Your browser is old and dusty. Try Google Chrome!

Details for slr1547

ORF slr1547
Accession NP_440793.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -214 -228 -0.688726 0.237
NP_441061.1_2 Forward -339 -325 -2.06536 0.281
NP_441418.1_6 Forward -150 -131 -2.65548 0.0201
NP_441418.1_6 Forward -234 -215 -18.5851 0.0832
NP_441418.1_6 Forward -237 -218 -20.1584 0.106
NP_441418.1_6 Forward -231 -212 -29.4015 0.224
NP_442291.1_5 Reverse -140 -156 -4.95634 0.292
NP_441453.1_4 Forward -150 -142 6.70593 0.121
NP_441623.1_1 Forward -346 -328 7.39397 0.139
NP_442877.1_3 Reverse -205 -224 18.7798 0.0467
NP_442151.1_6 Forward -68 -54 5.60446 0.27
NP_442151.1_6 Reverse -213 -227 5.30946 0.284
NP_441818.1_6 Reverse -134 -148 10.7177 0.266
NP_441818.1_9 Forward -233 -214 -9.24366 0.288
NP_441818.1_9 Forward -259 -240 -11.0136 0.3
NP_441818.1_9 Forward -230 -211 -11.0136 0.3
NP_440226.1_1 Forward -150 -131 7.57094 0.103
NP_440150.1_6 Reverse -56 -75 9.93088 0.178
NP_443002.1_5 Forward -345 -327 12.8997 0.212
NP_442173.1_1 Reverse -142 -150 5.82095 0.2
NP_442752.1_4 Forward -150 -143 13.8055 0.0199
NP_443027.1_4 Forward -152 -142 8.04317 0.219
NP_440784.1_7 Reverse -142 -149 6.23397 0.241
NP_440784.1_7 Forward -149 -142 6.13563 0.241
NP_441934.1_8 Forward -71 -52 10.0292 0.292
NP_440061.1_9 Reverse -103 -117 7.07881 0.219
NP_440061.1_9 Forward -70 -56 6.58715 0.239
NP_440061.1_9 Reverse -130 -144 5.30886 0.29
NP_440110.1_8 Forward -239 -220 -1.08219 0.233
NP_441476.1_5 Reverse -211 -230 -0.4922 0.2
NP_441476.1_5 Forward -230 -211 -0.688862 0.2
NP_441476.1_5 Reverse -226 -245 -0.983855 0.2
NP_439979.1_2 Forward -234 -215 9.14423 0.238
NP_442062.1_8 Forward -150 -140 9.22315 0.0658
NP_442062.1_8 Forward -327 -317 5.5849 0.163
NP_441900.1_2 Reverse -209 -227 -2.53818 0.279
NP_441859.1_3 Forward -151 -132 15.0432 0.0704
NP_440304.1_4 Reverse -329 -339 3.02829 0.299
NP_442268.1_9 Reverse -329 -348 19.6656 0.181
NP_442242.1_4 Forward -149 -142 12.4288 0.0393
NP_440011.1_1 Forward -313 -294 11.6025 0.27
NP_439918.1_2 Forward -259 -240 3.83436 0.178
NP_441210.1_10 Reverse -54 -72 19.3903 0.235
NP_441594.1_6 Forward -336 -317 0.0977854 0.293
NP_441925.1_4 Reverse -244 -263 -11.8993 0.253
NP_440856.1_7 Forward -240 -221 -9.63698 0.294
NP_441083.1_5 Reverse -59 -69 -0.511621 0.269
NP_442827.1_8 Reverse -223 -242 0.883656 0.194
NP_441738.1_2 Reverse -143 -150 15.28 0.0102
NP_441558.1_7 Forward -391 -372 8.55425 0.276
NP_441955.1_8 Forward -333 -316 7.41366 0.279
NP_441645.1_9 Reverse -216 -235 17.8957 0.273
NP_440209.1_1 Forward -150 -142 14.8674 0.012
NP_440447.1_1 Forward -155 -137 7.4923 0.194
NP_441713.1_1 Reverse -53 -72 -15.5368 0.265
NP_441713.1_1 Forward -225 -206 -16.3235 0.28
NP_441770.1_1 Forward -347 -328 11.7983 0.277
NP_441792.1_5 Reverse -251 -267 12.6449 0.19
NP_441716.1_1 Reverse -59 -73 3.8345 0.259
NP_441716.1_1 Forward -120 -106 2.65453 0.298
NP_440343.1_9 Forward -270 -251 6.29264 0.3
NP_440851.1_6 Forward -18 -1 3.0871 0.288
NP_440906.1_5 Forward -149 -142 12.0355 0.0724
NP_440906.1_5 Reverse -142 -149 12.0355 0.0724
NP_440747.1_10 Forward -153 -141 -2.51763 0.0509
NP_440747.1_10 Forward -71 -59 -2.71429 0.0639
NP_441130.1_10 Forward -152 -138 18.2892 0.0142
NP_441486.1_1 Forward -237 -223 -4.22864 0.192
NP_441880.2_10 Forward -221 -203 9.0656 0.263
NP_440944.1_2 Reverse -99 -118 -3.14714 0.285
NP_442634.1_2 Reverse -135 -154 -0.590531 0.293
NP_441695.1_6 Reverse -29 -48 15.8307 0.218
NP_441014.1_5 Reverse -54 -72 16.1454 0.2
NP_441014.1_8 Reverse -214 -233 -8.94866 0.288
NP_442848.1_4 Forward -255 -241 16.4209 0.196
NP_442848.1_5 Reverse -212 -230 -1.55415 0.276
NP_441012.1_4 Reverse -61 -74 13.3923 0.217
NP_441012.1_4 Reverse -221 -234 7.00078 0.272
NP_443018.1_3 Forward -140 -133 10.2655 0.107
NP_443018.1_3 Reverse -60 -67 9.38056 0.128
NP_443018.1_3 Forward -149 -142 5.34899 0.212
NP_443018.1_3 Reverse -142 -149 5.34899 0.212
NP_441634.1_8 Forward -152 -138 6.3911 0.114
NP_441634.1_8 Forward -224 -210 5.50613 0.114
NP_441634.1_8 Forward -70 -56 -3.93365 0.295
NP_440376.1_1 Forward -68 -59 2.65466 0.216
NP_440376.1_1 Forward -150 -141 -0.000272808 0.285
NP_440376.1_1 Reverse -141 -150 -0.0986038 0.285
NP_442687.1_7 Forward -151 -141 5.19158 0.217
NP_442687.1_7 Forward -195 -185 4.3066 0.255
