCCAAGGAGATGTTGCAGACTATGTACAGTGCCAATGGTATCGGGTTGGCTGCTCCCCAGGTGGGTATTAACAAACAACTTTTGGTGGTGGATTGTGAACAGGATAAGCCCGATGAACCGCCTTTGATTATGATTAATCCCCAAATTACCCGCACTAGCGAAGAACTTTGTGTGGTGGAAGAGGGTTGTCTGAGTGTGCCCAATGTTTACATGGATGTGACCCGGCCCCGGGCGATCGAAGTGACCTACAAAGATGAGCATGGCCGGCCCCAAAAACGCCTTTTTGCTGAGCTAACCGCCAGGGTAATTCAACATGAAATGGACCATCTGAATGGGGTTATGTTTGTGGACCGGGTGGATAATCCTTTAGCCTTAGCAGAATCTTTGAAGAAAGAAGGTTTTTCTATGCAGGCGGTTAAGCCCGTCGCTTGA

Protein

MTATILVEKQKVDRPPLELHYLGDKVLRQPAKRIAKVDDSIRKLAKEMLQTMYSANGIGLAAPQVGINKQLLVVDCEQDKPDEPPLIMINPQITRTSEELCVVEEGCLSVPNVYMDVTRPRAIEVTYKDEHGRPQKRLFAELTARVIQHEMDHLNGVMFVDRVDNPLALAESLKKEGFSMQAVKPVA