NP_442485.1_3 Reverse -211 -230 2.16274 0.215
NP_442485.1_3 Reverse -208 -227 0.786102 0.234
NP_442485.1_3 Forward -351 -332 -6.09707 0.299
NP_440609.1_6 Reverse -135 -154 15.4374 0.287
NP_440642.1_10 Forward -17 -3 1.47397 0.293
NP_441682.1_6 Forward -233 -214 11.7008 0.291
NP_441422.1_7 Forward -152 -135 -3.30441 0.233
NP_441422.1_7 Forward -329 -312 -5.1727 0.247
NP_440667.1_2 Forward -271 -252 -7.76869 0.285
NP_441950.1_8 Forward -238 -224 4.62115 0.292
NP_442658.1_1 Reverse -329 -339 14.0409 0.0273
NP_442658.1_1 Reverse -139 -149 13.5492 0.0364
NP_442658.1_1 Forward -152 -142 7.25606 0.214
NP_440141.1_8 Reverse -309 -328 10.1275 0.211
NP_440141.1_8 Reverse -132 -151 4.22769 0.292
NP_442782.1_2 Forward -360 -346 10.3243 0.174
NP_442782.1_2 Reverse -347 -361 0.392915 0.29
NP_442496.1_5 Forward -55 -37 4.44404 0.289
NP_442205.1_9 Reverse -204 -220 -2.89139 0.276
NP_442937.1_5 Forward -227 -208 16.6174 0.042
NP_442937.1_5 Forward -155 -136 6.98095 0.265
NP_442937.1_5 Forward -73 -54 6.09597 0.288
NP_441958.1_5 Forward -151 -141 -6.41148 0.28
NP_441127.1_1 Reverse -337 -351 17.6008 0.0924
NP_439905.1_1 Forward -149 -136 6.21414 0.295
NP_440984.1_7 Reverse -35 -49 6.58777 0.209
NP_440984.1_7 Reverse -54 -68 5.1128 0.27
NP_442690.1_1 Reverse -72 -91 -15.9302 0.282
NP_442911.1_2 Reverse -131 -150 -1.27885 0.0834
NP_440153.1_8 Reverse -213 -226 -3.02898 0.276
NP_440153.1_8 Reverse -324 -337 -3.4223 0.295
NP_441099.1_5 Forward -232 -213 -4.32711 0.145
NP_442002.1_9 Forward -151 -144 10.7572 0.185
NP_441294.1_1 Forward -119 -100 10.2259 0.279
NP_441294.1_7 Reverse -209 -223 11.5544 0.137
NP_441646.1_1 Forward -75 -56 -0.197208 0.259
NP_441646.1_7 Forward -339 -325 15.9292 0.234
NP_442431.1_10 Forward -233 -215 4.83737 0.206
NP_441292.1_2 Forward -272 -253 -6.39206 0.241
NP_441000.1_6 Reverse -140 -154 5.50613 0.0933
NP_442771.1_1 Reverse -229 -247 -8.73231 0.204
NP_440147.1_4 Forward -70 -57 4.64084 0.153
NP_440147.1_4 Reverse -208 -221 0.314277 0.257
NP_440147.1_4 Forward -152 -139 -0.669033 0.294
NP_441175.1_2 Forward -83 -64 7.57094 0.226
NP_441295.1_4 Reverse -60 -79 -1.08219 0.29
NP_441550.1_8 Reverse -57 -67 5.97777 0.22
NP_441916.1_7 Reverse -318 -328 2.43831 0.254
NP_441916.1_10 Reverse -3 -22 5.70265 0.208
NP_441916.1_10 Reverse -4 -23 0.58944 0.279
NP_440465.1_4 Reverse -140 -159 14.3558 0.184
NP_441041.1_4 Reverse -325 -344 -10.3253 0.231
NP_441041.1_4 Forward -271 -252 -13.5702 0.291
NP_439966.1_7 Forward -152 -142 8.14104 0.14
NP_439966.1_7 Reverse -139 -149 5.97777 0.199
NP_439966.1_7 Reverse -38 -48 5.28945 0.232
NP_439966.1_9 Reverse -139 -148 9.24284 0.253
NP_439966.1_9 Forward -152 -143 0.884706 0.253
NP_442941.1_3 Reverse -142 -152 1.06167 0.153
NP_440983.1_5 Reverse -213 -232 14.8474 0.0965
NP_440983.1_5 Reverse -210 -229 -1.47551 0.228
NP_440983.1_5 Reverse -216 -235 -8.35868 0.295
NP_440260.1_8 Forward -231 -213 -3.81576 0.257
NP_442281.1_1 Forward -155 -141 6.88214 0.113
NP_442281.1_1 Reverse -54 -68 2.5556 0.263
NP_442281.1_1 Forward -146 -132 2.06395 0.278
NP_442281.1_1 Forward -73 -59 2.06395 0.278
NP_442281.1_2 Reverse -216 -235 17.3057 0.124
NP_440437.1_1 Forward -83 -64 -2.55715 0.219
NP_441087.1_6 Forward -321 -303 -1.84987 0.273
NP_441457.1_7 Forward -224 -205 3.93269 0.229
NP_442288.1_3 Forward -196 -179 7.61033 0.257
NP_441556.1_4 Reverse -216 -235 16.7536 0.119
NP_441556.1_4 Reverse -213 -232 10.9692 0.261
NP_441644.1_6 Reverse -59 -69 13.6475 0.0181
NP_441644.1_6 Forward -150 -140 3.32285 0.288
NP_442215.1_2 Forward -77 -61 7.43336 0.0692
NP_442215.1_2 Reverse -56 -72 -6.13632 0.264
NP_442215.1_2 Reverse -329 -345 -6.52964 0.273
NP_442215.1_2 Forward -76 -60 -6.82463 0.28
NP_442215.1_2 Reverse -286 -302 -7.21796 0.289
NP_442029.1_8 Forward -320 -301 11.1109 0.252
NP_440929.1_8 Reverse -141 -150 7.86621 0.0522
NP_440929.1_8 Forward -150 -141 7.57121 0.0706
NP_442933.1_10 Forward -150 -141 5.40793 0.19
NP_441751.2_8 Reverse -142 -156 -2.75368 0.133
NP_442554.1_4 Reverse -281 -300 6.88262 0.291
NP_442554.1_8 Forward -67 -57 12.4681 0.0263
NP_442554.1_8 Reverse -142 -152 4.40493 0.188
NP_442554.1_8 Reverse -60 -70 4.20827 0.193
NP_442554.1_8 Reverse -94 -104 3.32329 0.23
NP_442554.1_8 Forward -149 -139 3.12662 0.239
NP_440133.1_10 Forward -230 -211 8.94757 0.181
NP_441762.1_7 Forward -151 -139 4.36554 0.0504
NP_441762.1_7 Reverse -140 -152 -5.07423 0.187
NP_442142.1_4 Forward -343 -330 4.54195 0.217
NP_442142.1_4 Reverse -56 -69 3.16532 0.265
NP_442292.1_1 Reverse -142 -151 -0.0986038 0.239
NP_442292.1_1 Forward -149 -140 -0.786921 0.287
NP_442292.1_5 Reverse -314 -333 0.884433 0.257
NP_440122.1_2 Reverse -57 -76 5.89931 0.234
NP_442476.1_6 Forward -149 -135 3.44117 0.156
NP_440895.1_6 Forward -156 -143 9.36073 0.224
NP_442381.1_8 Reverse -138 -157 -14.3569 0.28
NP_442406.1_9 Reverse -329 -348 -0.197208 0.291
NP_442301.1_2 Reverse -206 -225 11.2084 0.169
NP_442301.1_2 Reverse -209 -228 3.63691 0.292
NP_441715.1_4 Reverse -142 -152 9.12481 0.103
NP_440183.1_9 Reverse -320 -339 -15.5368 0.273
NP_440379.1_5 Forward -234 -215 3.14605 0.149
NP_440379.1_5 Forward -237 -218 -1.7705 0.192
NP_440379.1_5 Reverse -210 -229 -3.04881 0.204
NP_440379.1_5 Forward -321 -302 -6.78538 0.238
NP_440379.1_5 Forward -231 -212 -7.37537 0.243
NP_441468.1_1 Reverse -142 -149 6.13563 0.209
NP_441468.1_1 Forward -149 -142 6.0373 0.223
NP_441015.1_10 Forward -227 -208 -3.73712 0.191
NP_441673.1_1 Forward -150 -141 1.27803 0.155
NP_441673.1_1 Reverse -141 -150 1.27803 0.155
NP_441673.1_1 Reverse -210 -219 -7.86675 0.187
NP_441673.1_1 Forward -219 -210 -7.96508 0.206
NP_441731.1_3 Forward -76 -57 14.2574 0.159
NP_441426.1_3 Reverse -212 -231 9.04509 0.259
NP_441826.1_2 Reverse -59 -73 -3.83532 0.288
NP_441826.1_5 Forward -345 -326 14.6508 0.105
NP_441826.1_5 Forward -339 -320 7.47261 0.221
NP_441826.1_5 Reverse -325 -344 3.34271 0.271
NP_441637.1_9 Forward -24 -6 -2.83245 0.292
NP_442490.1_9 Forward -162 -143 -4.22878 0.259
NP_442490.1_9 Reverse -138 -157 -6.68705 0.273
NP_442868.1_6 Forward -152 -142 0.471689 0.226
NP_442719.1_2 Forward -354 -336 -9.02799 0.259
NP_442227.1_2 Reverse -212 -231 -1.18052 0.262
NP_442808.1_1 Reverse -140 -150 8.53436 0.0493
NP_442808.1_1 Reverse -317 -327 6.0761 0.131
NP_441101.1_1 Forward -224 -206 15.1621 0.231
NP_441101.1_10 Forward -154 -135 -6.68705 0.29
NP_442775.1_6 Forward -233 -214 19.3707 0.226
NP_440145.1_3 Forward -78 -59 -3.63879 0.206
NP_442542.1_2 Reverse -57 -70 6.90245 0.201
NP_442542.1_9 Reverse -134 -148 5.99717 0.255
NP_442342.1_1 Reverse -313 -327 16.5625 0.259
NP_442342.1_9 Forward -305 -289 6.25339 0.223
NP_440342.1_1 Reverse -321 -340 11.3075 0.279
NP_440558.1_2 Forward -349 -330 -0.983855 0.206
NP_440558.1_2 Forward -72 -53 -4.13045 0.243
NP_442789.1_4 Reverse -211 -230 10.0292 0.0942
NP_442789.1_4 Reverse -214 -233 -2.45882 0.237
NP_442789.1_4 Reverse -301 -320 -6.39206 0.285
NP_441878.1_6 Reverse -58 -68 10.4031 0.0176
NP_441878.1_6 Forward -75 -65 9.81313 0.0212
NP_441878.1_6 Forward -69 -59 0.668351 0.139
NP_441878.1_6 Forward -223 -213 -7.29646 0.217
NP_441036.1_6 Reverse -327 -345 8.27895 0.292
NP_441036.1_8 Reverse -140 -150 15.2213 0.0116
NP_441557.1_5 Reverse -141 -150 7.66954 0.0443
NP_441557.1_5 Forward -150 -141 0.983037 0.0911
NP_441445.1_1 Reverse -50 -69 1.47442 0.255
NP_441590.1_4 Reverse -235 -254 2.55527 0.293
NP_442419.1_2 Forward -233 -214 -5.01543 0.295
NP_440101.1_3 Forward -317 -298 2.75272 0.246
NP_442183.1_1 Forward -150 -136 10.9143 0.078
NP_442183.1_3 Reverse -74 -93 14.4533 0.243
NP_442166.1_3 Reverse -343 -362 -2.36049 0.211
NP_440979.1_3 Forward -149 -131 10.9339 0.235
NP_441574.1_1 Forward -234 -215 -5.60541 0.265
NP_440058.1_2 Forward -366 -347 -0.000545616 0.289
NP_441549.1_9 Forward -223 -205 -9.0273 0.241
NP_440547.1_1 Reverse -136 -155 8.4551 0.264
NP_441037.1_4 Forward -152 -142 5.85583 0.296
NP_441633.1_3 Forward -152 -139 3.26421 0.0709
NP_441633.1_3 Reverse -139 -152 -4.30728 0.191
NP_441633.1_3 Forward -329 -316 -5.88057 0.236
NP_441633.1_3 Forward -70 -57 -5.97891 0.236
NP_440136.1_2 Reverse -142 -149 6.23397 0.171
NP_440136.1_2 Forward -149 -142 6.13563 0.193
NP_442590.1_10 Reverse -318 -337 3.44104 0.293
NP_442998.1_5 Reverse -344 -354 8.04317 0.274
NP_442998.1_10 Reverse -143 -150 15.5754 0.0102
NP_440299.1_1 Reverse -137 -150 3.26365 0.251
NP_441799.1_1 Reverse -299 -313 4.22722 0.261
NP_441007.1_10 Reverse -136 -149 0.805932 0.216
NP_441007.1_10 Forward -224 -211 0.60927 0.221
NP_441007.1_10 Forward -227 -214 -0.669033 0.287
NP_442334.1_2 Forward -78 -61 -7.63097 0.297
NP_440256.1_1 Reverse -259 -278 -3.83545 0.14
NP_442961.1_4 Reverse -51 -70 10.1275 0.118
NP_441090.1_5 Forward -323 -305 16.4404 0.251
NP_441559.1_8 Reverse -313 -327 -5.90027 0.271
NP_441559.1_8 Forward -332 -318 -6.68692 0.279
NP_440915.1_6 Forward -72 -58 7.86607 0.0637
NP_440997.1_4 Reverse -211 -230 11.5042 0.276
NP_441179.1_9 Reverse -217 -227 9.321 0.28
NP_441464.1_8 Reverse -210 -224 6.6861 0.226
NP_441464.1_8 Reverse -231 -245 5.99778 0.248
NP_441464.1_10 Forward -255 -241 9.04604 0.265
NP_441939.1_3 Reverse -142 -161 11.5042 0.112
NP_440677.1_1 Reverse -219 -238 7.27595 0.241
NP_442386.1_9 Forward -151 -142 5.89917 0.233
NP_442386.1_9 Reverse -140 -149 4.81753 0.282
NP_440570.1_5 Forward -232 -213 10.9142 0.138
NP_440570.1_5 Reverse -335 -354 -0.688862 0.263
NP_440570.1_5 Reverse -194 -213 -2.85214 0.282
NP_441750.1_1 Reverse -331 -350 -7.86702 0.27
NP_441750.1_1 Forward -231 -212 -12.6852 0.3
NP_441340.1_5 Forward -149 -142 6.13563 0.175
NP_441340.1_5 Reverse -142 -149 5.93897 0.198
NP_442484.1_2 Forward -233 -214 -0.688862 0.271
NP_440168.1_4 Reverse -55 -74 -5.70374 0.255
NP_440168.1_4 Forward -78 -59 -6.29373 0.26
NP_440586.1_1 Forward -235 -216 -4.42544 0.278
NP_440586.1_8 Forward -149 -142 11.4451 0.0645
NP_440586.1_8 Reverse -263 -270 9.18354 0.171
NP_440586.1_8 Forward -140 -133 9.08521 0.178
NP_440586.1_8 Reverse -304 -311 5.64364 0.297
NP_440452.1_2 Forward -352 -333 14.4533 0.247
NP_442251.1_6 Reverse -142 -149 12.0355 0.0627
NP_442959.1_7 Forward -347 -328 2.0644 0.222
NP_441262.1_3 Forward -150 -143 14.7888 0.0223
NP_441262.1_3 Reverse -141 -148 5.15232 0.265
NP_440027.1_3 Forward -346 -328 8.57317 0.193
NP_440027.1_3 Reverse -59 -77 6.1149 0.23
NP_443051.1_1 Forward -151 -142 0.786375 0.125
NP_439996.1_2 Reverse -220 -239 9.43923 0.139
NP_439996.1_6 Forward -232 -213 6.45564 0.296
NP_439937.1_8 Forward -152 -133 5.11266 0.197
NP_439937.1_8 Forward -227 -208 -1.27885 0.249
NP_439937.1_8 Forward -230 -211 -2.55715 0.26
NP_439937.1_8 Reverse -223 -242 -3.54046 0.27
NP_439937.1_8 Forward -236 -217 -3.63879 0.271
NP_439937.1_8 Reverse -214 -233 -4.03212 0.276
NP_439937.1_9 Forward -328 -311 -11.7615 0.264
NP_439937.1_9 Forward -69 -52 -16.1864 0.287
NP_440626.1_1 Forward -149 -130 11.3067 0.217
NP_440439.1_1 Reverse -138 -151 -0.177378 0.209
NP_440439.1_1 Forward -153 -140 -0.275709 0.211
NP_442239.1_8 Forward -229 -210 5.70265 0.266
NP_440372.1_2 Forward -149 -142 6.72562 0.0929
NP_440372.1_2 Reverse -142 -149 6.62729 0.151
NP_441789.1_7 Reverse -211 -230 -4.03287 0.28
NP_441803.1_2 Reverse -214 -233 0.786102 0.244
NP_442384.1_10 Reverse -59 -72 7.09911 0.0875
NP_442114.1_4 Reverse -141 -152 12.2517 0.107
NP_442114.1_4 Forward -150 -139 8.02348 0.227
NP_441018.1_7 Forward -270 -251 7.86593 0.263
NP_442790.1_4 Forward -77 -58 -7.27704 0.152
NP_442262.1_10 Reverse -60 -67 9.47889 0.187
NP_442262.1_10 Forward -140 -133 9.18389 0.211
NP_440163.1_10 Reverse -222 -232 13.648 0.118
NP_440344.1_10 Reverse -221 -238 -13.2358 0.278
NP_440075.1_2 Forward -60 -41 1.67108 0.298
NP_440531.1_6 Forward -149 -130 -2.36049 0.249
NP_440297.1_9 Reverse -332 -342 1.06167 0.282
NP_440297.1_9 Forward -67 -57 -0.216628 0.282
NP_439926.1_7 Forward -287 -269 7.98396 0.204
NP_441592.1_4 Reverse -59 -78 -3.14714 0.275
NP_441592.1_7 Forward -355 -336 9.3409 0.234
NP_441896.1_3 Reverse -309 -328 4.81767 0.138
NP_441896.1_3 Reverse -132 -151 -0.39387 0.239
NP_440894.1_10 Reverse -313 -332 6.78429 0.211
NP_440999.1_9 Reverse -209 -223 0.687908 0.177
NP_440999.1_9 Reverse -137 -151 -1.37704 0.236
NP_440999.1_9 Forward -223 -209 -1.5737 0.242
NP_440888.1_2 Reverse -213 -227 8.06211 0.172
NP_440888.1_2 Forward -340 -326 5.01387 0.298
NP_440491.1_1 Reverse -210 -229 7.20938 0.274
NP_442033.1_10 Forward -329 -310 -9.34199 0.213
NP_441759.1_6 Reverse -129 -148 21.7306 0.0468
NP_441543.1_2 Reverse -142 -151 8.75118 0.0968
NP_441543.1_2 Forward -326 -317 5.40793 0.2
NP_441543.1_2 Forward -113 -104 4.71961 0.222
NP_442845.1_2 Forward -147 -133 5.89945 0.22
NP_442845.1_2 Forward -74 -60 5.1128 0.243
NP_441834.1_10 Forward -317 -298 0.58944 0.287
NP_441469.1_8 Reverse -230 -239 8.55452 0.227
NP_441469.1_8 Reverse -140 -149 6.78456 0.227
NP_441469.1_8 Forward -151 -142 6.29291 0.227
NP_442578.1_7 Forward -149 -142 5.93897 0.183
NP_441462.1_2 Forward -219 -209 -0.511621 0.236
NP_441462.1_2 Forward -68 -58 -1.19994 0.291
NP_441621.1_7 Reverse -139 -153 6.88276 0.068
NP_441621.1_7 Reverse -217 -231 3.04785 0.121
NP_441621.1_7 Reverse -214 -228 -4.4253 0.223
NP_441621.1_7 Reverse -211 -225 -5.9986 0.27
NP_443062.1_6 Forward -283 -264 1.0811 0.28
NP_441410.1_4 Forward -262 -243 8.06178 0.297
NP_440519.1_8 Reverse -331 -347 2.32015 0.266
NP_442204.1_1 Forward -72 -61 2.71361 0.266
NP_442204.1_1 Forward -154 -143 1.82863 0.266
NP_441351.1_8 Forward -348 -329 2.45773 0.251
NP_442487.1_5 Reverse -121 -140 6.88182 0.198
NP_440516.1_8 Forward -150 -141 8.25953 0.0391
NP_442428.1_5 Reverse -142 -149 6.13563 0.209
NP_442428.1_5 Forward -149 -142 6.0373 0.212
NP_442428.1_8 Forward -232 -213 -0.197208 0.271
NP_440673.1_2 Forward -350 -331 14.5843 0.0986
NP_440673.1_3 Reverse -143 -150 12.4288 0.0426
NP_440718.1_1 Reverse -246 -265 16.9115 0.199
NP_441052.1_2 Reverse -213 -223 4.3066 0.161
NP_441052.1_2 Reverse -59 -69 3.91327 0.17
NP_440436.1_4 Reverse -142 -151 14.9456 0.0103
NP_440436.1_4 Forward -149 -140 5.80084 0.182
NP_441884.1_9 Forward -153 -134 -14.1602 0.138
NP_441884.1_9 Reverse -210 -229 -20.7484 0.205
NP_441719.1_4 Forward -149 -142 6.72562 0.093
NP_441719.1_4 Reverse -142 -149 6.62729 0.151
NP_441004.1_1 Forward -228 -209 -12.9802 0.251
NP_441004.1_1 Forward -237 -218 -16.3235 0.284
NP_441004.1_1 Forward -246 -227 -17.5035 0.292
NP_441004.1_1 Forward -234 -215 -18.1918 0.298
NP_441004.1_2 Reverse -335 -354 6.09597 0.182
NP_441004.1_2 Forward -233 -214 -2.26216 0.264
NP_441004.1_5 Forward -226 -212 7.07942 0.292
NP_442366.1_3 Reverse -140 -158 4.54237 0.0961
NP_442873.1_3 Reverse -368 -387 6.09517 0.24
NP_441729.1_1 Reverse -332 -351 21.3373 0.0555
NP_441115.1_9 Reverse -314 -332 16.8337 0.0979
NP_442206.1_1 Forward -68 -49 -10.522 0.219
NP_442206.1_10 Forward -150 -135 3.71647 0.181
NP_440328.1_4 Forward -156 -137 1.86774 0.213
NP_441851.1_10 Forward -151 -141 6.07655 0.187
NP_441851.1_10 Reverse -140 -150 4.69992 0.254
NP_442814.1_2 Forward -316 -297 5.89931 0.259
NP_441501.1_6 Forward -157 -138 12.6841 0.288
NP_442856.1_7 Forward -77 -58 -4.72043 0.265
NP_442515.1_1 Reverse -209 -223 1.47456 0.158
NP_442515.1_1 Reverse -287 -301 -1.8687 0.266
NP_440593.1_3 Forward -344 -325 -5.31042 0.259
NP_440593.1_3 Reverse -211 -230 -5.9004 0.268
NP_440463.1_8 Forward -232 -213 20.6664 0.052
NP_440463.1_8 Forward -229 -210 7.59671 0.264
NP_442689.1_8 Reverse -76 -93 0.0388413 0.191
NP_441349.1_10 Reverse -200 -219 -7.08038 0.242
NP_442843.1_1 Reverse -133 -152 0.982764 0.17
NP_439960.1_10 Forward -229 -211 4.34571 0.161
NP_439960.1_10 Forward -232 -214 -2.93078 0.262
NP_440474.1_8 Reverse -226 -240 8.3571 0.189
NP_440474.1_8 Forward -149 -135 7.76712 0.199
NP_440474.1_8 Reverse -232 -246 4.03056 0.294
NP_441477.1_5 Forward -72 -53 6.98095 0.277
NP_441477.1_10 Reverse -58 -76 2.0841 0.25
NP_440588.1_2 Forward -159 -140 0.0977854 0.149
NP_440588.1_2 Forward -77 -58 -4.81876 0.23
NP_440954.1_1 Forward -333 -314 -3.44213 0.257
NP_442006.1_2 Forward -306 -289 -15.6941 0.228
NP_442006.1_3 Forward -74 -56 -7.15901 0.298
NP_441003.1_9 Forward -77 -58 7.37428 0.234
NP_441003.1_9 Forward -23 -4 5.40766 0.264
NP_440078.1_4 Reverse -94 -113 9.43923 0.295
NP_440078.1_10 Reverse -59 -78 4.32602 0.253
NP_441078.1_4 Reverse -141 -150 0.0980582 0.205
NP_441078.1_4 Forward -150 -141 0.0980582 0.205
NP_441078.1_4 Forward -327 -318 -0.983583 0.213
NP_441078.1_4 Forward -68 -59 -1.6719 0.266
NP_441078.1_4 Reverse -59 -68 -1.77023 0.266
NP_441078.1_4 Forward -222 -213 -1.86856 0.272
NP_441078.1_4 Reverse -318 -327 -1.96689 0.282
NP_442388.1_3 Forward -80 -61 14.5524 0.152
NP_442388.1_4 Reverse -221 -240 12.3883 0.23
NP_441663.1_8 Forward -74 -55 0.196116 0.223
NP_442348.1_2 Forward -298 -289 11.8978 0.225
NP_442443.1_1 Forward -344 -325 -6.68705 0.295
NP_442443.1_1 Forward -320 -301 -6.98204 0.299
NP_440793.1_1 Forward -18 -4 19.8618 0.147
NP_440793.1_5 Forward -64 -46 27.5518 0.003
NP_441432.1_8 Forward -69 -60 3.44131 0.245
NP_441732.1_2 Reverse -206 -222 -7.41462 0.0849
NP_442343.1_5 Reverse -134 -153 11.7983 0.236
NP_441030.1_6 Reverse -301 -320 14.8731 0.184
NP_440629.1_6 Forward -156 -137 12.5054 0.289
NP_440760.1_1 Reverse -213 -232 -15.7335 0.154
NP_442797.1_1 Forward -347 -328 -0.197208 0.223
NP_441131.1_9 Forward -231 -212 10.7175 0.164
NP_440131.1_1 Reverse -49 -68 12.6841 0.082
NP_441945.1_10 Forward -235 -216 7.47261 0.284
NP_440713.1_4 Forward -141 -122 0.884433 0.3
NP_442489.1_7 Reverse -141 -150 0.786375 0.152
NP_442489.1_7 Forward -150 -141 0.589713 0.17
NP_442489.1_7 Forward -222 -213 -1.37691 0.195
NP_442489.1_7 Reverse -59 -68 -1.57357 0.213
NP_442489.1_7 Forward -68 -59 -1.6719 0.235
NP_442489.1_7 Reverse -318 -327 -1.6719 0.235
NP_442489.1_7 Forward -327 -318 -1.96689 0.28
NP_440757.1_7 Forward -227 -209 1.29745 0.269
NP_440757.1_7 Forward -317 -299 -0.472507 0.269
NP_442079.1_7 Forward -67 -48 0.58944 0.277
NP_440559.1_1 Reverse -142 -151 5.50626 0.14
NP_442763.1_10 Forward -345 -326 5.80098 0.26
NP_441659.2_8 Forward -150 -140 5.28991 0.112
NP_441659.2_8 Reverse -213 -223 3.42162 0.161
NP_441659.2_8 Reverse -59 -69 3.22496 0.169
NP_441022.1_1 Reverse -348 -357 10.7788 0.285
NP_441040.1_2 Forward -76 -57 -2.26216 0.139
NP_441040.1_2 Forward -335 -316 -12.7836 0.262
NP_442008.1_2 Reverse -56 -75 3.93269 0.245
NP_442346.1_5 Forward -151 -141 6.37155 0.205
NP_442346.1_5 Reverse -58 -68 6.17489 0.212
NP_442346.1_5 Forward -69 -59 5.5849 0.238
NP_442346.1_5 Reverse -110 -120 5.38824 0.248
NP_440545.1_3 Forward -72 -55 0.825489 0.131
NP_440545.1_3 Forward -154 -137 -4.38605 0.224
NP_440545.1_3 Reverse -299 -316 -5.27103 0.245
NP_440545.1_3 Reverse -55 -72 -5.36936 0.247
NP_440545.1_3 Reverse -314 -331 -5.46769 0.25
NP_440545.1_3 Reverse -206 -223 -6.746 0.287
NP_440545.1_3 Forward -316 -299 -7.13932 0.298
NP_441856.1_7 Forward -231 -212 9.43923 0.292
NP_440831.1_1 Forward -360 -341 10.4225 0.277
NP_441923.1_8 Forward -16 -2 11.8976 0.286
NP_440250.1_4 Reverse -73 -92 8.55343 0.222
NP_440459.1_2 Reverse -322 -339 7.41366 0.291
NP_440010.1_4 Reverse -209 -228 9.24175 0.169
NP_440010.1_4 Forward -154 -135 2.06362 0.227
NP_440010.1_4 Forward -232 -213 0.883656 0.243
NP_440010.1_4 Reverse -212 -231 -0.492971 0.255
NP_440010.1_6 Forward -233 -214 3.24438 0.26
NP_442551.1_4 Reverse -63 -78 -3.46169 0.29
NP_442311.1_4 Forward -227 -208 10.9142 0.127
NP_442311.1_4 Forward -230 -211 6.98095 0.254
NP_440847.1_8 Reverse -95 -114 11.7008 0.281
NP_441233.1_2 Forward -230 -211 20.649 0.122
NP_441585.1_2 Forward -165 -146 16.6174 0.201
NP_441888.1_7 Forward -332 -318 0.392915 0.299
NP_441833.1_4 Reverse -142 -149 14.1004 0.0258
NP_441833.1_4 Forward -149 -142 6.13563 0.198
NP_442162.1_9 Reverse -142 -149 6.62729 0.142
NP_442162.1_9 Forward -149 -142 6.52896 0.178
NP_442796.1_2 Forward -64 -45 14.7847 0.24
NP_440671.1_4 Reverse -219 -233 5.21113 0.289
NP_440772.1_6 Forward -149 -130 11.0125 0.212
NP_442045.1_5 Forward -349 -330 2.0644 0.261
NP_442199.1_5 Forward -110 -91 -1.7705 0.181
NP_442199.1_5 Forward -158 -139 -2.36049 0.185
NP_442140.1_3 Forward -149 -139 16.9913 0.0255
NP_442140.1_3 Reverse -142 -152 4.79825 0.238
NP_442140.1_3 Reverse -60 -70 3.42162 0.297
NP_441671.1_10 Reverse -326 -345 0.196116 0.281
NP_440875.1_9 Reverse -143 -153 17.327 0.0126
NP_441813.1_5 Forward -152 -142 9.61647 0.027
NP_441813.1_5 Reverse -139 -149 -0.314959 0.239
NP_440590.1_4 Reverse -142 -155 0.805932 0.143
NP_440590.1_4 Forward -326 -313 -4.60227 0.263
NP_440567.1_1 Forward -149 -135 -0.295402 0.276
NP_442497.1_10 Reverse -142 -151 0.688044 0.141
NP_440821.1_4 Reverse -139 -149 8.4365 0.0503
NP_440821.1_4 Forward -152 -142 0.373358 0.18
NP_441239.1_9 Reverse -57 -69 13.3137 0.037
NP_441239.1_9 Reverse -329 -341 12.1337 0.0494
NP_441239.1_9 Reverse -139 -151 9.38042 0.108
NP_441892.1_1 Forward -83 -66 2.00546 0.145
NP_441892.1_4 Reverse -323 -342 8.16093 0.114
NP_440665.1_1 Reverse -213 -232 3.14605 0.149
NP_440665.1_1 Forward -237 -218 -11.7019 0.244
NP_440665.1_1 Reverse -216 -235 -16.4218 0.288
NP_442193.1_1 Forward -234 -216 11.8189 0.223
NP_442193.1_3 Forward -366 -347 14.729 0.299
NP_440833.1_6 Reverse -235 -249 12.3887 0.194
NP_443035.1_10 Reverse -134 -151 5.9387 0.273
NP_440546.1_4 Forward -68 -58 11.5973 0.0774
NP_440546.1_4 Forward -317 -307 9.3673 0.142
NP_440675.1_1 Forward -123 -104 5.80098 0.21
NP_440462.1_6 Forward -152 -142 7.64985 0.0705
NP_440868.1_4 Forward -154 -142 7.70879 0.0648
NP_440868.1_4 Reverse -137 -149 4.26721 0.122
NP_442499.1_1 Forward -73 -54 4.916 0.226
NP_442402.1_4 Reverse -178 -197 -4.42619 0.225
NP_440696.1_3 Reverse -65 -83 -3.6191 0.287
NP_440843.1_8 Forward -246 -227 12.1925 0.297
NP_440825.1_7 Forward -366 -356 12.6169 0.155
NP_442837.1_3 Reverse -142 -149 6.13563 0.25
NP_442837.1_3 Forward -149 -142 5.93897 0.265
NP_440505.1_3 Forward -152 -142 14.6313 0.019
NP_440505.1_7 Forward -226 -207 5.99764 0.178
NP_440505.1_7 Forward -316 -297 -2.26216 0.289
NP_442360.1_5 Reverse -297 -307 13.4514 0.278
NP_440351.1_1 Forward -64 -45 0.392778 0.204
NP_441252.1_6 Reverse -343 -350 11.9372 0.25
NP_442471.1_10 Reverse -216 -235 9.3409 0.244
NP_442532.1_7 Forward -150 -136 13.4709 0.0849
NP_441011.1_8 Reverse -142 -151 7.17789 0.179
NP_442533.1_6 Reverse -59 -68 13.5694 0.021
NP_442533.1_6 Forward -68 -59 6.78456 0.103
NP_442533.1_6 Reverse -213 -222 5.60459 0.137
NP_442533.1_6 Reverse -65 -74 4.0313 0.194
NP_442533.1_6 Forward -222 -213 3.7363 0.204
NP_442533.1_6 Reverse -210 -219 2.65466 0.246
NP_442541.1_10 Forward -340 -326 2.75226 0.254
NP_442232.1_3 Forward -158 -139 -9.047 0.242
NP_442229.1_1 Reverse -139 -153 11.602 0.18
NP_443016.1_1 Forward -74 -55 0.786102 0.193
NP_441482.1_7 Forward -156 -142 -10.7185 0.213
NP_439944.1_9 Forward -149 -139 6.17489 0.192
NP_442269.1_10 Forward -265 -246 8.35759 0.194
NP_441749.1_7 Reverse -322 -341 8.55425 0.275
NP_441028.1_6 Forward -11 -1 3.8145 0.281
NP_442664.1_3 Forward -383 -369 15.2409 0.246
NP_441527.1_4 Forward -55 -36 -5.77769 0.208
NP_440115.1_6 Forward -153 -143 7.64985 0.146
NP_441059.1_2 Reverse -346 -365 -7.4737 0.291
NP_441602.1_3 Forward -332 -313 -2.85214 0.239
NP_441972.1_5 Reverse -214 -233 2.16274 0.121
NP_441972.1_5 Reverse -211 -230 -6.88371 0.238
NP_441106.1_1 Forward -151 -142 8.35786 0.0585
NP_441106.1_1 Reverse -140 -149 5.70292 0.131
NP_440429.1_9 Reverse -65 -84 0.491109 0.297
NP_441286.1_1 Forward -69 -57 -4.77924 0.175
NP_441286.1_1 Forward -151 -139 -6.45087 0.265
NP_440670.1_8 Reverse -141 -150 13.2744 0.0157
NP_440670.1_8 Forward -150 -141 7.37455 0.0774
NP_440886.1_7 Reverse -212 -222 15.9091 0.0203
NP_440886.1_7 Forward -151 -141 4.60114 0.227
NP_442614.1_2 Forward -68 -54 11.8976 0.176
NP_442614.1_2 Reverse -210 -224 8.84938 0.244
NP_442382.1_7 Reverse -249 -268 5.99764 0.247
NP_442072.1_9 Forward -341 -323 -22.9903 0.271
NP_442963.1_3 Reverse -303 -321 14.0805 0.273
NP_442963.1_9 Reverse -71 -89 15.2604 0.3
NP_440907.2_8 Forward -149 -139 5.97777 0.182
NP_441021.1_1 Reverse -214 -233 -12.4886 0.288
NP_440326.1_5 Forward -22 -9 14.0806 0.229
NP_441626.1_2 Forward -149 -142 6.0373 0.212
NP_441626.1_2 Reverse -142 -149 6.0373 0.212
NP_442365.1_5 Forward -67 -48 6.98095 0.264
NP_442615.1_1 Forward -159 -141 -4.11075 0.177
NP_441962.1_4 Reverse -211 -230 -10.817 0.232
NP_441962.1_4 Forward -242 -223 -12.2919 0.255
NP_441962.1_4 Forward -155 -136 -15.0452 0.297
NP_440387.1_1 Forward -150 -134 -4.46469 0.187
NP_440387.1_1 Reverse -228 -244 -5.84132 0.254
NP_440855.1_1 Reverse -213 -232 5.99764 0.148
NP_440855.1_1 Forward -234 -215 -0.787193 0.266
NP_441521.1_2 Reverse -30 -47 15.3777 0.296
NP_441836.1_2 Reverse -53 -72 -0.983855 0.215
NP_441836.1_2 Reverse -207 -226 -4.42544 0.255
NP_441193.1_1 Reverse -249 -268 11.7 0.229
NP_441993.1_1 Forward -228 -209 2.33652 0.26
NP_442224.1_1 Reverse -211 -230 -0.590531 0.233
NP_440814.1_8 Forward -47 -28 6.98095 0.269
NP_441858.1_2 Forward -84 -65 13.5438 0.228
NP_440293.1_3 Forward -75 -56 -4.52377 0.264
NP_440293.1_3 Forward -230 -211 -5.80207 0.282
NP_440766.1_4 Reverse -137 -151 0.294584 0.291
NP_439988.1_3 Forward -72 -58 13.1759 0.191
NP_439988.1_3 Reverse -334 -348 4.03116 0.296
NP_442103.1_2 Forward -321 -303 12.8014 0.235
NP_440798.1_2 Forward -350 -336 14.7486 0.254
NP_441984.1_3 Reverse -209 -227 5.82068 0.276
NP_442509.1_9 Reverse -141 -151 12.0743 0.105
NP_440554.1_4 Reverse -142 -152 6.96153 0.107
NP_440554.1_4 Forward -149 -139 5.38824 0.15
NP_442228.1_10 Forward -232 -213 11.7992 0.255
NP_442341.1_7 Reverse -212 -226 8.94771 0.0801
NP_442341.1_7 Reverse -317 -331 8.84938 0.0822
NP_441173.1_9 Reverse -355 -363 11.0321 0.228
NP_441173.1_9 Reverse -189 -197 9.75379 0.284
NP_442395.2_4 Reverse -230 -249 17.1082 0.0407
NP_440423.1_3 Forward -386 -367 10.6192 0.28
NP_443000.1_7 Forward -152 -142 1.74999 0.229
NP_440275.1_3 Reverse -139 -149 15.2213 0.0182
NP_440275.1_3 Forward -152 -142 5.78156 0.131
NP_440091.1_1 Reverse -137 -149 8.00379 0.0714
NP_440679.1_2 Reverse -134 -152 11.3272 0.281
NP_440679.1_10 Forward -232 -213 -21.7317 0.297
NP_442686.1_9 Reverse -130 -149 11.3067 0.231
NP_439962.1_4 Forward -233 -214 0.0977854 0.197
NP_439962.1_4 Forward -230 -211 -0.4922 0.199
NP_439962.1_4 Reverse -329 -348 -4.13045 0.267
NP_439962.1_4 Reverse -211 -230 -4.52377 0.271
NP_439962.1_4 Reverse -214 -233 -5.50708 0.28
NP_439962.1_4 Reverse -208 -227 -6.09707 0.28
NP_439962.1_4 Reverse -40 -59 -6.09707 0.28
NP_439962.1_4 Reverse -313 -332 -7.37537 0.288
NP_439962.1_4 Reverse -133 -152 -8.16202 0.292
NP_439962.1_4 Forward -158 -139 -9.14533 0.299
NP_440175.1_7 Reverse -327 -345 11.2174 0.235
NP_440175.1_7 Forward -234 -216 9.85107 0.276
NP_440149.1_8 Forward -240 -221 -4.32711 0.206
NP_441105.1_3 Forward -161 -142 2.94938 0.0949
NP_441105.1_3 Forward -79 -60 -5.40875 0.219
NP_441105.1_3 Reverse -320 -339 -8.26035 0.269
NP_440216.1_1 Reverse -141 -155 -3.83532 0.09
NP_440216.1_1 Reverse -318 -332 -10.6202 0.145
NP_440216.1_9 Reverse -61 -70 5.89959 0.289
NP_440172.1_1 Forward -317 -307 2.53664 0.277
NP_442015.1_10 Forward -72 -59 -0.767364 0.281
NP_442015.1_10 Forward -154 -141 -0.865694 0.285
NP_441111.1_7 Reverse -142 -150 8.96754 0.0463
NP_441766.1_2 Reverse -141 -150 6.5879 0.0918
NP_442417.1_5 Forward -234 -220 6.58777 0.216
NP_440416.1_9 Forward -157 -138 -14.7502 0.18
NP_440416.1_9 Forward -75 -56 -20.1584 0.282
NP_443052.1_8 Reverse -4 -23 -13.8652 0.299
NP_443052.1_9 Reverse -320 -339 -3.14714 0.245
NP_443052.1_9 Forward -344 -325 -5.60541 0.271
NP_442116.1_6 Reverse -270 -287 6.35461 0.28
NP_442403.1_9 Forward -153 -134 8.94757 0.191
NP_442154.1_1 Forward -230 -212 -4.50408 0.125
NP_442154.1_1 Forward -233 -215 -7.94566 0.151
NP_442154.1_1 Forward -247 -229 -16.0088 0.229
NP_442154.1_6 Forward -229 -210 4.81767 0.234
NP_442154.1_6 Forward -226 -207 2.16274 0.234
NP_442564.1_10 Reverse -337 -351 8.55439 0.296
NP_440261.1_5 Forward -67 -54 4.54251 0.0567
NP_440261.1_5 Forward -311 -298 -2.73398 0.0924
NP_440261.1_5 Reverse -142 -155 -12.4687 0.297
NP_440988.1_10 Reverse -57 -71 7.7064 0.215
NP_440988.1_10 Forward -224 -210 7.02871 0.224
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCCAGAGTTTAAGCAGACCTATCTGGGGTTGATTCGTTTGCAAAACGCTTTGCCCCAAGTGCCAGTGCCGCCGGCTATTGACGCCGATGTGTTGGCCCAGAGGGTATTTGCCAAACTAGAGCAGGAAAATCGTTGGCGTGGTATTTGGTTCTGGGGTAGTGTGACTGCCGCCGCTGTGGTGGTGGCCGCCTACTCTAGTATTCTGGGTAAACCCTTGGTTCCTTCTCTGAATCAGGCTAATTTGGACCCGGCGATCGTAGCCATGGATGAAGATCCTTTGATGGTTGCCATCCACGAGCCGATGTTTGAAGTGTTAACCAAAGTGGACCCTGGCCATGGGCCCGAAAATGAGGGAGCGGAACAAGGGCTGCATTAATTTGATTGTTGCTTTGCCCCTGG

CDS

ATGATTAATTTGGTTGAATTTAATCTGTTTTTAGATTTACTTGGTAGTGCCCTGTTGCTATCTCTGCCGTGGCTCCTGTTGGGAATTATCATTTCTAGTACTTTCCTAATTTGGACCGATGAGCAGAAATGGGTGGCTAATTTCCCCCGCAATCGTTTGCTCAGTAGTTTGGTGGGAAGCGCCCTCGGTTTTCTGCTGCCTCTGGGGGCTTTTGGTAGTGTGCCCTTAGTGAGGCGTTTACTTTTACAGGGAGCTCCCATTCCTTTGGCTGTTAGTTTTTTAGTGGCAGCACCCACCTTGAATATTTTTGCCATTGTCAGGGTCTTATCTTCCCGTCAATCTCAGTACGGTCTAATTTTTCTTTGTATTTCTTGCAGTTGGTTGATGGCGATCGTGATGGGGTTAGTTTTTAGTACCTATCGACTGGCCCGTCAACAGGCAGAGGACGAGGGGGAAACGGCCCTGTTAAACATTCCCCTATTACGGTCAGGGGCTTTGATTATACTCCAATCTTCGATGGAGGCGTCCCCAAGGCAGGGAGGGTTGGTTTTTGCCAGTGGAGTTAATCCTGTGGCAGATTTTTCCTGGCGGCAAAAGTTACATCTTTTTGGTCGTAACATCATTGAGGAATTTCAGGAATTTGGTGGGGTGCTAGTCATCGGGACGGCGATCGCCTGTGGCATTGTCTTTTTCCTTCCCCAGGCGTGGTTACTACAATGGGCTGGATTGGGGCCGGTACGGCAAACTGTACTAATGATGGGTTGGTCGTTCATTTTACCCCTGGGAAATTTTAGTAACCCAGATTTATTGGCACCCCTGGGGGAACAACTCTGGCGAGGGTCCATGGTTGCTTTTTTATTATGGGGAAGTTTGTTTAATTTACAGACCATTGGACTCTGGTTAGTAACCCTGAGACTGCGGCCCTTGAGCTACTTAGTGGTGTTAGTGGGCTTATCAGTCTTTCTTTTTGCCATGGTGACTAATTACTACTTAAGTTAG

Protein

MINLVEFNLFLDLLGSALLLSLPWLLLGIIISSTFLIWTDEQKWVANFPRNRLLSSLVGSALGFLLPLGAFGSVPLVRRLLLQGAPIPLAVSFLVAAPTLNIFAIVRVLSSRQSQYGLIFLCISCSWLMAIVMGLVFSTYRLARQQAEDEGETALLNIPLLRSGALIILQSSMEASPRQGGLVFASGVNPVADFSWRQKLHLFGRNIIEEFQEFGGVLVIGTAIACGIVFFLPQAWLLQWAGLGPVRQTVLMMGWSFILPLGNFSNPDLLAPLGEQLWRGSMVAFLLWGSLFNLQTIGLWLVTLRLRPLSYLVVLVGLSVFLFAMVTNYYLS